Helicobacter pylori P12 uid59327

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|210134335|ref|YP_002300774.1| bacterioferritin comigratory protein [Helicobacter pylori P12]
    MEKLEVGQLAPDFRLKNSDGVEISLKDLLHKKVVLYFYPKDNTPGCTLEAKDFSALFGEFEKKNAVVVGVSPDNAQSHQK
    FISQCSLNVILLCDEDKKAANLYKAYGKRMLYGKEHLGIIRSTFIINTQGVLEKCFYNVKAKGHAQKVLESL

    >gi|210134425|ref|YP_002300864.1| peptide methionine sulfoxide reductase [Helicobacter pylori P12]
    MKVLSYLKNFYLFLAIGAIMQANENMGSQHQKTDERVIYLAGGCFWGLEAYMERIYGVIDASSGYANGKTSSTNYEKLHK
    SDHAESVKVIYDPKKISLDKLLRYYFKVVDPVSVNKQGNDVGRQYRTGIYYVNSADKEVIDHALKALQKEVKGKIAIEVE
    PLKNYVRAEEYHQDYLKKHPGGYCHIDLKKADEVIVDDDKYTKPSHEVLKKKLTKLQYEVTQNKHTEKPFENEYYNKEEE
    GIYVDITTGEPLFSSADKYDSGCGWPSFSKPINKDVVKYEDDESLNRKRIEVLSRIGKAHLGHVFNDGPKELGGLRY
    CIN
    SAALRFIPLKDMEKEGYGEFIPYIKRGELKKYINDKKSH

    >gi|210134431|ref|YP_002300870.1| disulphide isomerase [Helicobacter pylori P12]
    MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQDLKMVVIEDPDTKYNIPLVVS
    KDGNLVIGLSNIFFSNKSEDVKLVAETNQKIQALNATQQNSAKLNAIFNEIPADYAIELPSTNAANKDKILYIVSDPM
    CP
    HCQKELTKLRDHLKENTVRMVVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
    VENTTKKIFESGVIKGVPFLYHYKA

    >gi|210134570|ref|YP_002301009.1| copper-transporting ATPase [Helicobacter pylori P12]
    MKESFYIEGMTCTACSSGIERSLGRKSFVKKIEVSLLNKSANIEFNENETNLDEIFKLIEKLGYSPKKTLAEEKKEFFSP
    NVKLALAVIFTLFVVYLSMGAMLSPSLLPESLLTINNHSNFLNACLQLIGTLIVMHWGRDFYIQGFKALWHKQPNMSSLI
    AIGTSAALISSLWQLHFVYTSQWSYGHYYFESVCVILMFVMVGKRIENVSKDKALDAMQALMKNAPKTALKMHNNQQIEV
    LVDSIVVGDILKVLPGSAIAVDGEIIEGEGELDESMLSGEALPVYKKVGDKVFSGTFNSHTSFLMKATQNNKNSTLSQIV
    EMIHNAQSSKAEISRLADKVSSVFVPSVIAIAVLAFVMWLIIAPKPDFWWNFGIALEVFVSVLVISCPCALGLATPMSIL
    VANQKASSLGLFFKDAKSLEKARLVNTIVFDKTGTLTNGKPVVKSVHSKIELLELLSLAGSIEKSSEHVIAKGIVEYAKE
    RNAPLKEMSEVKVKTGFGISAKTDYQGAKEVIKVGNSEFFNPINTLEIKENGILVFVGRAISEKEDELLGVFVLEDLPKK
    GVKEHIAQIKKLGINTFLLSGDNKENVQKCALELGIDGYISNAKPQDKLNKIKELKEKGQIVMMVGDGLNDAPSLAMSDV
    AVVMAKGSDVSVQAADIVSFNNDIKSVYSAIKLSQATIKNIKENLFWAFCYNSVFIPLACGVLYKANIMLSPAIAGLAMS
    LSSVSVVLNSQRLRNFKIKDH

    >gi|210134882|ref|YP_002301321.1| methylated-DNA-protein-cysteine methyltransferase [Helicobacter pylori P12]
    MVLYHYYFKTPKSFPLEYLHLCANESHLLRLDFDAANFSHNTPMNTPLKLSVQALERYFLGQLFEFNTPLDLIGTFFQKQ
    VWSALMTIPYGKTKSYDEIAKLINNPKSCRAVGNANRNNPISLIVP
    CHRVVRKNGTLGGYNGGIEVKKWLLEFESKILNE
    RAKNSLIS

    >gi|210134958|ref|YP_002301397.1| molybdopterin biosynthesis protein [Helicobacter pylori P12]
    MSEPIDRFTRIRWLFKNDFEKIRQQRILICGVGGVGGFVLDALYRVGIGQITIIDKDVFDVTNQNRQIGSERIGESKVLV
    LQDLYKGIQAFNCRIDEAFLNSFNFRDYDYILDCMDDLPIKTSLAIKCQNFAYGKFISSMGSAKRLNPKHIQVGSVWESY
    GDKFGRKFRDFLKKRRFKGDFKVVFSPEVPH
    CIELGSFNAVTASFGLQIASEVVQDIIK

    >gi|210134991|ref|YP_002301430.1| cadmium-transporting ATPase [Helicobacter pylori P12]
    MQEYHIHNLDCPDCASKLERDLNKLDYVKKAQINFSTSKLLLDTSDFEKVKDFIKQNEPHLSLSFKEAAEKPLSFTPLIT
    TIIVFLGAILILHLEPSPFIEKAVFFVLALVYLISGKDVILGAFRGLKKGQFFDENALMLIATIAAFCVGAYEESVSIMV
    FYSAGEFLQKLAIARSKKSLKALVDVAPNLAYLKKGDALVSVAPEDLRINDIVVVKVGEKVPVDGVVVKGESLLDERALS
    GESMPVNVSENSKVLGGSLNLKAVLEIKVEKMYKDSSIAKVVDLVQQATNEKSETEKFITKFSRYYTPSVLFIALMIAVL
    PPLFSMGSFDEWIYRGLVALMVSCPCALVVSVPLGYFGGVGAASRKGILMKGVHVLEVLTQAKSIAFDKTGTLTKGVFKV
    TDIVPQNGHSKEEVLHYASCSQLLSTHPIALSIQKACEEMLKDDKHQHDIKNYEEVSGMGVKAQCHTDLIIAGNEKMLDQ
    FHIVHSPSKENGTIVHVAFNQTYIGYIVISDEIKDDAIECLRDLKAQGIENFCILSGDRKSATESIAQTLGCEYYASLLP
    EEKTSVFKTFKERYKAPAIFVGDGINDAPTLASADVGIGMGKGSELSKQSADIVITNDSLSSLVKVLAIAKKTKSIIWQN
    ILFALGIKAVFIVLGLMGVASLWEAVFGDVGVTLLALANSMRAMRA

    >gi|210135024|ref|YP_002301463.1| thioredoxin [Helicobacter pylori P12]
    MSHYIELTEENFESTIKKGVALVDFWAPWCGPCKMLSPVIDELASEYEGKAKICKVNTDEQEELSAKFGIRSIPTLLFTK
    DGEVVHQLVGVQTKVALKEQLNKLLG

    >gi|210135025|ref|YP_002301464.1| thioredoxin reductase [Helicobacter pylori P12]
    MIDCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQITGSSEIENYPGVKEVVSGLDFMQPWQEQCFRFGLKHEMTA
    VQRVSKKDSHFVILAEDGKTFEAKSVIIATGGSPKRTGIKGESEYWGKGVST
    CATCDGFFYKNKEVAVLGGGDTAVEEAI
    YLANICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLTPYVVEEIKGDASGVSSLSIKNTATNETRELVVPGFFIFVGYD
    VNNAVLKQEDNSMLCKCDEYGSIVVDFSMKTDVQGLFAAGDIRIFAPKQVVCAASDGATAALSVISYLEHH

    >gi|210135223|ref|YP_002301662.1| thiol peroxidase [Helicobacter pylori P12]
    MQKVTFKEETYQLEGKTLKVGDKAPDVKLVNGDLQEVSLLKPGVRFQVISSLPSLTGSVCLLQAKHFNEQAGKLPSVSFS
    VISMDLPFSQGQICGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEA
    LLKVLK

    >gi|210135237|ref|YP_002301676.1| thiol:disulfide interchange protein [Helicobacter pylori P12]
    MFSLSYVSKKFLSVLLLISLFLSACKSNNKDKLDENLLSSGSQSSKELNDERDNIDKKSYTGLEDVFSDNKSISPNDKYM
    LLVFGRNG
    CSYCERLKKDLKNVKELHNYIKEHFSAYYVNISYSKEHDFKVGDKDKNDEKEIKMSTEELAQIYAVQSTPTI
    VLSDKTGKTIYELPGYMPSTQFLAVLEFIGDGKYQDTKNDEDLTKKLKAYIKYKTNLSKNKSS

    >gi|210135382|ref|YP_002301821.1| hypothetical protein HPP12_1189 [Helicobacter pylori P12]
    MLEDYAISLEEVNFNDFIVVDVRELDEYEELHLPNATLISVNDQEKLADFLSKHKDKKVLLHCRAGRRALDAAKSMHELG
    YTPYYLEGNVYDFEKYGFRMVYDDTSLSDKKDKKN

    >gi|210135625|ref|YP_002302064.1| thioredoxin [Helicobacter pylori P12]
    MLEVINEKNYAEKTAHQAVVVNVGASWCPDCRKIEPIMENLAKTYKGKVEFFKVSFDESQDLKESLGIRKIPTLIFYKNA
    KEVGERLVEPSSQKPIEDALKALL

    >gi|210135670|ref|YP_002302109.1| cation transporting P-type ATPase [Helicobacter pylori P12]
    MKCSHCQLEFKESELFKEVIHHKELYFCCTGCARVYTLLLDLNLESFYDKLNDSTLAPVTPQDSMSALELEQALEENNKG
    DFILNLLLEKTH
    CNACLWLNQKVLERLKGVKKVSVNFTTHHLQIVFDKSLNPKEIIQKIESLGYGAKIYNAKNYALKAQK
    EQRSYLLTLSVGFFATMNLMFIAIAKYASYGGASYGTGMDKLMQRNLDLVSLFLSLLVLVVVGRFFIKGAFYGLKNGVLG
    MDLSVSFGALSAFVYSVYAMLVSQETYFEASSTILTLVFGSKFLELKARLFANEKCLALESHEIHSVIVVENGKQIEKHP
    KDVAIGSVVWVPSGAKIALDGVLLSNASVDASLISGEFKPLELGVNDPILGGYVNVGVPFSYQVSATFQNSRLSSLLETL
    KKSFLEKPLIESSANQIADIFSKAVLFLAFVSFLLWQFGLGGNFEKALMVCISVLVISCPCAFALATPIALVIGVFKNPL
    IVFKEALFLETLAKAKKIFIDKTGTLTQKEVFLKEKIIYEEFDERLLKSLLKTREHLAHSAILKSLHGDEVDLEQIEFFA
    HGLKANYQNETLLVGSLKFLNAMGVDIPMKESANIMVGFAKNKTLCALFILEERLKANAKEVVQALQNQGLELEILSGDN
    ESSVKECAKKLGISKYHANLTPEDKAQTISSYKGVCAMVGDGNNDALALKQASVSLGFEKSALSKSACDILLLEEDLSLL
    EKAFDNAQKVYQVVLQNIVLSLIYNAILIPVAMLGYINPLIASLSMSASSLLVVLNSLRLKRS

    >gi|210135741|ref|YP_002302180.1| alkyl hydroperoxide reductase [Helicobacter pylori P12]
    MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVSIDSEQV
    HFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALL
    HFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL