Helicobacter pylori PeCan4 uid53539

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|308182310|ref|YP_003926437.1| bacterioferritin comigratory protein [Helicobacter pylori PeCan4]
    MEKLEVGQLAPDFRLKNSDGVEISLKDLLHKKVVLYFYPKDNTPGCTLEAKDFSALFSEFEKKNAVVVGVSPDNAQSHQK
    FISQCSLNVILLCDEDKKAANLYKAYGKRMLYGKEHLGIIRSTFIINTQGVLEKCFYNVKAKGHAQKVLESL

    >gi|308182397|ref|YP_003926524.1| bifunctional methionine sulfoxide reductase A/B protein [Helicobacter pylori PeCan4]
    MKVLSYLKHFYLFLLIGAFMQANESKGSQHQKTDERVIYLAGGCFWGLEAYMERIYGVIDASSGYANGKTSSTNYENLHE
    SDHAESVKVIYDPKKISLDKLLRYYFKVIDPVSVNKQGNDVGRQYRTGIYYTNSADKEVIDHALKALQKEVKGKIAIEVE
    PLKNYVRAEEYHQDYLKKNPGGYCHIDLKKADEVIVDDDKYTKPSDEVLKKKLTKLQYEVTQNKHTEKPFENEYYNKEEE
    GIYVDITTGEPLFSSADKYDSGCGWPSFSKPINKDVVKYEDDESLNRKRIEVLSRIGKAHLGHVFNDGPKELGGLRY
    CIN
    SAALRFIPLKDMEKEGYGEFIPYIKKGELKKYIQDKKSH

    >gi|308182406|ref|YP_003926533.1| hypothetical protein HPPC_01170 [Helicobacter pylori PeCan4]
    MILRASVLSALLLVSLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQDLKMVVIEDPDTKYNIPLVVS
    KDGNLIIGLSNIFFSNKSDDVQLVAETNQKVQALNATQQNSAKLNAIFNEIPADYAIELPSTNAANKDKILYIVSDPM
    CP
    HCQKELTKLRDHLKENTVRMVVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
    VENTTKKIFESGMIKGVPFLYHYKA

    >gi|308182544|ref|YP_003926671.1| copper-transporting ATPase [Helicobacter pylori PeCan4]
    MKESFYIEGMTCTACSSGIERSLGRKSFVKKIEVSLLNKSANIEFDENQTNLDEIFKLIEKLGYSPKKTLAKEKKGFFSP
    NVKLALAVVFTLFVVYLSMGAMLSPSLLPESLLTIDNHSNFLNACLQLVGTLIVMHLGRDFYIQGFKALWHRQPNMSSLI
    AIGTSAALISSLWPLYLVYTNQWSYGHYYFESVCVILMFVMVGKRIENVSKDKALDAMQALMKNAPKTALKMQNNQQIEV
    LVDSIVVGDILKVLPGSAIAVDGEIIEGEGELDESMLSGEALPVYKKVGDKVFSGTLNSNTSFLMKATQNNKNSTLSQIV
    EMIHNAQSSKAEISRLADKVSSVFVPSVIAISILAFVVWLIIAPKPDFWWNFGIALEVFVSVLVISCPCALGLATPMSIL
    VANQKASSLGLFFKDAKSLEKARLVNTIVFDKTGTLTNGKPVVKSVHSKIELLELLSLALSIEKSSEHVIAKGIVEYAKE
    YNAPLKDISEVKVKTGFGISAKIDYQGTKEIIKVGNSEFFNPINTLEIQENGILVFVGRAIDEKEDELLGAFVLEDLPKK
    GVKEHIAQIKKLGINTLLLSGDNKENVQKCALELGIDGYISNAKPQDKLNKIKELKEKGRIVMMVGDGLNDAPSLAMSDV
    AVVMAKGSDVSVQAADIVSFNNDIKSVYSAIQLSQATIKNIKENLFWAFCYNSVFIPLACGILYKANIMLSPAIAGLAMS
    LSSVSVVLNSQRLRNFKIKDH

    >gi|308182835|ref|YP_003926962.1| methylated-DNA--protein-cysteine methyltransferase [Helicobacter pylori PeCan4]
    MVLYHYYFKTPKSFPLEYLHLCANESHLLRLDFDAANFSHNTPMNTPLKLSVQALERYFLGQLFEFNAPLDLIGTFFQKQ
    VWSALMTIPYGKTKSYDEIAKLINNPRSCRAIGNANRNNPISLIVP
    CHRVVRKNGALGGYNGGIEVKKWLLEFESKILNQ
    QAKNSLIS

    >gi|308182947|ref|YP_003927074.1| cadmium-transporting ATPase [Helicobacter pylori PeCan4]
    MQEYHIHNLDCPDCASKLERDLNKLDCVKKAQINFSTSKLFLDTSDFEKVKAFIKQNEPHLSLSFKEAAEKPLSFTPLII
    TIIVFLGAILILHLNPSPFIEKAMFFVLALVYLVSGKDVILGAFRGLRKGQFFDENALMLIATIAAFCVGAYEESVSIMV
    FYSAGEFLQKLAISRSKKSLKALVDVAPNLAYLKKGDALVSVAPEDLRVNDIVVVKVGEKVPVDGVVIKGESLLDERALS
    GESMPVNVSEYSKVLGGSLNLKAVLEIKVEKMYRDSSIAKVVDLVQQATNEKSETEKFITKFSRYYTPSVLFIALMIAVL
    PPLFSMGSFDEWIYRGLVALMVSCPCALVISVPLGYFGGVGAASRKGILMKGVHVLEVLTQAKSIAFDKTGTLTKGVFKV
    IDIVPQNGHSKEEVLHYASCSQLLSTHPIALSIQKACEEMLKNDKHQHDIKNYEEVSGMGVKAQCNTDLIIAGNEKMLDQ
    FHIAHSPSPENGTIVHVAFNQTYVGYIVISDEIKDDAIECLRDLKAQGIENFCILSGDRKSATESIAQTLGCEYYASLLP
    EEKTSVFKTFKERYKAPAIFVGDGINDAPTLASADVGIGMGKGSELSKQSADIVITNDSLNSLVKVLAIAKKTKSIIWQN
    ILFALGIKAVFIVLGLMGVASLWEAVFGDVGVTLLALANSMRAMRA

    >gi|308182983|ref|YP_003927110.1| thioredoxin [Helicobacter pylori PeCan4]
    MSHYIELTEENFESTIKKGVALVDFWAPWCGPCKMLSPVIDELASEYEGKAKICKVNTDEQEELSAKFGIRSIPTLLFTK
    DGEVVHQLVGVQTKVALKEQLNKLLG

    >gi|308182984|ref|YP_003927111.1| thioredoxin reductase [Helicobacter pylori PeCan4]
    MIDCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQITGSSEIENYPGVKEVVSGLDFMQPWQEQCFRFGLKHEMSA
    IQRVSKKDSHFVILAEDGKTFEAKSVIIATGGSPKRTGIKGESEYWGKGVST
    CATCDGFFYKNKEVAVLGGGDTAVEEAI
    YLANICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLTPYVVEEIKGDASGVSSLSIKNTATNETRELIVPGFFIFVGYD
    VNNAVLKQEDGSMLCKCDEYGSIVVDFSMKTNVQGLFAAGDIRIFAPKQVVCAASDGATAALSVISYLEHH

    >gi|308183168|ref|YP_003927295.1| thiol peroxidase [Helicobacter pylori PeCan4]
    MQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGARFQVVSALPSLTGSVCLLQAKHFNEQAGKLPSVSFS
    VISMDLPFSQGQICGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEA
    LLKVLKK

    >gi|308183182|ref|YP_003927309.1| hypothetical protein HPPC_05230 [Helicobacter pylori PeCan4]
    MFSLSYVSKKFLSVLLLISLFLSACKSSNKDKLDENLLSSGSQSSKELNDERDNIDKKSYAGLEDIFSDNKSISPNNKYM
    LLVFGRNG
    CHYCERFKKDLKNVKELHDYVKDHFSAYYVNISYSKEHDFKVGDKDKNDEKEIKMSTEELAQIYAVQSTPTI
    VLSDKTGKTIYELPGYMPSTQFLAVLEFIGDGKYQDTKNDEDFIKKLKAYIKYKTNLSKSKSS

    >gi|308183328|ref|YP_003927455.1| hypothetical protein HPPC_05975 [Helicobacter pylori PeCan4]
    MLEDYAISLEEVNFNDFIVVDVRELDEYEELHLPNATLISVNDQEKLADFLSQHKDKKVLLHCRAGRRALDAAKSMHELG
    YTPYYLEGNVYDFEKYGFRMVYDDISGKKN

    >gi|308183556|ref|YP_003927683.1| thioredoxin [Helicobacter pylori PeCan4]
    MSEIINGKNYAEKIAHQAVVVNVGANWCPDCKKIEPIMENLAKTYKGKVEFFKVSFDESQDLKESLGIRKIPTLIFYKNG
    KEVGERLVEPGSSKPIEDAIKTLL

    >gi|308183606|ref|YP_003927733.1| putative cation transporting P-type ATPase [Helicobacter pylori PeCan4]
    MKCSHCQLEFKESELFKEVINHKELYFCCTGCARVYALLSDLNLESFYDKLNDSTLAPVTPQDSMSALELEQALEENNKG
    DFILNLLLEKTH
    CNACLWLNQKVLERLKGVKKVSVNFTTHHLQIVFDKSLNPKEIVQKIESLGYGAKIYNAKNYALKAQK
    EQRSYLLTLSVGFFATMNLMFIAIAKYASYGSASYGVGMDKLMQRNLDLVSLFLSLLVLVVVGRFFIKGAFYGLKNGVLG
    MDLSVSFGALSAFVYSIYAMLVSQETYFEASSTILTLVFGSKFLELKARLFANEKCLALESHEIHSVIVVENGKQIEKHP
    KDVAIGSVVLVPSGAKIALDGALLNHASVDASLISGEFKPLELGVNDQILGGYVNVGAPFSYQVSANFQNSRLSSLLETL
    KKSFLEKPLIESSANKIADIFSKAVLFLAFISFLLWQFGLGGNFEKALMVCISVLVISCPCAFALATPIALVIGVFKNPL
    IVFKEALFLETLAKVKKIFIDKTGTLTQKEVLLKEKIIYEEFDERLLKSLLKTREHLAHSAILKSLDGDEVSLEKIEFFA
    HGLKANYHNETLLVGSLKFLNAMGVNIKAKESANIMVGFAKNKTLCALFVLEERLKNNAKEVIQALQDKGLELEILSGDN
    ENSVKECAKKLGISNYHANLTPEDKAQIISSYKGVCAMIGDGNNDALALKQASVSLGFEKSALSKSACDILLLEEDLSLL
    KKAFDNAQKVYQVVLQNIVLSLIYNAILIPVAMLGYINPLIASLSMSASSLLVVLNSLRLKRS

    >gi|308183718|ref|YP_003927845.1| alkyl hydroperoxide reductase [Helicobacter pylori PeCan4]
    MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQV
    HFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALL
    HFEEHGEVCPAGWRKGDKGMKATHKGVAEYLKENSINL