Helicobacter pylori B8 uid49873

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|298735526|ref|YP_003728047.1| putative cation-transporting ATPase CopA [Helicobacter pylori B8]
    MKCSHCQLEFKESELFKEVINHKELHFCCTGCARVYALLLDLNLESFYDKLNDSTLAPVTPQDSMNALELEQALEENNKG
    DFILNLLLEKTH
    CNACLWLNQKVLERLKGVKKVSVNFTTHHLQIVFDKSLNPKEIIQKIESLGYGAKIYNAKNYALKAQK
    EQRSYLLTLSVGFFATMNLMFIAIAKYASYGGASYGGASYGAGMDKLMQRNLDLVSLLLSLLVLVVVGRFFIKGAFYGLK
    NGVLGMDLSVSFGALSAFVYSVYAMLVSQETYFEASSTILTLVFGSKFLELKARLFANEKCLALESHEIHSVIVVEKDKQ
    IEKHPKDVAIGSVVWVPSGAKIALDGALLNNASVDASLISGEFKPLELGVNDPILGGYVNVGAPFSYQVSATFQNSRLSG
    LLETLKKSFLEKPLIESSANQIADIFSKAVLFLAFVSFLLWQFGLGGNFEKALMVCISVLVISCPCAFALATPIALVIGV
    FKNPLIVFKEALFLETLAKVEKIFIDKTGTLTQKEVLLKEKIIYEKFDERLLKSLLKVREHLAHSAILKSLDGDEVNLEK
    IEFFAHGLKANYQNETLLVGSLKFLNAMGVNIKAKESANIMVGFAKNKTLCALFILEERLKNNAKEVVQALQNQGLELEI
    LSGDNESSVKECAKKLGISKYHANLTPEDKAQIISSYKGVCAMIGDGNNDALALKQASVSLGFEKSALSKSACDILLLEE
    DLSLLKKAFDNAQKVYQVVLQNIVLSLIYNAVLIPVAMLGYINPLIASLSMSASSLLVVLNSLRLKRS

    >gi|298735574|ref|YP_003728095.1| hypothetical protein HPB8_74 [Helicobacter pylori B8]
    MLEVINGKNYAEKIAHQAVVVNVGASWCPDCRKIEPIMENLAKTYKGKVEFFKVSFDESQDLKESLGIRKIPTLIFYKNA
    KEVGERLVEPSSQKPIEDALKALL

    >gi|298735758|ref|YP_003728283.1| hypothetical protein HPB8_262 [Helicobacter pylori B8]
    MLEDYAISLEEVNFNDFIVVDVRELDEYEELHLPNATLISVNDPEKLADFLSKHKDEKVLLHCRAGRRALDAAKSMHELG
    YTPYYLEGNVYDFEKYGFRMVYDDTCDKKN

    >gi|298735921|ref|YP_003728446.1| thiol:disulfide interchange protein DsbC [Helicobacter pylori B8]
    MFSLSYVSKKFLSVLLLISLFLSACKSNNKDKLDENLLSSGSQSSKELNDERDNIDKKSYAGLEDVFLDNKSISPNNKYM
    LLVFGRNG
    CSYCERFKKDLKNVKELRDYIKEHFSAYYVNISYSKEHNFKVGDKNNEKEIKMSTEELEQIYAVQSTPTIVL
    SDKTGKTIYELPGYMPSTQFLAVLEFIGDGKYQDTKNDEDLTKKLKAYIKYKTNLSKSKSN

    >gi|298735936|ref|YP_003728461.1| thiol peroxidase, atypical 2-Cys peroxiredoxin [Helicobacter pylori B8]
    MQKVTFKEETYQLEGKTLKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVISSLPSLTGSVCLLQAKHFNEQAGKLPSVSFS
    VISMDLPFSQGQICGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVVYKEIVQNILEEPNYEA
    LLKVLE

    >gi|298736374|ref|YP_003728900.1| methylated-DNA-[protein]-cysteine S-methyltransferase Dat1 [Helicobacter pylori B8]
    MVLYHYYFKTPKSFPLEYLHLCANESHLLRLDFDTTNFSHNTPMNTPLKLSVQALERYFLGQLFEFDAPLDLIGTSFQKQ
    VWSALMTIPYGKTKSYDEIAKLINSPKSCRAVGNANYNNPISLIVP
    CHRVVRKNGALGGYNGGIEVKKWLLEFESKILNE
    QAKNPLIS

    >gi|298736457|ref|YP_003728983.1| hypothetical protein HPB8_962 [Helicobacter pylori B8]
    MSEPIDRFTRIRWLFKNDFEKIRRQRVLICGVGGVGGFALDALYRVGIGQITIIDKDVFDVTNQNRQIGSERIGESKVLV
    LQDLYKGIQALNLHINEAFLNSFNFRDYDYILDCMDDLPIKTSLAIKCQNFAYGKFISSMGSAKRLNPKHIQVGSVWESY
    GDKFGRKFRDFLKKRRFKGDFKVVFSPEVPH
    CIELGSFNAVTASFGLQIASEVVQDIIK

    >gi|298736494|ref|YP_003729020.1| cadmium, zinc and cobalt-transporting ATPase [Helicobacter pylori B8]
    MQEYHIHNLDCPDCASKLERDLNKLDYVKKAQINFSTSKLFLDTSDFEKVKAFIKQNEPHLSLSFKEVAEKPLSFTPLIV
    TIIVFLGAILILHLNPSPFIEKAMFFVLALVYLVSGKDVILGAFRGLRKGQFFDENALMLIATIAAFCVEAYEESVSIMV
    FYSAGEFLQKLAISRSKKSLKALVDVAPNLAYLKKGDALVSVAPEDLRVNDIVVVKVGEKVPVDGVVVKGESLLDERALS
    GESMPVNVSENSKVLGGSLNLKAVLEIKVEKMYRDSSIAKVVDLVQQATNEKSETEKFITKFSRYYTPSVLFIALMIAVL
    PPLFSMGSFDEWIYRGLVALMVSCPCALVISVPLGYFGGVGAASRKGILMKGVHVLEVLTQAKSIAFDKTGTLTKGVFKV
    IDIVPQNGHSKEEVLHYASCSQLLSTHPIALSIQKACEEMLKDDKHQHDIKNYEEVSGMGVKAQCHADLIIAGNEKMLDQ
    FNIAHSPSPENGTIVHVAFNQTYVGYIVISDEIKDDAIECLRDLKAQGIENFCILSGDRKSATESIAQTLGCEYHASLLP
    EEKTSVFKTFKERYKAPAIFVGDGINDAPTLASADVGIGMGKGSELSKQSADIVITNDSLSSLVKVLAIAKKTKSIIWQN
    ILFALGIKAVFIVLGLMGVASLWEAVFGDVGVTLLALANSMRAMRA

    >gi|298736528|ref|YP_003729054.1| thioredoxin 1 [Helicobacter pylori B8]
    MSHYIELTEENFESTIKKGVALVDFWAPWCGPCKMLSPVIDELASEYEGKAKICKVNTDEQEELSAKFGIRSIPTLLFTK
    DGEVVHQLVGVQTKVALKEQLNKLLG

    >gi|298736529|ref|YP_003729055.1| thioredoxin reductase [Helicobacter pylori B8]
    MIDCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQITGSSEIENYPGVKEVVSGLDFMQPWQEQCFRFGLKHEMTA
    VQRVSKKDSHFVILAEDGKTFEAKSVIIATGGSPKRTGIKGESEYWGKGVST
    CATCDGFFYKNKEVAVLGGGDTAVEEAI
    YLANICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLTPYVVEEIKGDASGVSSLSIKNTATNETRELVVPGFFIFVGYD
    VNNAVLKQEDGSMLCKCDEYGSIVVDFSMKTNVQGLFAAGDIRIFAPKQVVCAASDGATAALSVISYLEHH

    >gi|298736683|ref|YP_003729213.1| Cu2+-exporting ATPase [Helicobacter pylori B8]
    MKESFYIEGMTCTACSSGIERSLGRKSFVKKIEVSLLNKSANIEFDENQTNLDEIFKLIEKLGYSPKKTLAKEKKGFFSP
    NVKLALAVVFTLFVVYLSMGAMLSPSLLPKSLLTIDNHSNFLNACLQLIGTLIVMHWGRDFYIQGFKALWHRQPNMSSLI
    ALGTSAALISSLWQLYFVYTNQWSYGHYYFESVCVILMFVMVGKRIENVSKDKALDAMQALMKNAPKTALKMQNNQQIEV
    LVDSIVVGDILKVLPGSAIAVDGEIIEGEGELDESMLSGEALPVYKKVGDKVFSGTFNSHTSFLMKATQNNKNSTLSQII
    EMIHNAQSSKAEISRLADKVSSVFVPSVIAIAVLAFVVWLIIAPKPDFWWNFGIALEVFVSVLVISCPCALGLATPMSIL
    VANQKASSLGLFFKDAKSLEKARLVNTIVFDKTGTLTNGKPVVKSVYSNIELLELLSLASSIEKSSEHVIAKGIVEYAKE
    HDAPLKEMSEVKVKTGFGISAKVDYQGAKEIIKVGNSEFFNPINTLEIKENGILVFVGRMINEKEDELLGAFVLEDLPKK
    GVKEHVAQIKNLGINTFLLSGDNRENVQKCALELGIDGYISNAKPQDKLNKIKELKEKGQIVMMVGDGLNDAPSLAMSDV
    AVVMAKGSDVSVQAADIVSFNNDIKSVYSAIKLSQATIKNIKENLFWAFCYNSVFIPLACGVLYKANIMLSPAIAGLAMS
    LSSVSVVLNSQRLRNFKIKDH

    >gi|298736825|ref|YP_003729355.1| thiol:disulfide interchange protein DsbC [Helicobacter pylori B8]
    MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQDLKMVVIEDPDTKYNIPLVVS
    KDGNLVIGLSNIFFSNKSEDVQLVAETNQKVQALNATQQNSAKLNAIFNEIPADYAIELPSTNAANKDKILYIVSDPM
    CP
    HCQKELTKLRDHLKENTVRMVVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
    VENVTKKIFESGVIKGVPFLYHYKA

    >gi|298736833|ref|YP_003729363.1| bifunctional methionine sulfoxide reductase A/B protein [Helicobacter pylori B8]
    MQANENMGSQHQKTDERVIYLAGGCFWGLEAYMERIYGVIDASSGYANGKTSSTNYEQLHESDHAESVKVVYDPKKISLD
    KLLRYYFKVIDPVSVNKQGNDVGRQYRTGIYYVNSADKEVIDNALKELQKEVKGKIAIEVEPLKNYVRAEEYHQDYLKKH
    PGGYCHIDLKKADEVIVDSDKYTKPSDEVLKKKLTKLQYEVTQNKHTEKPFENEYYNKEEEGIYVDITTGEPLFSSADKY
    DSGCGWPSFSKPINKDVVKYEDDESLNRKRIEVLSRIGKAHLGHVFNDGPKELGGLRY
    CINSAALRFIPLKDMEKEGYGE
    FIPYIKKGELKKYIQDKKTH

    >gi|298736920|ref|YP_003729450.1| peroxiredoxin Q/BCP [Helicobacter pylori B8]
    MEKLEVGQLAPDFRLKNNDGVEISLKDLLHKKVVLYFYPKDNTPGCTLEAKDFSALFSEFEKKNAVVVGVSPDNAQSHQK
    FISQCSLNVILLCDEDKKAANLYKAYGKRMLYGKEHLGIIRSTFIINTQGVLEKCFYNVKAKGHAQKVLESL

    >gi|298737147|ref|YP_003729677.1| alkyl hydroperoxide reductase subunit C [Helicobacter pylori B8]
    MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGVILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQV
    HFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALL
    HFEEHGEVCPAGWRKGDKGMKATHKGVAEYLKENSINL