Helicobacter acinonychis Sheeba uid58685

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|109946713|ref|YP_663941.1| cation transporter E1-E2 family ATPase [Helicobacter acinonychis str. Sheeba]
    MKCSHCQLEFKESELFKETINHKELHFCCAGCARVYALLLDLNLESFYDKLGASTLAPVTHQAPVNALELEQAIEENDKG
    DFTLNLLLEKTH
    CNACLWLNQKVLERLSGVKKVSVNFTTHHLQIVFEKSLNPKEIIQKIESLGYGAKVYNAKNYTLKAQK
    EQRSYLLTLSVGFFATMNLMFIAIAKYASYGSSGMDKLMQRNLDLVSLFLSLLVLVVVGRFFIKGAFYGLKNGVFGMDLS
    VSFGALSAFVYSVYAMFVSQETYFEASSTILTLVFGSKFLELKARLFANEKCLALESHEIHSVIVLEKDKQVEKHPKDVA
    IGSIILVPSGAKIALDGVLLNNASVDASLISGEFKPLELGVNDQILGGYVNVGVPFSYQVSANFQNSRLSSLLETLKKSF
    LEKPLIESSANKIADIFSKTVLFLAFVSLILWQFGWGANFEKALMVCISVLVISCPCAFALATPIALVIGVFKNPLIVFK
    EALFLETLAKVKKIFIDKTGTLTQKEVLLKEKIIYEHFDERLLKSLLKTREHLAHSAILKSLDGDEVILEKIEFFAHGLK
    AHYHNETLIVGSLKFLNAMGVSVKVKESANIMVGFAKNKTLCALFILEERLKNNAKEVVQALHNKGLELEILSGDNESSV
    KECTKKLGISKYHANLTPEDKAQIISSYKGVCAMIGDGNNDALALKQASVSLGFEKSALSKSACDILLLEEDLSLLEKAL
    HNAQKVYQVVLQNIVLSLIYNAILIPVAMLGYINPLIASLSMSASSLLVVLNSLRLKRS

    >gi|109946749|ref|YP_663977.1| thioredoxin [Helicobacter acinonychis str. Sheeba]
    MLEVINGKNYAEKIVHQAVVVNVGASWCPDCRKIEPIMDNLAKTYAGKVHFFKVAFDESQDLKESLGIRKIPTLIFYKNA
    KEVGERLVEPSSQKPIEDAIKTLL

    >gi|109946921|ref|YP_664149.1| hypothetical protein Hac_0308 [Helicobacter acinonychis str. Sheeba]
    MILRASVLSVFLLVSLGAAPESPANKQMQDNLVKVIEKQTSKKVRILETKSLKSNQDLKIVVVEDPDTKYQIPLVVSKDG
    NLVIGLSNIFFSNKSDDVQLVAETNQRIQTLNATQQNSAKLNAIFNEVPADYVVELPSTNAANKDKILYIVSDPM
    CPHCQ
    RELTKLRDHLKENTVKMVIVGWLGVNSAKKAALIQEEMAQAKARGASVEDKISIIEKIYSTQYDINAQKEPEDLRTKVEN
    VTKKIFEPGVIKGVPFLYHYRS

    >gi|109946929|ref|YP_664157.1| bacterioferritin comigratory protein [Helicobacter acinonychis str. Sheeba]
    MEKLEAGQLAPNFRLKNSDGVEISLKNLLHKKVVLYFYPKDNTPGCTLEAQDFSALFNEFEKKNAIVVGVSPDNIQSHQK
    FISQCSLNVILLCDEDKKVANLYKAYGKRMLYGKEHLGIIRSTFIINTQGVLEKCFYNVKAKGHAQKVLESL

    >gi|109947086|ref|YP_664314.1| disulfide interchange protein [Helicobacter acinonychis str. Sheeba]
    MFSFSYFFSKKFLSVLLLISLVLSACKSNNKDKLDENLLSSGSQSSKELDDERDNIDKKSYAGLEDIFSDTKFISPNDKY
    MLLVFGRNG
    CSYCERLKKDLKNVKELHDYVKDHFSAYYINISYPKMHNFKVGDKDKNDEKEIKMSTEELAQIYAVQSTPS
    IVLSDKTGKTIYELPGYMPSTQFLAVLEFIGNGEYQKAASDKDFIKQLKAYIKYKTDLSKNKSS

    >gi|109947238|ref|YP_664466.1| molybdopterin biosynthesis protein [Helicobacter acinonychis str. Sheeba]
    MSEPIDRFTRIRWLFKDDFEKIRQQKVLICGVGGVGGFALDSLYRVGIGQITIIDKDVFDVTNQNRQIGSERIGESKTLV
    LQDLYKGIQALNYRIDEAFLNSFNFRDYDYILDCMDGLPIKTSLAIKCQNFAYGKFISSMGSAKRLNPKHIQVGSVWESY
    GDKFGRKFRDFLKKRHFKGNFKVVFSPETPH
    CIELGSFNAVTASFGLQIASEVVQDIIKHERK

    >gi|109947299|ref|YP_664527.1| thioredoxin [Helicobacter acinonychis str. Sheeba]
    MSHYIELTEENFESTIKKGVALVDFWAPWCGPCKMLSPIIDELASEYEGKAKICKVNTDDQEELSAKFNIRSIPTLLFTK
    DGEVVHQLVGVQTKVALKEQLDKLLG

    >gi|109947300|ref|YP_664528.1| hypothetical protein Hac_0729 [Helicobacter acinonychis str. Sheeba]
    MIDCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQITGSSEIENYPGVKEVVSGLDFMQPWQEQCFRFGLKHEMTA
    IQRVSKKDSHFVILAEDGKTFEAKSVIIATGGSPKRTGIKGESEYWGKGVST
    CATCDGFFYKNKEVAVLGGGDTAVEEAI
    YLANICKRVYLIHRRDGFRCAPITLEHARKNDKIEFLTPYVVEEIKGDNAGVSSLSIKNTATNQTRELVVPGFFVFVGYD
    VNNAVLKQEDGSMLCKCDEYGSIVVDFSMKTNVQGLFAAGDIRIFAPKQVVCAASDGATAALSVISYLEHH

    >gi|109947412|ref|YP_664640.1| methylated-DNA--protein-cysteine methyltransferase [Helicobacter acinonychis str. Sheeba]
    MSKSLMDLYHYYFKTPKSFPLEYLHLCANESHLLRLDFDTTNFSISMNTPLKLSVQALERYFLGQLFEFDVPLDLIGTFF
    QKQVWSALLTIPYGKIKSYDEIAKLINNPKSCRAIGNANHNNPISLIVP
    CHRVVRKNGTLGGYNGGIEVKKWLLEFESKI
    LNQQAKNFLIF

    >gi|109947461|ref|YP_664689.1| heavy metal-transporting ATPase [Helicobacter acinonychis str. Sheeba]
    MQEYHIHNLDCPDCAAKLERDLNKLDCVKKAQINFSTSKLFLDTSDFEKVKAFIKQNEPHLSLSFKEAVEKPLSFTPLIT
    TIIVFLGAILILRLNPSAFIEKAVFVVLALVYLISGKDVILGAFRGLRKGQFFDENALMLIATIAAFCVGAYEESVSIIV
    FYSAGEFLQKLAISRSKKSLKALVDVAPNLAYLKKGDELVSVTPEDLQINDIVVVKVGEKVPVDGVVIKGESLLDERALS
    GESMPINVSENSKVLGGSLNLKAVLEIKVEKIYKDSSIAKVVDLVQQATNEKSETEKFITKFSRYYTPSVLFIALMIAVL
    PPLFSMGSFDEWIYRGLVALMVSCPCALVISVPLGYFGGVGAASRKGILMKGVHVLEVLTQAKSIAFDKTGTLTKGVFKV
    MDIVPQNRHSKEEVLHYASCSQLLSTHPIALSIQKACEEMLKDNQHQHDIKNYEELSGMGVKAQCHADLIIAGNEKMFDK
    FNIAHSPSPQNGTIVHVAFNQNYIGYIVISDEIKDDAIECLRDLKAQGIENFCILSGDRKSVTESIAKTLGCEYHASLLP
    EEKTSVFKNFKERYKAPAIFVGDGINDAPTLASADVGIGMGKGSELSKQSADIVITNDSLNSLVKVLAIAKKTKSIIWQN
    ILFALGIKMVFIVLGLMGVASLWEAVFGDVGVTLLALANSMRAMRA

    >gi|109947712|ref|YP_664940.1| copper-transporting ATPase [Helicobacter acinonychis str. Sheeba]
    MKASFYIEGMTCTACSSGIERSLGRRSFVKKIEVSLLNKSANIEFNENETNLDEIFKLIEKLGYSPKKTLTKEKKEFFSP
    NVKLILAVIFTLFVVYLSMGAMLSPSLLPKSLLTINNHSNFLNACLQLIGTLIVMHLGRDFYIQGFKALWHRQPNMSSLI
    AIGTTAALDSSLWQLYLVYTDQWSYGHYYFESVCVILMFVMVGKRIENISKDKALDAMQTLMKNAPKTALKMQDNQKIEV
    LVDSIVVGDILKVLPGSAIAVDGEIIEGEGELDESMLNGEALPVYKKVGDKVFSGTLNSNTSFLMKATQNNKNSTLSQII
    EMIHNAQSSKAEISRLADKVSSVFVPSVIAIASLAFIVWLIIAPKPDFWWNFGIALEVFVSVLVISCPCALGLATPMSIL
    VANQKAGSLGLFFKDAKSLEKARLVNTIVFDKTGTLTNGKPVVKSVHSNIESLELLSLASSIEHNSEHVIAKGIVEYAKE
    YNAPLKGISEVKVKTGFGISAKIDYQGTKEIIKVGNSEFFNLINPLEIKENGILVFVARAINEKEDELLGVFVLEDLPKK
    GVKEHIAQIKNLGINTFLLSGDNLKNVQKCALELGIDDYISNAKPQDKLNKIKELKEKGQIVMMVGDGLNDAPSLAMSDV
    AVVMAKGSDVSVQAADIVSFNNDIKSVYSAIQLSQATIKNIKENLFWAFCYNSVFIPLACGVLYKANIMLSPAIAGLAMS
    LSSVSVVLNSQRIRNFKIKDH

    >gi|109947713|ref|YP_664941.1| copper iron binding protein [Helicobacter acinonychis str. Sheeba]
    MKVTFQVPSITCGHCVDKIEKFVGEIEGVNFIDVSVENKSVIVEFDAPATQDLIKEALLDAGQEVV

    >gi|109947841|ref|YP_665069.1| thioredoxin reductase family protein [Helicobacter acinonychis str. Sheeba]
    MNQEILDVLIVGAGPGGIATAIECEIAGIKKTLLCEKTESHSGMMEKFYKAGKRVDKDYRKQVVELKGHIPFKDSFKEET
    LENFTKLLKEHRITPSYRTDIESVKKEGDLFKITTTSNATYHAKFVVVAIGKMGQPNRPTYKIPVTRSKQVVFSIND
    CKE
    NEKTLVIGGGNSAVEYAIALCKTTPTTLNYRKKEFSRINEDNAKNLQEVLDNNTLKSKLGVDIESLEEDGTQIKVNFTDN
    TSESFDRLLYAIGGSTPLEFFKRCSLELDPSTNIPVVKENLESSNIPNLFIVGDILFKSGASIATALNHGYDVAAEIAKR
    LRS

    >gi|109947987|ref|YP_665215.1| hypothetical protein Hac_1495 [Helicobacter acinonychis str. Sheeba]
    MGAIMQANENMGSKLPKTDGKVIYLAGGCFWGLEAYMERIYGVIDASSGYANGKTQSTNYQKLHESDHAESVKVVYDPKK
    ISLDKLLRYYFKVVDPVSVNKQGNDVGRQYRTGIYYVDNADKKVIDNALKELQKSVKGKIAIEVEPLKNYVRAEEYHQDY
    LKKNPNGYCHIDLKKADEVIVDSDKYTKPSDEVLKKKLTQLQYEVTQNKRTEKPFENEYYNKEEEGIYVDITTGEPLFSS
    ADKYDSGCGWPSFSKPISKDVVKYEDDESLNMRRTEVLSRIGKAHLGHVFNDGPKELGGLRY
    CINSASLRFIPLKDMEKE
    GYGEFIPYIKKGELKKYIHDKKTH

    >gi|109948081|ref|YP_665309.1| hypothetical protein Hac_1599 [Helicobacter acinonychis str. Sheeba]
    MLEDYAISLEEVNFNDFIVVDVRELDEYEELHLPNVTLISVNDEEKLADFLSQHKDKKVLLHCRAGVRALNAAKSMHALG
    YTPYYLEGNVYDFEKYGFRMIYDDTSLSDKKN

    >gi|109948144|ref|YP_665372.1| alkyl hydroperoxide reductase [Helicobacter acinonychis str. Sheeba]
    MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKSGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQV
    HFAWKNTPVEKGGIGQVSFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALL
    HFEEHGEVCPAGWRKGDKGMKPTHKGVAEYLKENSVKL