Helicobacter hepaticus ATCC 51449 uid57737

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|32265554|ref|NP_859586.1| thioredoxin [Helicobacter hepaticus ATCC 51449]
    MAKYKELTNDNFDTEALSGVALVDFWAPWCNPCKMLSPVIDKLADEYEGKAKICKVNVDEQGELSKRFGIRNIPTILFMK
    DGEIKDQVTGAMPEQVIRQKLDSIL

    >gi|32265985|ref|NP_860017.1| thioredoxin reductase TrxB [Helicobacter hepaticus ATCC 51449]
    MIDLAIIGGGPAGLSAGLYATRGGIKNVVLFEKGMPGGQITGSSEIENYPGVKDIVSGMEFMEPWQEQCFRFGLTHKMSE
    VSQITKKNDIFYIHQTDGSIDEAKAVIFCAGGSPKRANLKGEDEFWGRGIST
    CATCDGFFYKDQEVIVLGGGDTALEEAV
    YLSRICSKVHLVHRRNEFRAAPSTIEHVKKNDKIHIVTPAVVEEIKGDKSGVTSVLIKHTDSNTNEEIPVMGIFIFVGYN
    VNTATLKQDDGSMLCECDEYGSIKVDLSMKTSVEGLFAAGDVRTLAPKQVVCAAGDGATAALQAIAYLEHK

    >gi|32266085|ref|NP_860117.1| cation transport ATPase [Helicobacter hepaticus ATCC 51449]
    MKQHILILKGIDCANCAQRIEDALNALPNTKEANIDFSTNMLYIYTDNLTKVIHTITHIEPQVSVLETSSSYISPLQEDT
    KHSHELLSISIFIAIFIFCMAALHIDSLYIPPIVAYILLSIVYIGSGIPIFSATWRNCKNKLFFDEHSLMLFATLAALCI
    GEISEAVAVMLFFRVGEFLESLAVQKSKRSINALLQIMPDIAHKKHNDTLQDLHPQELSVGDIIVIKVGEKIPTDGIVLK
    GKSYLDMRSINGESVPVSINEGQSIIAGAINTTAMLEVRVEKPFKDSHIAKIAKLTQEASANKAKTQKVITSFARIYTPI
    IFFLSLSLALIPPLFDEQWHEWVYRALVVMMISCPCALVIAVPLGYFAAIGQASAKGILFKGSTYLETLAQVKNIIFDKT
    GTLTLGTFEILSIVPNEGYTQQDLLEIASLAEQNSNHPIATCIKNHLNTMCHIESYEEISGKGVRLLSDKGEILAGNAAL
    MQENHISFTPIHTPHTTIYVALKGTYVGHILIGDKIKEGIKDDLKMLKHYGIKHFAILSGDNQTNVDCLAKELGISHAYG
    NLLPAQKEQKLAEFMEQWQEKIAFVGDGINDAIVLRRSDVGISINTGETSNDISKESADIILQHNSLQGLVQAFKIAHHT
    RSITWQNISFALASKLVLIILSIMGIANMWLAVFGDVGIALLALLNAMRPPRSKN

    >gi|32266182|ref|NP_860214.1| hypothetical protein HH0683 [Helicobacter hepaticus ATCC 51449]
    MTTTLSVSGMRCGKCVDKIEKFIGEIEGVSLIDVNLEKSQVKIEFNAPATQELISEAILDAGFGIDENNS

    >gi|32266238|ref|NP_860270.1| methionine sulfoxide reductase A [Helicobacter hepaticus ATCC 51449]
    MAVIYLAGGCFWGIQGYFDKLKGTLCSQVGYANSAVENPSYEFVCSGNSGAVEALELHYDEDLLPLREIIGRFLSVINPC
    ALNFQGNDIGTQYRNGVYFVQESDESIIKECLKLWEKKHHKKAVTEVEKLQNFYSAELYHQKYLEKNALGYCHINTDLAL
    QKWEE

    >gi|32266421|ref|NP_860453.1| hypothetical protein HH0922 [Helicobacter hepaticus ATCC 51449]
    MQLKGKNNLSLATPIYATDLDESFCIIDMRYPEDYEICHIHNSHQLNNPYDIYALAKKHPDKKCVLVCYSGHMASILGTE
    LVQEGLENIYFYDDEFATLENANIQLITK

    >gi|32266509|ref|NP_860541.1| bacterioferritin comigratory protein Bcp [Helicobacter hepaticus ATCC 51449]
    MKLQKGDKAPQFRLKNADEIEISLQDLLTKRVVVYFYPKDNTPGCTIEAEEFSTLLEKFEAKDTIIVGISPDSPKCHQNF
    INKKALKILLLSDTDKSIASAYGAYGTKMMYGKEVQGIIRSTFVIERNGIIKESFYNVRAKGHAQKVLESLD

    >gi|32266521|ref|NP_860553.1| cation-transporting ATPase [Helicobacter hepaticus ATCC 51449]
    MYFLLQKSSLTSFYDKLTSPLTPPTLDTHNDLARFDTDAFMQKYVHTITKDEMKLCEVHLIISGIHCAACIWLNEKLLLA
    QEGIISATINYTNNKATIVWDRNKLPLSTIITLIQSIGYDAYVYDSRIQESADKKQMKEYYIRVIVALFCTMNIMWVAIA
    QYSGYFLGITKEAKDILNLASFILCTPALFYSGWVFFRSSYYGLRNGFVGMDLLVAVGSTLTYFYSIYAAITHSGETYFE
    SVSMIITFVLIGKFLEVRARKNAGDSLDKLNHLLPTSVELCDKQNPHLTRQVTPEEVQIGDMILVKAGEKIAIDGILLSQ
    RAIFDTKAISGESLPIESKEGDEILSGYVNLNHQIFYQATKIFSQSLMSHIIELVSASLNYKPHIQNLANSLSQYFSRVI
    LSIALLCFLGWYFIGNVGVEKSLMVAISVIIIACPCALALATPIASVVGIGESYRHNVLFKQAKFLESLAKANIVIFDKT
    GTLTIGKPKVQQCYIQSAYDKQLLREFVRLSKHPVALGIFDFLDTHTDSSTQETIWNLKDFQQFDAQGISALVESENQSI
    TLVGGNLEFLQNKGFILPKLTINKGMVFAYGMQKNEENILLEIFELYDEPKPYAKTLIESLHKRGIATALLSGDRAESVE
    QISSLINIQESHHSLSPLQKAEWIESYKHKHPRNVLVMVGDGINDAPALSKSDIAISMGAGSDIAILSSDVVILDDKLST
    LHNAFEIAHRTYVSIKQNIALSIGYNALSVPIATAGLVIPLFAALSMSLSSLIVVFNSMRLKYFKGETQNENKNG

    >gi|32266536|ref|NP_860568.1| methylated DNA-protein cysteine methyltransferase [Helicobacter hepaticus ATCC 51449]
    MIYTQQFHSPLGTIALASDKSTLLGLWFEGQKYFTLPKDCVREQTPILAQTQQWLEIYFSGEIPHFTPPLAPLHTQSTPF
    RESVWTILRTIPYGRTITYKEIAQTLACQRGIAKMSAQAVGGAVGANPIALLIP
    CHRVIGSDKSLTGYAGGLKRKEWLLG
    LERESLKAIK

    >gi|32266640|ref|NP_860672.1| hypothetical protein HH1141 [Helicobacter hepaticus ATCC 51449]
    MKKNTIIYVFCMLLLSISTSFGASFEDTLKATIKSNTKQDIKILKIQNLQSSPDVKLVLIAVGNMQVPIFASKDGKLVMG
    VSNVFFAHKSEDMGAVGSLIKQTQSESKPDKAILDTLFKKIPQDEYIILRSPNKNAKKITYIVSDPN
    CPSCQKELNNIQE
    RLKDSDVYMLLVGFVGEDSPIKSSMLRDRLLDVKDDKEKLKILREVYTPKSKVPTSYINIDIKDTMKINQKVIDAGIKSV
    PFVYERNK

    >gi|32266659|ref|NP_860691.1| thioredoxin [Helicobacter hepaticus ATCC 51449]
    MIENIDSKRFYEVIKQGCVVVDFSAPWCPDCRAIDPMLEVLAQEFAGKITIFKVSFDTQTHLKDELNIRKIPTLIFYKDG
    KEVGERLIEPHSIESIRSAFNTLL

    >gi|32266797|ref|NP_860829.1| putative inner membrane protein [Helicobacter hepaticus ATCC 51449]
    MFEDFKQRFLVKFWSPMPAIIALGVMAAYYFGLTGTYWAVTGEFTRWGGHIMNLLGVDTSTWGYFKILGLQGTPLDRVDG
    VMIIGMFTGAFAAAAMANNVKFRLPQSNIRIAQALIGGIIAGFGARIGMG
    CNLASFFTGIPQFSLHAWFFTIMTLVGVWL
    GTKVVLLSLFRSHTKLEKVSAQKDIGNSKENQSRAKLLFALGVLVLVGIGVWVAYLMAYGNIPEGKKIPILALAVVFGVG
    FGFIISRAQICFTSAFRDLFITGRGYMARAVIVGMMVSTIGVFSYIMLGLPPKIMWAAPNAVIGGLLFGFGIVIAGGCEC
    GWMYRAVEGQVHYWIVGVGNVIGSTLLAATWDYYSVPLATSFPKINLLESFGNYGGLVVSYVLLFAFLAFVLFLERRYFA
    KNKRFERA

    >gi|32266911|ref|NP_860943.1| hypothetical protein HH1412 [Helicobacter hepaticus ATCC 51449]
    MSMVIVEVNNQQAPFLATDDGKMIFQAEVLIAQDKSTESRVQEFYKNLYEKEKLRISAKLKEVFKAQKANVFTFKAKKPS
    NKTIYIVSDFN
    CPYCQREFANLDKRLESANVELLVVGFLGEDSILKAANALKNKSGNQAKDIAMLQKLYTPKSKGQSMDI
    KAAMALTQAVADTGVRSVPYIIEP

    >gi|32266915|ref|NP_860947.1| methionine sulfoxide reductase B [Helicobacter hepaticus ATCC 51449]
    MKMPPLNEQERAVLLHKATEAPFSGAYTDCFENGIYLCRQCGTPLYESNAKFPSHCGWASFDDEIQGAIKRIPDSDGVRT
    EIICAHCGGHLGHIFENEGFTPKNIRH
    CVNSLSLSFRKNNAQ

    >gi|32267043|ref|NP_861075.1| alkyl hydroperoxide reductase TsaA [Helicobacter hepaticus ATCC 51449]
    MLVTKPAPDFTAEAIKADGTFEDSFNLYKNIGKNGAVVFFWPKDFTFVCPSEIIAFDKRVKDFEARGVKVIGVSIDSKEV
    HFAWRNVPVNQGGIGAVTFPMVSDITKQISRDYDVLFNGAVALRGSFLIDKNKVVRHAVINDLPLGRNVDEMIRMVDAML
    FVEEHGEVCPAGWNKGDEGMKANAKGVAEYLAKNADKL

    >gi|32267087|ref|NP_861119.1| thiamine biosynthesis protein ThiF [Helicobacter hepaticus ATCC 51449]
    MYNFTQEQLRRYARHFSLKECGFKGQEKILKSKVLIVGAGGLGSPVAFYLAAAGVGEIGIIDGDNVDLSNLQRQILHTTA
    EVSTPKIESAMAKLSALNPEITLTPHFTMLEAHNALEILSLYDVIVDGTDNFATKFLINDACVLLNKPYSHGGILRFSGQ
    SMSIKPKESACYACIFDSPPPEGSVPN
    CASAGVFGAIAGMLGTIQAAEVLKIITGIGQPLYNQLLSFDATTMNFRKIKLK
    KNPKCRVCGNEGITQLQEYANPTCEIKLFR

    >gi|32267261|ref|NP_861293.1| hypothetical protein HH1762 [Helicobacter hepaticus ATCC 51449]
    MTISLYGIKTCGSVKKAITLLQKHSIPFIFIDLKTHTPSKEQLALWIEQKGIEIVLNTKGTTYKTLKKDGKITDTILNAT
    LQMQINTLFDTPMLLKRPIITSDENLIIGYDESAILRLIHIFQQRKL

    >gi|32267317|ref|NP_861349.1| thiol peroxidase [Helicobacter hepaticus ATCC 51449]
    MEVKFKGTPAQLSANTIKVGDDAPQIKLTAKDLSQVQIGGASGKYQIINVVPSLDTGVCATQTRRFNQEAATLQNTNVYV
    VSMDLPFAQGRFCSTEGIENLTPLSDFVTKDFGKAYGLLLQSSPLVGLLTRAVLIIDPQGKVIYIEICEEITQEPNYEKA
    LAVIK