Helicobacter pylori B38 uid59415

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|254778852|ref|YP_003056957.1| Bacterioferritin comigratory protein [Helicobacter pylori B38]
    MEKLEVGQLAPDFRLKNSDGVEISLKDLLHKKVVLYFYPKDNTPGCTLEAKDFSALFSEFEKKNAVVVGVSPDNAQSHQK
    FISQCSLNVILLCDEDKKVANLYKAYGKRMLYGKEYLGIIRSTFIINTQGVLEKCFYNVKAKGHAQKVLESL

    >gi|254778931|ref|YP_003057036.1| Peptide methionine sulfoxide reductase [Helicobacter pylori B38]
    MKVLSYLKIFYLFLAIGAIMQANENMGSQHQKTDERVIYLAGGCFWGLEAYMERIYGVIDASSGYANGKTSSTNYEKLHE
    SDHAESVKVVYDPKKISLDKLLRYYFKVIDPVSVNKQGNDVGRQYRTGIYYVNSADKEVIDHALKALQKEVKGKIAIEIE
    PLKNYMRAEEYHQDYLKKHPGGYCHIDLKKADEVIVDSDKYTKPSDEVLKKKLTKLQYEVTQNKHTEKPFENEYYNKEEE
    GIYVDITTGEPLFSSADKYDSGCGWPSFSKPINKDVVKYEDDESLNRKRIEVLSRIGKAHLGHVFNDGPKELGGLRY
    CIN
    SAALRFIPLKDMEKEGYGEFIPYIKRGELKKYINDKKSH

    >gi|254778937|ref|YP_003057042.1| hypothetical protein HELPY_0235 [Helicobacter pylori B38]
    MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQDLKMVVIEDPDTKYNIPLVVS
    KDGNLVIGLSNIFFSNKSEDVKLVAETNQKIQALNATQQNSAKLNAIFNEIPADYAIELPSTNAENKDKILYIVSDPM
    CP
    HCQKELTKLRDHLKENTVRMVVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
    VENTTKKIFESGVIKGVPFLYHYKA

    >gi|254779066|ref|YP_003057171.1| Copper-transporting ATPase/P-type transporting ATPase; putative membrane protein [Helicobacter pylori B38]
    MKESFYIEGMTCTACSSGIERSLGRKSFVKKIEVSLLNKSANIEFNENETNLDEIFKLIEKLGYSPKKTLAEEKKEFFSP
    NVKLALAVIFTLFVVYLSMGAMLSPSLLPESLLAIDNHSNFLNACLQLIGTLIVMHWGRDFYIQGFKALWHRQPNMSSLI
    ALGTSAALISSLWQLYFVYTNQWSYGHYYFESVCVILMFVMVGKRIENVSKDKALDAMQALMKNAPKTALKMHNNQQIEV
    LVDSIVVGDILKVLPGSAIAVDGEIIEGEGELDESMLSGEALPVYKKVGDKVFSGTFNSHTSFLMKATQNNKNSTLSQIV
    EMIHNAQSSKAEISRLADKVSSVFVPSVIAIAILAFVVWLIIAPKPDFWWNFGIALEVFVSVLVISCPCALGLATPMSIL
    VANQKASSLGLFFKDAKSLEKARLVNTIVFDKTGTLTNGKPVVKSVHSKIELLELLSLALSIEKSSEHVIAKGIVEYAKE
    HDAPLKEMSEVKVKTGFGISAKTDYQGAKEVIKVGNSEFFNPINTLEIQENGILVFVGRVINEKEDELLGAFVLEDLPKK
    GVKEHIAQIKKLGINTFLLSGDNRENVQKCALELGIDGYISNAKPQDKLNKIKELKEKGQIVMMVGDGLNDAPSLAMSDV
    AVVMAKGSDVSVQAADIVSFNNDIKSVYSAIKLSQATIKNIKENLFWAFCYNSVFIPLACGVLYKANIMLSPAIAGLAMS
    LSSVSVVLNSQRLRNFKIKDH

    >gi|254779202|ref|YP_003057307.1| Thioredoxin reductase (TRXR) (TR) [Helicobacter pylori B38]
    MIDCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQITGSSEIENYPGVKEVVSGLDFMQPWQEQCFRFGLKHEMTA
    VQRVSKKDSHFVILAEDGKTFEAKSVIIATGGSPKRTGIKGESEYWGKGVST
    CATCDGFFYKNKEVAVLGGGDTAVEEAI
    YLANICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLTPYVVEEIKGDASGVSSLNIKNTATNEKRELVVPGFFIFVGYD
    VNNAVLKQEDGSMLCKCDEYGSIVVDFSMKTDVQGLFAAGDIRIFAPKQVVCAASDGATAALSVISYLEHH

    >gi|254779203|ref|YP_003057308.1| Thioredoxin 1 [Helicobacter pylori B38]
    MSHYIELTEENFESTIKKGVALVDFWAPWCGPCKMLSPVIDELASEYEGKAKICKVNTDEQEELSAKFGIRSIPTLLFTK
    DGEVVHQLVGVQTKVALKEQLNKLLG

    >gi|254779235|ref|YP_003057340.1| Cadmium, zinc and cobalt-transporting ATPase [Helicobacter pylori B38]
    MQEYHIHNLDCPDCASKLERDLNKLDCVKKAQINFSTSKLFLDTSDFEKVKAFIKQNEPHLSLSFKEATEKPLSFTPLIA
    TIAVFLGAILILHLNPSPLIEKAVFVVLALVYLVSGKDVILGAFRGLRKGQFFDENALMLIATIAAFCVGAYEESVSIMV
    FYSAGEFLQKLAIARSKKSLKALVDVAPNLAYLKKGDALVSVAPEDLRVNDIVVVKVGEKVPVDGVVIKGESLLDERALS
    GESMPVNVSERSKVLGGSLNLKAVLEIQVEKLYKDSSIAKVVDLVQQATNEKSETEKFITKFSRYYTPSVLFIALMIAVL
    PPLFSMGSFDEWIYRGLVALMVSCPCALVISVPLGYFGGVGAASRKGILMKGVHVLEVLTQAKSIAFDKTGTLTKGVFKV
    TDIVPQNGHSKEEVLHYASCSQLLSTHPIALSIQKACEEMLKDDKHQHDIKNYEELSGMGVKAQCHTDLIIAGNEKMLDQ
    FHIAHSPSKENGTIVHVAFNQTYVGYIVISDEIKDDAIECLRDLKAQGIENFCILSGDRKSATESIAQTLGCEYHASLLP
    EEKTSVFKTFKERYKAPAIFVGDGINDAPTLASADVGIGMGKGSELSKQSADIVITNDSLSSLVKVLAIAKKTKSIIWQN
    ILFALGIKAVFIVLGLMGVASLWEAVFGDVGVTLLALANSMRAMRA

    >gi|254779269|ref|YP_003057374.1| putative molybdenum biosynthesis cofactor, MoeB/ThiF family [Helicobacter pylori B38]
    MSEPIDRFTRIRWLFKNDFEKIRQQRVLICGVGGVGGFALDALYRVGIGQITIIDKDVFDVTNQNRQIGSERIGESKVLV
    LQDLYKGIQALNLHVDEAFLNSFNFRDYDYILDCMDDLPIKTSLAIKCQNFAYGKFISSMGSAKRLNPKHIQVGSVWESY
    GDKFGRKFRDFLKKRRFKGDFKVVFSPEVPH
    CIELGSFNAVTASFGLQIASEVVQDIIK

    >gi|254779338|ref|YP_003057443.1| Methylated-DNA--protein-cysteine methyltransferase (6-O-methylguanine-DNA methyltransferase) (MGMT) (O-6-methylguani
    MVLYHYYFKTPKSFPLEYLHLCANESYLLRLDFDTANFSHNTPMNTPLKLSVQALERYFLGQLFEFDAPLDLIGTSFQKQ
    VWSALMTIPYGKTKSYDEIAKLINNPKSCRAIGNANHNNPISLIVP
    CHRVVRKNGALGGYNGGIEVKKWLLEFESKILNE
    RAKNSLIS

    >gi|254779618|ref|YP_003057724.1| Thiol peroxidase [Helicobacter pylori B38]
    MQKVTFKEETYQLEGKTLKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQAGKLPSVSFS
    VISMDLPFSQGQICGAEGIKDLRILSDFRYKAFGENYGVLLGKGSFQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEA
    LLKVLK

    >gi|254779631|ref|YP_003057737.1| hypothetical protein HELPY_1048 [Helicobacter pylori B38]
    MFSLSYVSKKFLSVLLLISLFLSACKSNNKDKLDENLLSSGSQSSKELNDERDNIDKKSYAGLEDVFSDNKSISPNNKYM
    LLVFGRNG
    CSYCERFKKDLKNVKELRDYIKEHFSAYYVNISYSKEHNFKVGDKDKNDEKEIKMSTEELAQIYAVQSTPTI
    VLSDKTGKTIYELPGYMPSTQFLAVLEFIGDGKYQDTKNDEDLTKKLKAYIKYKTDLSKNKSS

    >gi|254779767|ref|YP_003057873.1| hypothetical protein HELPY_1198 [Helicobacter pylori B38]
    MLEDYAISLEEVNFNDFIVVDVRELDEYEELHLPNATLISVNDQEKLADFLAQHKDQKVLLHCRAGRRALDAAKSMHELG
    YTPYYLEGNVYDFEKYGFRMVYDDTCDKKN

    >gi|254779970|ref|YP_003058077.1| Thioredoxin [Helicobacter pylori B38]
    MLEVINGKNYAEKIAHQAVVVNVGASWCPDCRKIEPIMENLAKTYKGKVEFFKVSFDESQDLKESLGIRKIPTLIFYKNA
    KEVGERLVEPGSSKPIEDALKALL

    >gi|254780013|ref|YP_003058120.1| ATPase, P-type copper-transporter; putative membrane protein [Helicobacter pylori B38]
    MKCSHCQLEFKESELFKEVIHHKELYFCCTGCARVYALLLDLNLESFYDKLNDSTLAPVTPQDSMNALELEQALEENNKS
    DFILNLLLEKTH
    CNACLWLNQKVLERLKGVKKVSVNFTTHHLQIVFDKSLNPKEIVQKIESLGYGAKIYNAKNYALKAQK
    EQRSYLLTLSVGFFATMNLMFIAIAKYASYGGASYGTGMDKLMQRNLDLVSLFLSLLVLVVVGRFFIKGAFYGLKNGVFG
    MDLSVSFGALSAFVYSIYAMLVSQETYFEASSTILTLVFGSKFLELKARLFANEKCLALESHEIHSVIVVENGKQIEKHP
    KDVAIGSVVWVPSGAKIALDGVLLNNASVDASLISGEFKPLELGVNDPILGGYVNVGVPFSYQVNADFQNSRLSGLLETL
    KKSFLEKPLIESSANKIADIFSKAVLFLAFISFLLWQFGLGGNFEKALMVCISVLVISCPCAFALATPIALVIGVFKNPL
    IVFKEALFLETLAKVEKIFIDKTGTLTQKEVLLKEKIIYEEFDERLLKSLLKTREHLAHNAILKTLDGDEVNLEKIEFFA
    HGLKANYQNETLLVGSLKFLNAMGVNIKAKESANIMVGFAKNKTLCALFILEERLKANAKEVIQALQNKGLELEILSGDN
    ESSVKECAKKLGISKYHANLTPEDKAQTISSYQGVCAMVGDGNNDALALKQASVSLGFEKSALSKSACDILLLEEDLSLL
    EKAFHNAQKVYQVVLQNIVLSLIYNAILIPVAMLGYINPLIASLSMSASSLLVVLNSLRLKRS

    >gi|254780094|ref|YP_003058201.1| Alkyl hydroperoxide reductase [Helicobacter pylori B38]
    MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQV
    HFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALL
    HFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL