Helicobacter pylori Shi470 uid59165

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|188526940|ref|YP_001909627.1| bacterioferritin comigratory protein [Helicobacter pylori Shi470]
    MEKLEVGQLAPDFRLKNSDGVEISLKDLLHKKVVLYFYPKDNTPGCTLEAKDFSDLFSEFEKKNAVVVGVSPDNAQSHQK
    FISQCSLNVILLCDEDKKAANLYKAYGKRMLYGKEHLGIIRSTFIINTQGVLEKCFYNVKAKDHAQKVLESL

    >gi|188527029|ref|YP_001909716.1| bifunctional methionine sulfoxide reductase A/B protein [Helicobacter pylori Shi470]
    MQANESMGSQHQKTDERVIYLAGGCFWGLEAYMERIYGVIDASSGYANGKTSSTNYEKLHESDHAESVKVVYDPKKISLD
    KLLRYYFKVIDPVSVNKQGNDVGRQYRTGIYYVNSADKEVIDHALKALQKEVKGKIAIEVEPLKNYVRAEEYHQDYLKKH
    PGGYCHIDLKKADEVIVDSDKYTKPSDEVLKKKLTKLQYEVTQNKHTEKPFENEYYNKEEEGIYVDITTGEPLFSSADKY
    DSGCGWPSFSKPINKDVVKYEDDESLNRKRIEVLSRIGKAHLGHVFNDGPKELGGLRY
    CINSAALRFIPLKDMEKEGYGE
    FIPYIKKGELKKYIQDKKNALRGND

    >gi|188527037|ref|YP_001909724.1| hypothetical protein HPSH_01200 [Helicobacter pylori Shi470]
    MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQDLKIVVIEDPDTKYNIPLVVS
    KDGNLIIGLSNIFFSNKSDDVQLVAETNQKVQALNATQQNSAKLNAIFNEIPADYAIELPSTNAENKDKILYIVSDPM
    CP
    HCQKELTKLRDHLKENTVRMVVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
    VENTTKKIFESGVIKGVPFLYHYKA

    >gi|188527186|ref|YP_001909873.1| copper-transporting ATPase [Helicobacter pylori Shi470]
    MKESFYIEGMTCTACSSGIERSLGRKSFVKKIEVSLLNKSANIEFDENQTNLDEIFKLIEKLGYSPKKTLAKEKKGFFSP
    NIKLALAVVFTLFVVYLSMGAMLSPSLLPESLLTIDNHSNFLNACLQLIGALIVMHLGRDFYIQGFKALWHRQPNMSSLI
    AIGTSAALISSLWPLYLVYTNQWSYGHYYFESVCVILMFVMVGKRIENVSKDKALDAMQALMKNAPKTALKMQNNQQIEV
    LVDSIVVGDILKVLPGSAIAVDGEIIEGEGELDESMLSGEALPVYKKVGDKVFSGTFNSHTSFLMKATQNNKNSTLSQII
    EMIHNAQSSKAEISRLADKVSSVFVPSVIAIAILAFVVWLIIAPKPDFWWNFGIALEVFVSVLVISCPCALGLATPMSIL
    VANQKASSLGLFFKDAKSLEKARLVNTIVFDKTGTLTNGKPVVKSVHSKIELLELLSLAGSIEKSSEHVIAKGIVEYAKE
    RNAPLKEMSEVKVKTGFGISAKTDYQGAKEIIKVGNSEFFNPINTLEIKENGILVFVGRAISEKEDELLGVFVLEDLPKK
    GVKEHIAQIKNLGINTLLLSGDNRENVKKCALELGIDGYISNAKPQDKLNKIKELKEKGQIVMMVGDGLNDAPSLAMSDV
    AVVMAKGSDVSVQAADIVSFNNDIKSVYSAIQLSRATIKNIKENLFWAFCYNSVFIPLACGVLYKANIMLSPAIAGLAMS
    LSSVSVVLNSQRLRNFKIKDH

    >gi|188527329|ref|YP_001910016.1| thioredoxin reductase [Helicobacter pylori Shi470]
    MIDCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQITGSSEIENYPGVKEVVSGLDFMQPWQEQCFRFGLKHEMTA
    VQRVSKKDSHFVILAEDGKTFEAKSVIIATGGSPKRTGIKGESEYWGKGVST
    CATCDGFFYKNKEVAVLGGGDTAVEEAI
    YLANICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLTPYVVEEIKGDASGVSSLSIKNTATNETRELIVPGFFIFVGYD
    VNNAVLKQEDGSMLCKCDEYGSIVVDFSMKTNVQGLFAAGDIRIFAPKQVVCAASDGATAALSVISYLEHH

    >gi|188527330|ref|YP_001910017.1| thioredoxin [Helicobacter pylori Shi470]
    MSHYIELTEENFESTIKKGVALVDFWAPWCGPCKMLSPVIDELASEYEGKAKVCKVNTDEQEELSAKFGIRSIPTLLFTK
    DGEVVHQLVGVQTKVALKEQLNKLLG

    >gi|188527365|ref|YP_001910052.1| cadmium-transporting ATPase [Helicobacter pylori Shi470]
    MQEYHIHNLDCPDCASKLERDLNKLDCVKKAQINFSTSKLFLDTSDFEKVKAFIKQNEPHLSLSFKEAAEKPLSFTPLII
    TILVFLGAILILHLNPSPFIEKAMFFVLAIVYLVSGKDVILGAFRGLRKGQFFDENALMLIATIAAFCVGAYEESVSIMV
    FYSAGEFLQKLAISRSKKSLKALVDVAPNLAYLKKGDALVSVAPEDLRVNDIVVVKVGEKVPVDGVVIKGESLLDERALS
    GESMPVNVSERSKVLGGSLNLKAVLEIKVEKMYKDSSIAKVVDLVQQATNEKSETEKFITKFSRYYTPSVLFIALMIAIL
    PPLFSMGSFDEWIYRGLVALMVSCPCALVISVPLGYFGGVGAASRKGILMKGVHVLEVLTQAKSIAFDKTGTLTKGVFKV
    IDIVPQNGHSKEEVLHYASCSQLLSTHPIALSIQKACEEMLKDDKHQHDIKNYEEVSGMGVKAQCDTDLIIAGNEKMLEQ
    FNIAHSPSPENGTIVHVAFNQTYVGYIVISDEIKDDAIECLRDLKAQGIENFCILSGDRKSATESIAQTLGCEYYASLLP
    EEKTSVFKTFKERYKAPAIFVGDGINDAPTLASADVGIGMGKGSELSKQSADIVITNDSLSSLVKVLAIAKKTKSIIWQN
    ILFALGIKAVFIVLGLMGVASLWEAVFGDVGVTLLALANSMRAMRA

    >gi|188527402|ref|YP_001910089.1| molybdopterin biosynthesis protein [Helicobacter pylori Shi470]
    MSEPIDRFTRIRWLFKNDFEKIRRQKVLICGVGGVGGFALDALYRVGIGQITIIDKDAFDVTNQNRQIGSERIGESKVLV
    LQDLYKGIQALNLHIDEAFLNSFNFRDYDYILDCMDDLPIKTSLAIKCQNFAYGKFISSMGSAKRLNPKHIQVGSVWESY
    GDKFGRKFRDFLKKRRFKGDFKVVFSPEVPH
    CIELGSFNAVTASFGLQIASEVVQDIIK

    >gi|188527477|ref|YP_001910164.1| methylated-DNA--protein-cysteine methyltransferase (dat1) [Helicobacter pylori Shi470]
    MFLYHYYFKTPKSFPLEYLHLCANESHLLRLDFDATNFSHNTPMNTPLKLSVQALERYFLGQLFEFNAPLDLIGTFFQKQ
    VWSALMTIPYGKTKSYDEIAKLINNPRSCRAIGNANRNNPISLIVP
    CHRVVRKNGALGGYNGGIEVKKWLLEFESKILNQ
    QAKNFLIS

    >gi|188527845|ref|YP_001910532.1| thiol peroxidase [Helicobacter pylori Shi470]
    MQKVTFKEETYQLEGKALEVGDKAPDVKLVNGDLQEVSLLKQGVRFQVISALPSLTGSVCLLQAKHFNEQAGKLPSVSFS
    VISMDLPFSQGQICGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEA
    LLKVLE

    >gi|188527858|ref|YP_001910545.1| hypothetical protein HPSH_05530 [Helicobacter pylori Shi470]
    MFSLSYVSKKFLSVLLLISLFLSACKSNNKDKLDENLLSSGSQSSKELNDERDNIDKKSYAGLEDIFSDNKSISPNDKYM
    LLVFGRNG
    CHYCERLKKDLKNVKELSDYVKEHFSAYYVNISYSKEHNFKVGDKDKNDEKEIKMSTEELAQIYAVQSTPTI
    VLSDKTGKTIYELPGYMPSTQFLAVLEFIGDGKYQDTKNDEDFTKKLKAYIKYKTNLSKNKSS

    >gi|188528010|ref|YP_001910697.1| hypothetical protein HPSH_06325 [Helicobacter pylori Shi470]
    MLEDYAISLEEVNFNDFIVVDVRELDEYEELHLPNATLISVNDQEKLADFLSQHKDKKVLLHCRAGRRALDAAKSMHALG
    YTPYYLEGDVYDFEKYGFRMVYDDACGKKN

    >gi|188528229|ref|YP_001910916.1| thioredoxin [Helicobacter pylori Shi470]
    MSEIINGKNYAEKIAHQAVVVNVGASWCPDCRKIEPIMENLAKTYKDKVEFFKVSFDESQDLKESLGIRKIPTLIFYKNG
    KEVGERLVEPGSSKPIEDAIKTLL

    >gi|188528273|ref|YP_001910960.1| putative cation transporting P-type ATPase [Helicobacter pylori Shi470]
    MKCSHCQLEFKESELFKEVINHKELYFCCTGCARVYALLSDLNLESFYDKLNDSTLAPVKPQDSMSALELEQALEENNKS
    DFILNLLLEKTH
    CNACLWLNQKVLERLKGVKKVSVNFTTHHLQIVFDKSLNPKEIVQKIESLGYGAKIYNAKNYALKAQK
    EQRSYLLTLSVGFFATMNLMFIAIAKYASYGAGMDKLMQRNLDLVSLFLSLLVLVVVGRFFIKGAFYGLKNGVLGMDLSV
    SFGALSAFVYSIYAMLVSQETYFEASSTILTLVFGSKFLELKARLFANEKCLALESHEIHSVIVVENGKQIEKHPKDVAI
    GSVVLVPSGAKIALDGALLNHASVDASLISGEFKPLELGVNDQILGGYVNVGAPFSYQVSANFQNSRLSSLLEILKKSFL
    EKPLIESSANKIADIFSKAVLFLAFISFLLWQFGLGGNFEKALMVCISVLVISCPCAFALATPIALVIGVFKNPLIVFKE
    ALFLETLAKVKKIFIDKTGTLTQKEVLLKEKIIYEEFDERLLKSLLKVREHLAHSAILKSLDSDEVHLEKIEFFAHGLKA
    NYHNETLLVGSLKFLNAMGVNIKAKESANIMVGFAKNKTLCALFVLEERLKNNAKEVIQALQDKGLELEILSGDNENSVK
    ECAKKLGISNYHANLTPEDKAQIISSYKGVCAMIGDGNNDALALKQASVSLGFEKSALSKSACDILLLEEDLSLLKKAFD
    NAQKVYQVVLQNIVLSLIYNAILIPVAMLGYINPLIASLSMSASSLLVVLNSLRLKRS

    >gi|188528355|ref|YP_001911042.1| putative peroxidase [Helicobacter pylori Shi470]
    MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGVILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVSIDSEQV
    HFAWKNTPVEKGGVGQVSFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALL
    HFEEHGEVCPAGWRKGDKGMKATHKGVAEYLKENSINL

    >gi|188527948|ref|YP_001910635.1| thioredoxin reductase [Helicobacter pylori Shi470]
    MNQEILDVLIVGAGPGGIATAVECEIAGVKKVLLCEKTESHSGMIEKFYKAGKRIDKDYKKQVVELKGHIPFKDSFKEET
    LENFTNLLKEHRITPSYKTDIESVKKEGEYFKITTTSNTTYHAKFVVVAIGKMGQPNRPTYKIPVALSKQVVFSIND
    CKE
    NEKTLVIGGGNSAVEYAIALCKTTPTTLNYRKKEFSRINEDNAKNLQEVLGNNTLKSKLGVDIESLEENGAQIKVNFTDN
    TSESFDRLLYAIGGSTPLEFFKRCSLELDPSTNIPVVKENLESNNIPNLFIVGDILFKSGASIATALNHGYDAAIEIAKR
    LQS