Helicobacter pylori G27 uid59305

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|208434092|ref|YP_002265758.1| bacterioferritin comigratory protein [Helicobacter pylori G27]
    MEKLEVGQLAPDFRLKNSDGVEISLKDLLHKKVVLYFYPKDNTPGCTLEAKDFSALFSEFEKKNAVVVGVSPDNAQSHQK
    FISQCSLNVILLCDEDKKAANLYKAYGKRMLYGKEHLGIIRSTFIINTQGVLEKCFYNVKAKGHAQKILESL

    >gi|208434172|ref|YP_002265838.1| bifunctional methioninesulfoxide reductaseA/B protein [Helicobacter pylori G27]
    MKVLSYLKNFYLFLAIGAIMQANENMGSKLPKTDERVIYLAGGCFWGLEAYMERIYGVIDASSGYANGKTSSTNYEKLHE
    SDHAESVKVIYDPKKISLDKLLRYYFKVVDPVSVNKQGNDVGRQYRTGIYYVNSADKEVIDHALKALQKEVKGKIAIEVE
    PLKNYVRAEEYHQDYLKKHPGGYCHIDLKKADEVIVDSDKYTKLSDEVLKKKLTKLQYEVTQNKHTEKPFENEYYNKEEE
    GIYVDITTGEPLFSSADKYDSGCGWPSFSKPINKDVVKYEDDESLNRKRIEVLSRIGKAHLGHVFNDGPKELGGLRY
    CIN
    SAALRFIPLKDMEKEGYGEFIPYIKKGELKKYIQDKKTH

    >gi|208434178|ref|YP_002265844.1| disulphide isomerase [Helicobacter pylori G27]
    MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQDLKMVVIEDPDTKYNIPLVVS
    KDGNLVIGLSNIFFSNKSEDVKLVAETNQKIQALNATQQNSAKLNAIFNEIPADYAIELPSTNAENKDKILYIVSDPM
    CP
    HCQKELTKLRDHLKENTVRMVVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
    VENTTKKIFESGVIKGVPFLYHYKA

    >gi|208434322|ref|YP_002265988.1| copper-transporting ATPase [Helicobacter pylori G27]
    MKESFYIEGMTCTACSSGIERSLGRKSFVKKIEVSFLNKSANIEFNENKTNLDEIFKLIEKLGYSPKKTLAEEKKEFFSP
    NVKLALAVIFTLFVVYLSMGAMLSPSLLPESLLAINNHSNFLNACLQLIGALIVMHLGRDFYIQGFKALWHRQPNMSSLI
    AIGTSAALISSLWQLYLVYTNHYTDQWSYGHYYFESVCVILMFVMVGKRIENVSKDKALDAMQALMKNAPKTALKMQNNQ
    QIEVLVDSIVVGDILKVLPGSAIAVDGEIIEGEGELDESMLSGEALPVYKKVGDKVFSGTLNSHTSFLMKATQNNKNSTL
    SQIIEMIHNAQSSKAEISRLADKVSSVFVPSVIAIAILAFVVWLIIAPKPDFWWNFGIALEVFVSVLVISCPCALGLATP
    MSILVANQKASSLGLFFKDAKSLEKARLVNTIVFDKTGTLTNGKPVVKSVHSKIELLELLSLAGSIEKSSEHVIAKGIVE
    YAKERNAPLKEMSEVKVKTGFGISAKTDYQGIKEIIKVGNSEFFNPINTLEIKENGILVFVGRAISEKEDELLGVFVLED
    LPKKGVKEHIAQIKNLGINTFLLSGDNRENVKKCALELGIDGYISNAKPQDKLNKIKELKEQGQIVMMVGDGLNDAPSLA
    MSDVAVVMAKGSDVSVQAADIVSFNNDIKSVYSAIKLSQATIKNIKENLFWAFCYNSVFIPLACGVLYKANIMLSPAIAG
    LAMSLSSVSVVLNSQRLRNFKIKDH

    >gi|208434594|ref|YP_002266260.1| methylated-DNA--protein-cysteine methyl transferase [Helicobacter pylori G27]
    MVLYHYYFKTPKSFPLEYLHLCANESHLLRLDFDAANFSHNTPMNTPLKLSVQALERYFLGQLFEFNAPLDLIGTFFQKQ
    VWSALMTIPYGKTKSYDEIAKLINNPKSCRAVGNANRNNPISLIVS
    CHRVVRKNGTLGGYNWGIEVKKWLLEFESKILNE
    QAKNSLIS

    >gi|208434702|ref|YP_002266368.1| cadmium-transporting ATPase [Helicobacter pylori G27]
    MQEYHIHNLDCPDCASKLERDLNKLDYVKKAQINFSTSKLFLDTSDFEKVKDFIKQNEPHLSLSFKEAAEKPLSFTPLIA
    TIAVFLGAILILHLNPSPLIEKAMFFVLALVYLVSGKDVILGAFRGLRKGQFFDENALMLIATIAAFCVGAYEESVSIMV
    FYSAGEFLQKLAIARSKKSLKALVDVAPNLAYLKKGDALVSVAPEDLRINDIVVVKVGEKVPVDGVVIKGESLLDERALS
    GESMPVNVSERSKVLGGSLNLKAVLEIQVEKMYKDSSIAKVVDLVQQATNEKSETEKFITKFSRYYTPSVLCIALMIAIL
    PPLFSMGSFDEWIYRGLVALMVSCPCALVISVPLGYFGGVGAASRKGILMKGVHVLEVLTQAKSIAFDKTGTLTKGVFKV
    TDIVPQNGHSKEEVLHYASCSQLLSTHPIALSIQKACEEMLKDDKHQHDIKNYEEVSGMGVKAQCHTDLIIAGNEKMLDQ
    FHIAHSPSKENGTIVHVAFNQTYIGYIVISDEIKDDAIECLRDLKAQGIENFCILSGDRKSATESIAQTLGCEYYASLLP
    EEKTSVFKTFKERYKAPAIFVGDGINDAPTLASADVGIGMGKGSELSKQSADIVITNDSLSSLVKVLAIAKKTKSIIWQN
    ILFALGIKAVFIVLGLMGVASLWEAVFGDVGVTLLALANSMRAMRA

    >gi|208434738|ref|YP_002266404.1| thioredoxin [Helicobacter pylori G27]
    MSHYIELTEENFESTIKKGVALVDFWAPWCGPCKMLSPVIDELASEYQGKAKICKVNTDEQEELSAKFGIRSIPTLLFTK
    DGEVVHQLVGVQTKVALKEQLNKLLG

    >gi|208434739|ref|YP_002266405.1| thioredoxin reductase [Helicobacter pylori G27]
    MIDCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQITGSSEIENYPGVKEVVSGLDFMQPWQEQCFRFGLKHEMTA
    IQRVSKKDSHFVILAEDGKTFEAKSVIIATGGSPKRTGIKGESEYWGKGVST
    CATCDGFFYKNKEVAVLGGGDTAVEEAI
    YLANICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLTPYVVEEIKGDASGVSSLSIKNTAINEKRELVVPGFFIFVGYD
    VNNAVLKQEDNSMLCKCDEYGSIVVDFSMKTDVQGLFAAGDIRIFAPKQVVCAASDGATAALSVISYLEHH

    >gi|208434960|ref|YP_002266626.1| adhesin-thiol peroxidase [Helicobacter pylori G27]
    MQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQAGKLPSVSFS
    VISMDLPFSQGQICGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEA
    LLKVLK

    >gi|208434973|ref|YP_002266639.1| thiol:disulfide interchange protein [Helicobacter pylori G27]
    MFSLSYVSKKFLSVLLLISLFLSACKSNNKDKLDENLLSSGSQSSKELNDERDNIDKKSYAGLEDVFLDNKSISPNDKYM
    LLVFGRNG
    CSYCERFKKDLKNVKELRDYVKEHFSAYYVNISYSKEHDFKVGDKDKNDEKEIKMSTEELAQIYAIQSTPTI
    VLSDKTGKTIYELPGYMPSTQFLAVLEFIGDGKYQDAKNDEDLTKKLKAYIKYKTNLSKSKSS

    >gi|208435117|ref|YP_002266783.1| hypothetical protein HPG27_1167 [Helicobacter pylori G27]
    MLEDYAISLEEVNFNDFIVVDVRELDEYEELHLPNATLISVNDQEKLADFLAQHKDKKVLLHCRAGRRALDAAKSMHELG
    YTPYYLEGDVYDFEKYGFRMVYDDTCDKKN

    >gi|208435326|ref|YP_002266992.1| thioredoxin [Helicobacter pylori G27]
    MSEIINGKNYAEKIAHQAVVVNVGASWCPDCRKIEPIMENLAKTYKGKVEFFKVSFDESQDLKESLGIRKIPTLIFYKNG
    KEVGERLVEPSSQKPIEDALKALL

    >gi|208435442|ref|YP_002267108.1| alkylhydroperoxide reductase [Helicobacter pylori G27]
    MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKSGAILFFWPKDFTFVCPTEIIAFDKRVKDFQERGFNVIGVSIDSEQV
    HFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALL
    HFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL