Helicobacter pylori 26695 uid57787

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|15644766|ref|NP_206936.1| bacterioferritin comigratory protein (bcp) [Helicobacter pylori 26695]
    MEKLEVGQLAPDFRLKNSDGVEISLKDLLHKKVVLYFYPKDNTPGCTLEAKDFSALFSEFEKKNAVVVGISPDNAQSHQK
    FISQCSLNVILLCDEDKKAANLYKAYGKRMLYGKEHLGIIRSTFIINTQGVLEKCFYNVKAKGHAQKVLESL

    >gi|15644852|ref|NP_207022.1| bifunctional methionine sulfoxide reductase A/B protein [Helicobacter pylori 26695]
    MKVLSYLKNFYLFLAIGAIMQASENMGSQHQKTDERVIYLAGGCFWGLEAYMERIYGVIDASSGYANGKTSSTNYEKLHE
    SDHAESVKVIYDPKKISLDKLLRYYFKVVDPVSVNKQGNDVGRQYRTGIYYVNSADKEVIDHALKALQKEVKGKIAIEVE
    PLKNYVRAEEYHQDYLKKHPSGYCHIDLKKADEVIVDDDKYTKPSDEVLKKKLTKLQYEVTQNKHTEKPFENEYYNKEEE
    GIYVDITTGEPLFSSADKYDSGCGWPSFSKPINKDVVKYEDDESLNRKRIEVLSRIGKAHLGHVFNDGPKELGGLRY
    CIN
    SAALRFIPLKDMEKEGYGEFIPYIKKGELKKYINDKKSH

    >gi|15644859|ref|NP_207029.1| hypothetical protein HP0231 [Helicobacter pylori 26695]
    MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQDLKMVVIEDPDTKYNIPLVVS
    KDGNLIIGLSNIFFSNKSDDVQLVAETNQKVQALNATQQNSAKLNAIFNEIPADYAIELPSTNAANKDKILYIVSDPM
    CP
    HCQKELTKLRDHLKENTVRMVVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
    VENTTKKIFESGVIKGVPFLYHYKA

    >gi|15645005|ref|NP_207175.1| thiol:disulfide interchange protein (dsbC), putative [Helicobacter pylori 26695]
    MFSLSYVSKKFLSVLLLISLFLSACKSNNKDKLDENLLSSGSQSSKELNDERDNIDKKSYAGLEDVFSDNKSISPNDKYM
    LLVFGRNG
    CSYCERFKKDLKNVKELRDYIKEHFSAYYVNISYSKEHDFKVGDKNNEKEIKMSTEELAQIYAVQSTPTIVL
    SDKTGKTIYELPGYMPSTQFLAVLEFIGDGKYQDTKDDEDLTKKLKAYIKYKTNLSKSKSN

    >gi|15645018|ref|NP_207188.1| adhesin-thiol peroxidase (tagD) [Helicobacter pylori 26695]
    MQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFS
    VISMDLPFSQGQICGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEA
    LLKVLK

    >gi|15645300|ref|NP_207470.1| methylated-DNA--protein-cysteine methyltransferase (dat1) [Helicobacter pylori 26695]
    MVLYHYYFKTPKSFPLEYLHLCANESHLLRLDFDAANFSHNTPMNTPLKLSVQALERYFLGQLFEFNTPLDLIGTFFQKQ
    VWSALMTIPYGKTKSYDEIAKLINNPRSCRAVGNANRNNPISLIVP
    CHRVVRKNGTLGGYNGGIEVKKWLLEFESKILNQ
    QAKNSLIS

    >gi|15645374|ref|NP_207548.1| molybdopterin biosynthesis protein (moeB) [Helicobacter pylori 26695]
    MFKNDFEKIRQQRVLICGVGGVGGFALDALYRVGIGQITIIDKDVFDVTNQNRQIGSERIGESKVLVLQDLYKGIQALNL
    HIDEAFLNSFNFRDYDYILDCMDDLPIKTSLAIKCQNFAYGKFISSMGSAKRLNPKHIQVGSVWESYGDKFGRKFRDFLK
    KRRFKGDFKVVFSPEIPH
    CIELGSFNAVTASFGLQIASEVVQDIINDKRK

    >gi|15645410|ref|NP_207584.1| cadmium-transporting ATPase, P-type (cadA) [Helicobacter pylori 26695]
    MQEYHIHNLDCPDCASKLERDLNELDYVKKAQINFSTSKLFLDTSDFEKVKAFIKQNEPHLSLSFKEATEKPLSFTPLII
    TIMVFLGAILILHLNPSPLIEKAMFFVLALVYLVSGKDVILGAFRGLRKGQFFDENALMLIATIAAFFVGAYEESVSIMV
    FYSAGEFLQKLAVSRSKKSLKALVDVAPNLAYLKKGDELVSVAPEDLRVNDIVVVKVGEKVPVDGVVVKGESLLDERALS
    GESMPVNVSENSKVLGGSLNLKAVLEIQVEKMYKDSSIAKVVDLVQQATNEKSETEKFITKFSRYYTPSVLFIALMIAVL
    PPLFSMGSFDEWIYRGLVALMVSCPCALVISVPLGYFGGVGAASRKGILMKGVHVLEVLTQAKSIAFDKTGTLTKGVFKV
    TDIVPQNGHSKEEVLHYASCSQLLSTHPIALSIQKACEEMLKDDKHQHDIKNYEEVSGMGVKAQCHTDLIIAGNEKMLDQ
    FHIAHSPSKENGTIVHVAFNQTYVGYIVISDEIKDDAIECLRDLKVQGIENFCILSGDRKSATESIAQTLGCEYHASLLP
    EEKTSVFKTFKERYKAPAIFVGDGINDAPTLASADVGIGMGKGSELSKQSADIVITNDSLNSLVKVLAIAKKTKSIIWQN
    ILFALGIKAVFIVLGLMGVASLWEAVFGDVGVTLLALANSMRAMRA

    >gi|15645443|ref|NP_207617.1| thioredoxin (trxA) [Helicobacter pylori 26695]
    MSHYIELTEENFESTIKKGVALVDFWAPWCGPCKMLSPVIDELASEYEGKAKICKVNTDEQEELSAKFGIRSIPTLLFTK
    DGEVVHQLVGVQTKVALKEQLNKLLG

    >gi|15645444|ref|NP_207618.1| thioredoxin reductase (trxB) [Helicobacter pylori 26695]
    MIDCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQITGSSEIENYPGVKEVVSGLDFMQPWQEQCFRFGLKHEMTA
    VQRVSKKDSHFVILAEDGKTFEAKSVIIATGGSPKRTGIKGESEYWGKGVST
    CATCDGFFYKNKEVAVLGGGDTAVEEAI
    YLANICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLTPYVVEEIKGDASGVSSLSIKNTATNEKRELVVPGFFIFVGYD
    VNNAVLKQEDNSMLCKCDEYGSIVVDFSMKTNVQGLFAAGDIRIFAPKQVVCAASDGATAALSVISYLEHH

    >gi|15645686|ref|NP_207863.1| copper-transporting ATPase, P-type (copA) [Helicobacter pylori 26695]
    MKESFYIEGMTCTACSSGIERSLGRKSFVKKIEVSLLNKSANIEFDENQTNLDEIFKLIEKLGYSPKKALTKEKKEFFSP
    NVKLALAVIFTLFVVYLSMGAMLSPSLLPESLLAIDNHSNFLNACLQLIGALIVMHLGRDFYIQGFKALWHRQPNMSSLI
    AIGTSAALISSLWQLYLVYTNHYTDQWSYGHYYFESVCVILMFVMVGKRIENVSKDKALDAMQALMKNAPKTALKMQNNQ
    QIEVLVDSIVVGDILKVLPGSAIAVDGEIIEGEGELDESMLSGEALPVYKKVGDKVFSGTFNSHTSFLMKATQNNKNSTL
    SQIIEMIYNAQSSKAEISRLADKVSSVFVPSVIAISILAFVVWLIIAPKPDFWWNFGIALEVFVSVLVISCPCALGLATP
    MSILVANQKASSLGLFFKDAKSLEKARLVNTIVFDKTGTLTNGKPVVKSVHSKIELLELLSLALSIEKSSEHVIAKGIVE
    YAKEHNAPLKEMSGVKVKTGFGISAKTDYQGTKEIIKVGNSEFFNPINTLEIKENGILVFVGRAISEKEDELLGAFVLED
    LPKKGVKEHIAQIKNLGINTFLLSGDNRENVQKCAFELGIDGYISNAKPQDKLNKIKELKEKGQIVMMVGDGLNDAPSLA
    MSDVAVVMAKGSDVSVQAADIVSFNNDIKSVYSAIKLSQATIKNIKENLFWAFCYNSVFIPLACGVLYKANLMLSPAIAG
    LAMSLSSVSVVLNSQRLRNFKIKDH

    >gi|15645837|ref|NP_208015.1| hypothetical protein HP1223 [Helicobacter pylori 26695]
    MLEDYAISLEEVNFNDFIVVDVRELDEYEELHLPNATLISVNDQEKLADFLSQHKDKKVLLHCRAGRRALDAAKSMHELG
    YTPYYLEGNVYDFEKYGFRMVYDDTCDKKN

    >gi|15646067|ref|NP_208249.1| thioredoxin [Helicobacter pylori 26695]
    MSEMINGKNYAEKIAHQAVVVNVGASWCPDCRKIEPIMENLAKTYKGKVEFFKVSFDESQDLKESLGIRKIPTLIFYKNA
    KEVGERLVEPSSQKPIEDALKALL

    >gi|15646170|ref|NP_208354.1| alkyl hydroperoxide reductase (tsaA) [Helicobacter pylori 26695]
    MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQV
    HFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALL
    HFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL