Ammonifex degensii KC4

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|260892103|ref|YP_003238200.1| methylated-DNA/protein-cysteine methyltransferase [Ammonifex degensii KC4]
    METGKKTEKRIAQKIEVPSWGEFLALWSTEGKLCKLSFPGFWQDSEGHPGCPSSGERLALALKAYFAGEQVDFSWVPLDL
    GAYTPFQRRVLEFARGLPYGEVVSYGDLARALGIPGGARAVGRALAANRIPIIIP
    CHRVVARQGLGGFSLGLDWKQKLLA
    LEKKGFCRKRHLC

    >gi|260892220|ref|YP_003238317.1| selenide, water dikinase [Ammonifex degensii KC4]
    MERIRLTALTTSSGCAAKIGPGTLARILQDLPLIKDPRLLVGIETSDDAGVYLLTEEIALIQTVDFFTPVVDDPFFFGQI
    AAANALSDVYAMGGKPLTALNIICFPTACGDLEILAQILRGGAEKVKEAGVVLLGGHSVEDKEPKYGLAVTGIVHPAKVL
    TNRGSRPGDRLVLTKRLGTGIVVTALKADLAPAELVAEATQEMATLNQAAAEAMQEVGVNACTDITGFGLLGHALEMARA
    SGVHLVIKASQLPLFPQVLDFAAMGLIPAGAYANRQFVAERVEISPAVPPELQDILFDPQTSGGLLISVPAERLEALLEA
    LKRKGVATVAVIGEVTEGPPGTIEVIP

    >gi|260892256|ref|YP_003238353.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ammonifex degensii KC4]
    MRKEGAVLVVGGGVAGIQASLELARLGFYVYLAERGPSIGGGMAYLDKTFPTEDCALCILSPFLVECARHRNIEILTGAE
    VKGLSGEPGNFRVKLELHPRGVKVEECRACGVCFKVCPVEVPDEFNQGLSSRKAIYQPYPQAFPRAAVIDWGSCTRCGRC
    RDTCPTKAIDLEMEPEEKELSVGAILLTPGFSLFSPASLSPAYGWGLLPQVITNLEMERILSASGPFGGAVIRPFDGGFP
    RRIAWLQCVGSRDRRLNRPFCSSVCCMIALKQAHLVRERTRGEVETVIFGMDLRAFGKRFEEYALRAQEDGVRFIPCRIH
    SLVPAGEGVRLRWVEEGEAREEVFDLVVLSLGLAPPAASDKLLDNLGIPAGHFGFCPQEIAGMGTGRPGIFVAGTFAGPK
    DIPEAVAEATAAVGEISSWLKETRGTRVTAPSYPPPLELAGEPRIGVVVCDCGTNIRGVVKVPEVVALARQLPGVVWARE
    FLYACSQDSQQVIKEAVLRHRLNRLVVAACSPRTHRPLFRETLQEVGLNPYLLEMVNIRDHCSWVHHDPEEATAKAQALC
    AMGVAKAARLKPLSPAQVPVVPRALVVGGGVAGLTAACSLADQGVEVVLVEKTGRIGGRARELYYGLDGEDPRRLSHKLT
    EKVQSHPRIRVYTGTVPVSCEGFIGNFKVKLSNGEEVRCGAVILATGALPHKPRSFLYGTDPRVTTLWEFEKGWAKERVR
    FTEAQEILFLQCVESRTPERPYCSRVCCSKTALLARQVKEQKPSARVYVLYRDVRTYGFREKLYDAARAAGVIYLRYTPD
    RPPQVEEEEGKLKVTLFDPLLGEELVFRPDLLVLATPMVAPPGRKEMAQIFKVPVDEYGFFWEAHPKLRPVDFAAEGIFL
    CGTAHSPRSLKECLIQAKAAAARVASILLQEELTGKGEVARVDPAKCVACLTCVRVCPYGAPRYTPEKGVVAIEPLACQG
    CGTCVGECPNAAIELEGYRREQMAAAVAGLLGVRG

    >gi|260892959|ref|YP_003239056.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Ammonifex degensii KC4]
    MGSQNVLVVGGGISGITAAVEVAEASQGEVYLVEKRPYLGGRVTQLNQYFPKLCPPNCGLEINFKRIKNNPRIHVYTLAQ
    VEEIKGEEGNFEVKVKVNPRYVTAACTACGKCVEVCPAERPNEFNYNLDKTKAIYLPHIFAFPYKYVIDMQACQGTSCSK
    CVEVCPVKAIDLNMQPETLTLQVGAVIWATGWDPYDITKLEKYGAGRYPNVITNVMMERLASKDGPTGGQILRPSDGKPA
    KKIAFVQCAGSRDENHLPYCSTVCCLASLKQALYVKERDPEAQVYFFFIDIRALGRYEDFFNRAKNEAKITFIKGKVGEI
    IEDPATKDLTLKVEDQNEGKLMSETFDLVVLATGMMPTTKINPPPARVALDKDGFILNETPGIYGAGCVTRPVEVAAAVQ
    EATAAALRALQSIRGR

    >gi|260893193|ref|YP_003239290.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Ammonifex degensii KC4]
    MPRVGVFVCWCGSNIGGVLDCPALARAAATFPGVVYATDYQYMCSDPGQKLIAEAIKEHRLDRVVVAACSPRLHEDTFRE
    VLARAGLNPYLLEMTNLREHCSWVHAGEKELAQAKALSLIRRAVAKALRLIPLHPGRVKITRRCLVIGGGIAGIQAALDV
    ADAGIEVVLVEREPSLGGKMVLLDKTFPTLDCSA
    CISTPKMAAVAKHPLIRLYTYAEVEKVEGSLGNYRVIIRQKARYVD
    HTKCTGCGTCWEKCPVKVPDELNFRLSTRPAIYLPFPQAVPNKPVIDARHCRQLTKGKCGVCQKVCPAGAIDYTQQDSLH
    EEEVGAIIVATGFDLFPWEKAYGEYGYGRYPDVITGLAFERLVNASGPTGGRIVRPSDGREPRTVVFVHCVGSRDELKGR
    EYCSRICCMYTAKHAHQVKERLPEAKVYVFYIDIRTFGKGYEEFYRRVQDEGVIYLRGRVSKIYQEGDKLIVKGADTLLG
    EPVTIVADLVVLATGVVPAKGAEELARTLGISVDKDGFFQEAHPKLRPVETHTAGIFLAGACQGPKDIPDTVSQASAAAA
    KAVGLLLREEMAVSPLVAWVNQALCTGCLHCQVVCPYQAIEVVTEGGRRRARVKEELCQGCGSCTVACRPGAMELKGFSN
    GQILAEVEALCR

    >gi|260893234|ref|YP_003239331.1| Peroxiredoxin [Ammonifex degensii KC4]
    MEEKFPLIGERFPEMTVQTTFGKRRLPQDYAGSWFILFSHPADFTPVCTTEFVSFAKKYPEFKKLNCELIGLSVDQVFAH
    IKWTGWIKDTLGVEIPFPIIADDGTVARKLGMIHPAKGSNTVRAVFVVDDKGIIRVILYYPQELGRNIDEIVRIVKALQV
    SDANGVAMPANWPHNELIGDAVIIPPPTDEQTAKERIKMYTCYDWWFCYRKLG

    >gi|260893278|ref|YP_003239375.1| methyl-viologen-reducing hydrogenase delta subunit [Ammonifex degensii KC4]
    MRVGIFVCDCQGTLAQDLDFDRLVEECGRLPGVVTVKRHSLLCQEEGVALFQKMVQELELDRVVVAGCSPRSSLAAPELR
    FKRALREVGRDTTALEIANIREQCAWIHPGQKELATGKAVDLVAMAHARVLYNRPRNPASYKIADEALVIGGGPAGMQAA
    LDYARNGIKVTLVEKESHLGGQMARLEMLYQNESWPSSCATS
    CIMPNIGKLVNLHPNITVLTRTWVKEVKKDGGNFLVTL
    WQEPQFVNSQKCVECGRCAAICPVEVENDFDMGISRRKAAYKPHPMALPPGYTIDPNSCTRCGACVGACPAQAIDLQAAP
    QERTLRVGSVVLATGFEELPIPAVKLDFLEEVWDSRIITSLKLERYGFQLQRLPFKPRSVTFVLCCGSREKTGEIDPRCE
    YGCFPFQPLEGPKAYCSKICCAYTLKQIFLLKRFNPKLEINLIYSHIRANGPMAEEFFRRIKDQPGVNLIRGRVTALSRA
    AEEETLEVHVEFLEGAAGTGFKLRTDLLVLATALGSRKDIPNLAELFGFKLDMWGLPAINQGPYGDTPGCRVFRPTESTV
    HRLYVVGAAAGLNSVSPSVAEASAAVARALPYHRQGKVEVLDYYAEVDPQKCSGCGFCAKVCPHGVIQRREDGTYYTSPA
    FCQGCGLCTTACPTGAIRITNFNEESVEKELAVAFKHVPPDEPRIVGFLCYW
    CAYSGADMAGVARLSYPVGTRIIRVRCG
    GSVSPQYVVQAFAHGADGVIVGY
    CPPYNCHHHDGNVHVARRMAIWEKFLPLMGIDPRRFAFLEIGSMAGGAWVDAVNDMH
    KRLKEMKSGR

    >gi|260893282|ref|YP_003239379.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ammonifex degensii KC4]
    MKVNYDVVVIGGGTAGVTAATTARRHYPDKKVLLIRREEKTLIPCGIPYMFGVLDDPCKNVNPDYILSIRGIEVKVGEVK
    EIVRQDKKLVMTSGEEIGYDRLVLATGSRPALPAIPGIDQENVFWIKKELPYLQKVLAALAEARRVVIIGGGFVGVELAE
    QIRKYRQLEVTIVEILPYCLYTSFDEEFCFEAERELQALGVDILTEKKVAELAGNGKVKEVRLEDGTVLPADVVIITTGV
    RPVTELAEAAGLSLGPTGGILVDRTMATSDPNIFACGDCAEKFSFFGGNPVRIRLASVAAMEARVAGANLFARRRENPGT
    VGVFSTRIGDKAFGAAGLIERIAEEEGYDVLLGEASAPNRHPSALPGTFDTKVKLVFDRYTGILLGGQAVGSESVGELVN
    LLSACLLHRMTAVEMAAFQMGTHPLLTPSPPAYPLVVAAEEAAVAKLEKKREE

    >gi|260893513|ref|YP_003239610.1| thioredoxin [Ammonifex degensii KC4]
    MVLEVNERNFEAEVLQSNIPVLVDFWAPWCGPCRSMAPVVEEVAREFAGRLKVAKLNVDENMSLAQRYGIRGIPTLLFFR
    EGKVIAQEVGYTPKETLVAWLDRLLGGGEQ

    >gi|260893588|ref|YP_003239685.1| HesB/YadR/YfhF-family protein [Ammonifex degensii KC4]
    MLRVTAEAEKRLKAILQEHGLEQGYIRIFSAGLGCGGPRLGLALEESTGENDAVFTVSSLKFVVDKSLLPYVKEAVVDYE
    TTWWGESTFTISSPRASSC

    >gi|260893605|ref|YP_003239702.1| heavy metal translocating P-type ATPase [Ammonifex degensii KC4]
    MLVSEYLLAVKNLTCAACAANLERKLKELPGVEEAAVSVVSGRIRLKLSHPTVLTQVMDYVKAAGFSVELLEEETAKTVS
    SEGRSSELFWPLLAAFLLTLPLIYRSLAELFSWPLPSFLAGNLVPLLLASAVQFGPGLIFYRGAWRAMTSRTATMDTLVA
    LGTTAAYVTQIVNWYHALPSHHEPAGVIITTILLGRYLEEKAQQKTGKALRELHSLKPQKARVLRGDKEEEVPLEEVKVG
    ELLVVRPGERIPVDGVVEKGFSTVDESLLTGESLPVEKHPGNQVAGGTLNHNGVLYIRATRVGSQTTLARIIRLVTEAQE
    QKAHSQRLADQIVARFVPAVLVLSLLTLVGWGVFRGDWEQGLRQMIAVLVVACPCALGLATPTAVIVGLGKGAKAGVLFR
    GGEYLEKAARIDTVVFDKTGTLTHGRLEVTAFYPAPGFDREKVLSLVAATEAFSEHPVGRALARLAPAPPVATGEIQVRA
    LPGFGLEAQVQGREVLLGKEELLREKGIDTEALAEKAREIVSRGATVVFVAVDRRLAGVIGVADTVREEARSTVEKLERL
    GIKVVLATGDNPVTARQVAERAGITTWYAGLLPEDKVKLVKELQREGRRVAMVGDGINDAPALASADLGLAIDTGTDVAA
    EVAGVILFRGDLRGVERALILGKAVARKIKQNLFWAFIYNILALPAAALGFLSPVMAAALMGLSDVSVVSSSLLLYRLRM


    >gi|260893690|ref|YP_003239787.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ammonifex degensii KC4]
    MEERSIVVVGGGPAGLTAGIYAARVGLRPLLIERGVLGGKVRFTERLENFPGFSAGVEGHKLIAEMEGQARRFGVEFTTA
    DIIEVKPVDEHLEVIGNGLRIQTEAVIVATGTGPRPLGVPGEERLRGKGVSY
    CALSDASLFRHREVAVVGGGDSAVKEAL
    FLARTASRVYVIHRRDTLRAAQVLQEAAMAEPKITFVWDSVVTEVLGSDWVEGVKVKNLKTGEEDCLEVSGLVVFIGNQP
    NSGLVGQVVELDPHGFIVTNEEMRTSHPRILAAGDVRRKRLRDAVTAVADGALAATVAHGIIRHR

    >gi|260893719|ref|YP_003239816.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Ammonifex degensii KC4]
    MSDKIGAVMVVGGGVAGIQAALDLAESGYYVYLVERSPAIGGVMAQLDKTFPTNDCSMCILAPKLVECGRHPNIKLVTNA
    TITGISGEPGNFTVTIKQAPRYVDPEKCVACGDCAAKCPVKVKDEFNEGLGERKAIFIKYSQAVPAAYMIDATKCLRILH
    AEKAKAAGKEPPCGLCAKACQRGAINFDDTEKTFDLNVGAIVLAPGFDEYVPKELKALGYGVYPNVVTSIEFERILSASG
    PYGGHLVRPSDKKEPKKIAWIQCVGSRDRKLEKGAYCSSVCCTYAIKEAIIAKEHSAEPLDTAIFYMDMRTYGKGFEAYY
    EKAKKEHGVRFIRARVFRVEPGEKEGDLRIRYADESGEIKHEDFDMVVLSVGLRPAKTAVETAKVLGLELNHYDFCRTQE
    ADPVATSRPGIFVCGTFRTPMDIPQTVMEASAAAAAAQTLLSSVRGTMVKKEELPPEKDVSQEEPRIGVFVCHCGINIGG
    VVNVPEVAEYAKTLPNVVYATHNLYTCSQDTQQLIKEKIKEYNLNRVVVAACTPRTHEPLFQATIREAGLNPFLFAFASL
    REQVSWVHMKDKEVATQKAKDLVRAAVSKVRLAQPLSLVPVSINRSVLVIGGGVAGMTAALELANQGFKVDLVEKEGELG
    GLARRRLHFTAEGNEVAPIVNNLIEAVNSHPNITIHLNTKVVEASGYVGNFVSKLSNGKEITHGATVIAIGGREYKPTEY
    LYGQNPRVMTQLEFEDALVKGQEPVAGANTVVMINCVGSREEPRMYCSRVCCTESIRNALKFKEKNPQARVYILYRDIRT
    YGFKEDLYTKAREKGIVFIRYNPENKPKVEVAGDKLKVTVFDPILKEDLIIDADVLALSAAVLGPEDAREVGQLYKVTCG
    MDDFYLEAHMKLRPVDFATDGVFLCGLAHAPKFLDEAIAQAKAAAARAATVLTKDAILAGGIVSKVDPAKCSGCRICVNL
    CPYNAISFDDVNKVSVINEAVCKGCGVCAAACPSKAITMGGFTDEQIFAEIEALLS

    >gi|260893752|ref|YP_003239849.1| thioredoxin reductase [Ammonifex degensii KC4]
    MTYDLVIVGGGPAGLTAGIYAARAKIQALIVERALAGGKLASVDLIENYPGFPEPISGAELSSRMEEQVRRLGVPIKNAD
    VAEVKVLPDGFVLRTRDEEITAKTVIWATGSGPSPLGVPGEDRLRGRGVSY
    CAICDGFFFRDQEVAVVGGGDSAVQEALY
    LTRFVKKVYLIHRRDTFRATPILLEQLEANPKIEKIVNTVVKEIKGEEGVTGLELEEVTTGRQSFLPVSGVFIYVGVKPA
    SHLVQDLVDLDRHGYIITDEKMATRTPGLFAAGDVRQKPLRQIVTAVADGAIAAMSAERYLRERKG

    >gi|260893912|ref|YP_003240009.1| hypothetical protein Adeg_2081 [Ammonifex degensii KC4]
    MPDKVRIGIAGVMVGILALLLMKFGNPPNMGFCIACFLRDIAGALGLDHATKVQYLRPEIVGLVLGAWLTALFTREFRPI
    GGAAPWTRFTLGFFAMIGFLAFLGCPLRMVLRLAAGDLNALVGLAGLITGVIIGIFFINRGYSLGRAQPQSRVGGYLFPG
    VMLILLVFIFVKPSFILQSKTGPGSMHAPVLLSLAAGLILGFLAQRVRLCMVGGFRDYFFFRETYLLTGFFAILITAFLG
    NVFWLHTFKLGFAGQPIAHTEALWNFLGMTLGGLASVLLGG
    CPLRQLVAAAEGNMDAATAVTGMIVGAAIAHNFNLAASP
    QGLPPNGQFAVIFGLIITALIGWLSRPVTARQQVQA