Helicobacter pylori HPAG1 uid58517

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|108562559|ref|YP_626875.1| bacterioferritin comigratory protein [Helicobacter pylori HPAG1]
    MEKLEVGQLAPDFRLKNSDGVEISLKDLLHKKVVLYFYPKDNTPGCTLEAKDFSALFSEFEKKNAVVVGVSPDNAQSHQK
    FISQCSLNVILLCDEDKKAANLYKAYGKRMLYGKEHLGIIRSTFIINTQGVLEKCFYNVKAKGHAQKVLESL

    >gi|108562651|ref|YP_626967.1| bifunctional methionine sulfoxide reductase A/B protein [Helicobacter pylori HPAG1]
    MKVLSYLKIFYLFLAIGAIMQANENMGSKLPKTDERVIYLAGGCFWGLEAYMERIYGVIDASSGYANGKTSSTNYEKLHE
    SDHAESVKVVYDPKKISLDKLLRYYFKVVDPVSVNKQGNDVGRQYRTGIYYVNNADKEVIDNALKALQKEVKGKIAIEVE
    PLKNYVRAEEYHQDYLKKHPGGYCHIDLKKADEVIVDDDKYTKPSDEVLKKKLTKLQYEVTQNKHTEKPFENEYYNKEEE
    GIYVDITTGEPLFSSADKYDSGCGWPSFSKPINKDVVKYEDDESLNRKRIEVLSRIGKAHLGHVFNDGPKELGGLRY
    CIN
    SAALRFIPLKDMEKEGYGEFIPYIKRGELKKYIQDKKTH

    >gi|108562659|ref|YP_626975.1| hypothetical protein HPAG1_0234 [Helicobacter pylori HPAG1]
    MILRASVLSALLLVSLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQDLKMVVIEDPDTKYNIPLVVS
    KDGNLVIGLSNIFFSNKSEDVQLVAETNQKVQALNATQQNSAKLNAIFNEIPADYAIELPSTNAANKDKILYIVSDPM
    CP
    HCQKELTKLRDHLKENTVRMVVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
    VENTTKKIFESGVIKGVPFLYHYKA

    >gi|108562800|ref|YP_627116.1| copper-transporting ATPase [Helicobacter pylori HPAG1]
    MKESFYIEGMTCTACSSGIERSLGRKSFVKKIEVSLLNKSANIEFNENETNLDEIFKLIEKLGYSPKKTLAEEKKEFFSP
    NVKLALAVIFTLFVVYLSMGAMLSPSLLPESLLTINNHSNFLNACLQLIGTLIVMHWGRDFYIQGFKALWHRQPNMSSLI
    AIGTSAALISSLWQLYLVYTNHYTDQWSYGHYYFESVCVILMFVMVGKRIENVSKDKALDAMQALMKNAPKTALKMQNNQ
    QIEVLVDSIVVGDILKVLPGSAIAVDGEIIEGEGELDESMLSGEALPVYKKVGDKVFSGTFNSHTSFLMKATQNNKNSTL
    TQIIEMIHNAQSSKAEISRLADKVSSVFVPSVISIAILAFVVWLIIAPKPDFWWNFGIALEVFVSVLVISCPCALGLATP
    MSILVANQKASSLGLFFKDAKSLEKARLVNTIVFDKTGTLTNGKPVVKSVHSNIELLELLSLAGSIEKSSEHVIAKGIVE
    YAKERNAPLKEMSEVKVKTGFGISAKTDYQGAKEIIKVGNSEFFNPINTLEIKENGILVFVGRMINEKEDELLGVFVLED
    LPKKSVKEHIAQIKNLGINTFLLSGDNRENVKKCALELGIDGYISNAKPQDKLNKIKELKEKGQIVMMVGDGLNDAPSLA
    MSDVAVVMAKGSDVSVQAADIVSFNNDIKSVYSAIKLSQATIKNIKENLFWAFCYNSVFIPLACGVLYKANIMLSPAIAG
    LAMSLSSVSVVLNSQRLRNFKIKDH

    >gi|108563084|ref|YP_627400.1| methylated-DNA--protein-cysteine methyltransferase [Helicobacter pylori HPAG1]
    MVLYHYYFKTPKSFPLEYLHLCANESHLLRLDFDATNFSHNTPMNTPLKLSVQALERYFLGQLFEFNTPLDLIGTFFQKQ
    VWSALMAIPYGKTKSYDEIAKLINNPKSCRAVGNANYNNPISLIVP
    CHRVVRKNGALGGYNGGIEVKKWLLEFESKILNE
    QAKNSLIS

    >gi|108563165|ref|YP_627481.1| molybdopterin biosynthesis protein [Helicobacter pylori HPAG1]
    MSEPIDRFTRIRWLFKNDFEKIRQQRVLICGVGGVGGFALDALYRVGIGQITIIDKDVFDVTNQNRQIGSERIGESKVLV
    LQDLYKGIQALNLHIDEAFLNSFNFRDYDYILDCMDDLPIKTSLAIKCQNFAYGKFISSMGSAKRLNPKHIQVGSVWESY
    GDKFGRKFRDFLKKRRFKGDFKVVFSPEVPH
    CIELGSFNAVTASFGLQIASEVVQDIIK

    >gi|108563201|ref|YP_627517.1| cadmium-transporting ATPase [Helicobacter pylori HPAG1]
    MQEYHIHNLDCPDCASKLERDLNKLDYVKKAQINFSTSKLFLDTSDFEKVKAFIKQNEPHLSLSFKEATEKPLSFTPLII
    TIIVFLGAILILHLNPSPLIEKAMFFVLALVYLVSGKDVILGAFRGLRKGQFFDENALMLIATIAAFFVGAYEESVSIMV
    FYSAGEFLQKLAISRSKKSLKALVDVAPNLAYLKKGDALVSVAPEDLRVNDIVVVKVGEKVPVDGVVVKGESLLDERALS
    GESMPVNVSERSKVLGGSLNLKAVLEIKVEKMYKDSSIAKVVDLVQQATNEKSETEKFITKFSRYYTPSVLFIALMIAIL
    PPLFSMGSFDEWIYRGLVALMVSCPCALVISVPLGYFGGVGAASRKGILMKGVHVLEVLTQAKSIAFDKTGTLTKGVFKV
    TDIVPQNGHSKEEVLHYASCSQLLSTHPIALSIQKACEEMLKDDKHQHDIKNYEELSGMGVKAQCHTDLIIAGNEKMLDQ
    FHIAHSPSKENGTIVHVAFNQTYIGYIVISDEIKDDAIECLRDLKAQGIENFCILSGDRKSATESIAQTLGCEYYASLLP
    EEKTSVFKTFKERYKAPAIFVGDGINDAPTLASADVGIGMGKGSELSKQSADIVITNDSLNSLVKVLAIAKKTKSIIWQN
    ILFALGIKAVFIVLGLMGVASLWEAVFGDVGVTLLALANSMRAMRA

    >gi|108563235|ref|YP_627551.1| thioredoxin [Helicobacter pylori HPAG1]
    MSHYIELTEENFESTIKKGVALVDFWAPWCGPCKMLSPVIDELASEYEGKAKICKVNTDEQEELSAKFGIRSIPTLLFTK
    DGEVVHQLVGVQTKVALKEQLNKLLG

    >gi|108563236|ref|YP_627552.1| thioredoxin reductase [Helicobacter pylori HPAG1]
    MIDCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQITGSSEIENYPGVKEVVSGLDFMQPWQEQCFRFGLKHEMTA
    VQRVSKKDSHFVILAEDGKTFEAKSVIIATGGSPKRTGIKGESEYWGKGVST
    CATCDGFFYKNKEVAVLGGGDTAVEEAI
    YLANICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLTPYVVEEIKGDASGVSSLSIKNTATNETRELVVPGFFIFVGYD
    VNNAVLKQEDNSMLCKCDEYGSIVVDFSMKTNVQGLFAAGDIRIFAPKQVVCAASDGATAALSVISYLEHH

    >gi|108563427|ref|YP_627743.1| adhesin-thiol peroxidase [Helicobacter pylori HPAG1]
    MQEVTFKEETYQLEGKPLKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSSLPSLTGSVCLLQAKRFNEQVGKLPSVSFS
    VISMDLPFSQGQICGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEV
    LLKVLK

    >gi|108563440|ref|YP_627756.1| thiol:disulfide interchange protein [Helicobacter pylori HPAG1]
    MFSLSYVSKKSLSVLLLISLLLSACKSNNKDKLDENLLSSGSQSSKELNDERDNIDKKSYAGLEDVFSDNKSISPNDKYM
    LLVFGRNG
    CSYCERFKKDLKNVKELHDYIKEHFSAYYVNISYSKEHDFKVGDKNNEKEIKMSTEGLAQIYAVQSTPTIVL
    SDKTGKTIYELPGYMPSTQFLAVLEFIGDGKYQDTKDDEDLTKKLKAYINIKPTFLKTNQARKMHEKP

    >gi|108563590|ref|YP_627906.1| hypothetical protein HPAG1_1165 [Helicobacter pylori HPAG1]
    MLEDYAISLEEVNFNDFIVVDVRELDEYEELHLPNATLISVNDQEKLADFLSKHKDQKVLLHCRAGRRALDAAKSMHELG
    YTPYYLEGNVYDFEKYGFRMVYDDTCAKKN

    >gi|108563882|ref|YP_628198.1| thioredoxin [Helicobacter pylori HPAG1]
    MLEVINGKNYAEKIAHQAVVVNVGANWCPDCRKIEPIMENLAKTYKGKVEFFKVSFDESQDLKESLGIRKIPTLIFYKNA
    KEVGERLVEPGSSKPIEDAIKTLL

    >gi|108563937|ref|YP_628253.1| alkyl hydroperoxide reductase [Helicobacter pylori HPAG1]
    MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGRSGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQV
    HFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALL
    HFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSINL