Helicobacter pylori J99 uid57789

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|15611194|ref|NP_222845.1| bacterioferritin comigratory protein [Helicobacter pylori J99]
    MEKLEVGQLAPDFRLKNSDGVEISLKDLLHKKVVLYFYPKDNTPGCTLEAKDFSALFSEFEKKNAVVVGVSPDNSQSHQK
    FISQCSLNVILLCDEDKKVANLYKAYGKRMLYGKEHLGIIRSTFIINTQGVLEKCFYNVKAKGHAQKVLESL

    >gi|15611280|ref|NP_222931.1| bifunctional methionine sulfoxide reductase A/B protein [Helicobacter pylori J99]
    MKILSYLKKFYLFLLIGAIMQANESMGAKLPKTDERVIYLAGGCFWGLEAYMERIYGVIDASSGYANGKTSSTNYEKLHE
    SDHAESVKVIYDPKKISLDKLLRYYFKVIDPVSVNKQGNDVGRQYRTGIYYVNSADKEVIDNALKALQKEVKGKIAIEVE
    PLKNYVRAEEYHQDYLKKHPGGYCHIDLKKADEVIVDDDKYTKPSDEVLKKKLTKLQYEVTQNKHTEKPFENEYYNKEEE
    GIYVDITTGEPLFSSADKYDSGCGWPSFSKPINKDVVKYEDDESLNRKRIEVLSRIGKAHLGHVFNDGPKELGGLRY
    CIN
    SAALRFIPLKDMEKEGYGEFIPYIKKGELKKYIQDKKSH

    >gi|15611286|ref|NP_222937.1| hypothetical protein jhp0216 [Helicobacter pylori J99]
    MILRASVLSALLLVGLGAAPKHSVSASDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQDLKMVVIEDPDTKYNIPLVVS
    KDGNLVIGLSNIFFSNKSDDVKLVAETNQKIQALNATQQNSAKLNAIFNEIPADYAIELPSTNAENKDKILYIVSDPM
    CP
    HCQKELTKLRDHLKENTVRMVVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
    VENTTKKIFESGVIKGVPFLYHYKA

    >gi|15611421|ref|NP_223072.1| copper-transporting P-type ATPase [Helicobacter pylori J99]
    MKESFYIEGMTCTACSSGIERSLGRKSFVKKIEVSLLNKSANIEFNENETNLDEIFKLIEKLGYSPKKTLAEEKKEFFSP
    NVKLALAVIFTLFVVYLSMGAMLSPSLLPESLLTINHHSNFLNACLQLIGALIVMHLGRDFYIQGFKALWHRQPNMSSLI
    AIGTSAALISSLWQLYLVYTNHYTDQWSYGHYYFESVCVILMFVMVGKRIENVSKDKALDAMQALMKNAPKTALKMHNNQ
    QIEVLVDSIVVGDILKVLPGSAIAVDGEIIEGEGELDESMLSGEALPVYKKVGDKVFSGTLNSNTSFLMKATQDNKNSTL
    SQIIEMIHNAQSSKAEISRLADKVSSVFVPSVIAIAVLAFVVWLIIAPKPDFWWNFRTALEVFVSVLVISCPCALGLATP
    MSILVANQKASSLGLFFKDAKSLEKARLVNTIVFDKTGTLTNGKPVVKSIHSNIELLELLSLASSIEKSSEHVIAKGIVE
    YAKERNAPLKDISEVKVKTGFGISAKVDYQGAKEIIKVGNSEFFNPINTLEIKENGILVFVGRAINEKEDELLGAFVLED
    LPKKGVKEHIAQIKNLGINTFLLSGDNRENVKKCALELGIDGYISNAKPQDKLNKIKELKEKGRIVMMVGDGLNDAPSLA
    MSDVAVVMAKGSDVSVQAADIVSFNNDIKSVYSAIKLSQATIKNIKENLFWAFCYNSVFIPLACGVLYKANIMLSPAIAG
    LAMSLSSVSVVLNSQRLRNFKIKDH

    >gi|15611685|ref|NP_223336.1| methylated-DNA--protein-cysteine methyltransferase [Helicobacter pylori J99]
    MTLYHYYFKTPKSFPLEYLHLCANESHLLRLDFDATNFSHHTPMNTPLKLSVQALERYFLGQLFEFDAPLDLIGTFFQKQ
    VWSALMTIPYGKTKSYDEIAKLINNPKSCRAIGNANRNNPISLIVP
    CHRVVRKNGALGGYNGGIEVKKWLLEFESKILNE
    RAKNFLIS

    >gi|15611759|ref|NP_223410.1| hypothetical protein jhp0692 [Helicobacter pylori J99]
    MSEPIDRFTRIRWLFKNDFEKIRQQRVLICGVGGVGGFALDSLYRVGIGQITIIDKDMFDVTNQNRQIGSERIGESKVLV
    LQDLYKGIQALNCRIDEAFLNSFNFRDYDYILDCMDDLPIKTSLAIKCQNFAYGKFISSMGSAKRLNPKHIQVGSVWESY
    GDKFGRKFRDFLKKRRFKGDFKVVFSPEVPH
    CIELGSFNAVTASFGLQIASEVVQDIIKNERQWNERLRRRIGRF

    >gi|15611794|ref|NP_223445.1| putative heavy-metal cation-transporting P-type ATPase [Helicobacter pylori J99]
    MQEYHIHNLDCPDCAAKLERDLNKLDYVKKAQINFSTSKLFLDTSDFEKVKAFIKQNEPHLSLSFKEAAEKPLSFTPLIA
    TIAVFLGAILILHLEPSPFIEKAVFVVLALVYLISGKDVILGAFRGLRKGQFFDENALMLIATIAAFCVGAYEESVSIMV
    FYSAGEFLQILAIARSKKSLKALVDVAPNLAYLKKGDTLVSVAPEDLRINDIVVVKVGEKVPVDGVVIKGESLLDERALS
    GESMPVNVSERSKVLGGSLNLKAVLEIQVEKLYKDSSIAKVVDLVQQATNEKSETEKFITKFSRYYTPSVLFIALMIAVL
    PPLFSMGSFDEWIYRGLVALMVSCPCALVISVPLGYFGGVGAASRKGILMKGVHVLEVLTQTKSIAFDKTGTLTKGVFKV
    VDIVPQNGHSKEEVLHYASCSQLLSTHPIALSIQKACEEMLKDDKHQHDIKNYEELSGMGVKAQCHTDLIIAGNEKMLDQ
    FHIAHSPSPENGTIVHVAFNQTYIGYIVISDEIKDDAIECLRDLKAQGIENFCILSGDRKSATESIARTLGCEYHASLLP
    EEKTSVFKTFKERYKAPAIFVGDGINDAPTLASADVGIGMGKGSELSKQSADIVITNDSLSSLVKVLAIAKKTKSIIWQN
    ILFALGIKAVFIVLGLMGVASLWEAVFGDVGVTLLALANSMRTMRA

    >gi|15611830|ref|NP_223481.1| thioredoxin [Helicobacter pylori J99]
    MSHYIELTEENFESTIKKGVALVDFWAPWCGPCKMLSPVIDELASEYEGKAKICKVNTDEQEELSAKFGIRSIPTLLFTK
    DGEVVHQLVGVQTKVALKEQLNKLLG

    >gi|15611831|ref|NP_223482.1| thioredoxin reductase [Helicobacter pylori J99]
    MIDCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQITGSSEIENYPGVKEVVSGLDFMQPWQEQCFRFGLKHEMTA
    IQRVSKKGSHFVILAEDGKTFEAKSVIIATGGSPKRTGIKGESEYWGKGVST
    CATCDGFFYKNKEVAVLGGGDTAVEEAI
    YLANICKKVYLIHRRDGFRCAPITLEHAKNNSKIEFLTPYVVEEIKGDASGVSSLSIKNTATNEKRELVVPGLFIFVGYD
    VNNAVLKQEDNSMLCECDEYGSIVVDFSMKTNVQGLFAAGDIRIFAPKQVVCAASDGATAALSVISYLEHH

    >gi|15612056|ref|NP_223708.1| thiol peroxidase [Helicobacter pylori J99]
    MQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQAGKLPSVSFS
    VISMDLPFSQGQICGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEA
    LLKVLK

    >gi|15612069|ref|NP_223721.1| hypothetical protein jhp1004 [Helicobacter pylori J99]
    MFSLSYVSKKFLSVLLLISLFLSACKSNNKDKLDENLLSSGTQSSKELNDKRDNIDKKSYAGLEDVFLDNKSISPNDKYM
    LLVFGRNG
    CSYCERLKKDLKNVKELRNYIKEHFSAYYVNISYSKEHNFKVGDKDKNDEKEIKMSTEELAQIYAVQSTPTI
    VLSDKTGKTIYELPGYMPSVQFLAVLEFIGDGKYQDTKNDEDLTKKLKAYIKYKTNLSKSKSS

    >gi|15612209|ref|NP_223862.1| hypothetical protein jhp1144 [Helicobacter pylori J99]
    MLEDYAISLEEVNFNDFIVVDVRELDEYEELHLPNATLISVNDQEKLADFLSQHKDQKVLLHCRAGRRALDAAKSMHELG
    YTPYYLEGNVYDFEKYGFRMVYDDTSLSDKKN

    >gi|15612416|ref|NP_224069.1| thioredoxin [Helicobacter pylori J99]
    MLEVINGKNYAEKTAHQAVVVNVGASWCPDCRKIEPIMENLAKTYKGKVEFFKVSFDESQDLKESLGIRKIPTLIFYKNA
    KEVGERLVEPSSQKPIEDALKALL

    >gi|15612536|ref|NP_224189.1| putative peroxidase [Helicobacter pylori J99]
    MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGVILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVSIDSEQV
    HFAWKNTPVEKGGIGQVSFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALL
    HFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL