Halothiobacillus neapolitanus c2

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|261854676|ref|YP_003261959.1| thioredoxin reductase [Halothiobacillus neapolitanus c2]
    MSETNTRHARLLILGSGPAGYAAAVYAARANLNPVLITGMEMGGQLTTTTEVENWPGDPGDLTGPALMDRMKAHAEKFDT
    EIIFDHIQSTNLKQRPFTLKGDSGTYTCDALIVATGASAKYLGLESESKFKGKGVSA
    CATCDGFFYKNQEIAVVGGGNTA
    VEEALYLANVASKVHVIHRRDKFKAENILIDRLMKKVDEGKVEIHWHSAIDEILGDNTGVTGLRIKQVQTEKTTDIALTG
    VFIAIGHAPNTGIFEGELDLAGGYIQVKSGTQGNATATSVPGVFAAGDVMDHVYRQAITSAGTGCMAALDAKTYLEGLE

    >gi|261854803|ref|YP_003262086.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Halothiobacillus neapolitanus c2]
    MTRSAPPDDKHDRTPHGVPDSSGNSPRNSPEKTPETPPEKPPETSPKKRRRWRRWLIEIAVFVGVLLAVRAYMAPAIPTD
    FADAPLPAITFPTLTNGTTGPGTITLGSNPRPTALVFWATW
    CGVCHVELPWLNELAKTHRIITVAMQSGSADAVRQYLNK
    NQLDHLPVINDPDGQIAKKFGVSVTPTLFFIAPDGRIAMAETGITSPWGIRLRLWWLGL

    >gi|261854810|ref|YP_003262093.1| transcriptional regulator, ArsR family [Halothiobacillus neapolitanus c2]
    MAFKQDLNDQFARMGKVLGSGRRLELLDYLAQAPRSVEQLAEVSGLTVANTSQHLQKMQQAGLVRANRQGKYIIYQLADG
    EVVTLLNTLHTLADRHLAEVRALVATHLAPRDALAPITLDELRPHMASGDMTLIDVRPPQEFAAGHLPSAVNIPPDQLAS
    ALDRLDPKRPVVAY
    CRGRYCAFSYDAVAALRERGFSARRLAVGFPEWQLAGHPVIYPATSPTNQASL

    >gi|261854817|ref|YP_003262100.1| hypothetical protein Hneap_0190 [Halothiobacillus neapolitanus c2]
    MTKMPTHHRASARRRFSLMLLMTAFFIATPVYAAAQNGGDSDSGVEMVGNVAYVDHLTNLPADFAVMREKKIPMMIFFHA
    SY
    CGYCVQVDNQFLIPMRLDPEFKGRLLIRRVLVDGDTKYIGLDGKEHDYPHLANKLEVRGVPYILFLAPDGSRITSIQG
    TAYEFYDYYLSKDINLATDCAKHPNQKKCDGSKNGPGLN

    >gi|261854819|ref|YP_003262102.1| protein of unknown function UPF0061 [Halothiobacillus neapolitanus c2]
    MSFTSKQDDSNWYLEQTLAYAVADLCLPAQADRVPNPRMIAWNESLAAEMALDLPSEETRAQIFSGNIIPSGAAPSAQAY
    AGHQFGNFVPLLGDGRALLLGEVIDRHGKRRDIQLKGAGRTPFSRGGDGKAALGPVLREYLVSEAMHALGIPTTRGLAAV
    TTGETLWRKGEVPGAILTRVAASHIRVGTFEFLAARGGDAVRLKQLADYVIHRHYPTLKDSALPYSALLEAVVDAQANLV
    ARWMSVGFVHGVMNTDNTSIAGETIDYGPCAFMEAYHPKTVFSSIDLQGRYAYGNQPNIARWNLARFAESLLPLIDTDGD
    AAIAQANAVLADFPGRYSQHWLAAMRPKLGLSSDTGVSDSADTELIHWFLAAMQSERVDFTKGFRQLSTVVRGNVEPLRS
    LFNGSADFADWLEHWNTRIAQEKGTADERAERMDAVNPVIIPRNHQVEAMIEAAVREGDFSPFHALLAAVTHPFEDRPEW
    QNYCEPAPASFGPFTTF
    CGT

    >gi|261854825|ref|YP_003262108.1| Rhodanese domain protein [Halothiobacillus neapolitanus c2]
    MRQRCLGKFAFWCFFSFLSCAATQAHATAMLTLPGPVVCAQWLHAHSRDVQIVDVRDDPDSLSTPPIFYTQNGQKHLKRV
    GGHIPSALSVDFLALRNTHRVDGLSLDFQFPTPAEFQSLMQSICLQSNEPIVIAPTGDSAISLQEGALLALELTVYGVPT
    SEIALLNGGTHAWITAGFPISTNTIFPASGSHWRAKPARASILAHTADVRRQLDRGGLVLDARPLDQFVGITHSPVVTLP
    GRIQGATALPAEVMYTRAEDGSWHFLTPEQYRNVLAALDIEMDSRTKADAIVY
    CNTGQYAAGAWFILNRIIGDSDIRSYE
    GSLYNWEHHGLPVVGLK

    >gi|261854844|ref|YP_003262127.1| protein of unknown function DUF255 [Halothiobacillus neapolitanus c2]
    MKRYTRWVGLFSVLLLLPQWAQAADIHWQPYGPAVFAKAKAENRLILLDMVAVWCHWCHVMEDKTYSDPAVANEINAHFV
    AVRVDHDARPDLAERYRNYAWPATIILRPDGGEVLRKAGYIPPERMMKLLHQAEQLPVLAPEPEQVADAAPSSGDPLSST
    VRNMLIRNHLSLNDPVLGGLKLPQKFLVEGEVRWDMYLAAHGDKQAKKRAIAYLNAALKLIDPVFGGAYQYSTHGDWQHP
    HFEKIMSVQADYLRVYSQAYTQFGDDRYRQAIAAIAGYLNQFLSAPDGGFHPSQDADLVQGEKANTYFAKDRAARLAEGV
    PRVDPHQYTAQTAMAIEGLLDAYHATGDRQYFFRAMAGLDWVLRHRRLDDVGFKHDAKDVAGPYLIDNLYMARVYLALYR
    ITQTPMWLTQAEQLGDWISTHFTRSEGGLFSAVPDGTPVLPVPQVDQNLQAAGFYLGLAQASRKRHYLETATNILAYLAR
    PAVASARSSNAGILLYDAQRDALAKSLPKKTKDAPAS

    >gi|261854920|ref|YP_003262203.1| protein of unknown function DUF255 [Halothiobacillus neapolitanus c2]
    MQRHRNCWIKVFVRLALASTVLIVPVTVPAANTQPTQAEQQITRPQVDWPVLPTALQKKLNKALADQAQQNGQSTRDYHT
    RWLNADGLPMFTNRLILSDSPYLLEHAHNPINWYAYGPEALAAAKAQNKPLFISIGYAS
    CHWCHVMARESFESPAVAREL
    NRHFIAVKVDRQQQPALDHRYQIAVALVNQGQSGWPASVFALPDGRPFFTQLYQPEPSFLATLNNVHHVWQTKRPEVTND
    AVKLTALMRQVLDQQAKAAKLDDSVLARTVNALTAQFDPFQGGFGDGAKFPQATRLLFLLDWLAREQAHLSHPNAAGGVS
    TAQTKALQSELVLTLNHMARGGLFDQIGGGFFRYSTTPDWQVPHFEKMAYYQAMLAQTYLKAGLVLGNARDWRVAERTLD
    FVIRDMSAADGGFIAALSADSAVSHRAGAAKEEGYFYTWTPKEIAEALPHYEALLAERYWSITASGTVDGRSVPHQGDAA
    VQATMAKDEGMSLPALTAKMVAIRAKLESARKRRPAPGRDDNRILSWNGLLIEALADGGRVLGVPRFIAAAQKAAEFIDT
    NMRLPDKTLAHSYNRGVASGRANLADHADFALGLVALYDATGKNHWLRAAQKQAQIIMQDFAAANGGYYDHKALHTKADS
    DVLNLPSRPIDDGAEPAGNAQALALQLALAARTDDATYQEAAERMLASFSGLIVRDPTDFTGLLAGLSDLRHGSVGSLAF
    AGKGNVRIEAARTAKHTAEVRLHYTAPWHSNAHDASPGLIPTAITVSPDAFVRQIDYPQGEKVKLAFSDQPLNLYTGTQV
    LDIKLNPHVSGPMRIRVQIQACSDATCLAPEDLAIWLPL

    >gi|261854930|ref|YP_003262213.1| thioredoxin [Halothiobacillus neapolitanus c2]
    MTIHEATFANIDNLIKENDILIIDFWAPWCGPCRSFAPVFEAAAEANPSVAFAKANTEAEQQLGAYFQIRSIPTLMIFRE
    QILLFNQAGALPASALDELIGKVKELDMDVVRQEIEKAESESQQQQ

    >gi|261855031|ref|YP_003262314.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Halothiobacillus neapolitanus c2]
    MVSTTTPICEFNRPAIDFSLPDTEGRLWTLQDCRGPKGLLVMFICNHCPYVQAILPKIVRDTAELKRSGINSVAIMSNDI
    ADYPEDSPEHMHRLAREYDFSFPYLYDETQEIAKAYNAVCTPDFFGYNADLKLQFRGRLDASGRQNQPDAPRELFHAMQL
    IAETGTGPSDQTPSIGCSIKWRP

    >gi|261855046|ref|YP_003262329.1| Redoxin domain protein [Halothiobacillus neapolitanus c2]
    MSQVTFLGNPVEVAGVMPAVGSPAPAFTLTDGELQEKSLGDFAGKKKILNIFPSLDTPTCAQSVRSFNEKANSHPDTAVL
    CISADLPFAQGRFCGAEGLDNVITLSTFRHPEFLRDYGVLLADGALAHLAARAVIVLDEHDQVRYVQLVPEIADEPDYAA
    ALAALA

    >gi|261855120|ref|YP_003262403.1| Redoxin domain protein [Halothiobacillus neapolitanus c2]
    MIEVGQKLPEATLYHRGEQGLNGCSVTEMTAAQRIVLFAVPGAFTPTCSDAHVPGFMVLNDAIRAKGIDNIFCVAVNDPF
    VMKFWGEHLNVGDAIRMISDGNGMFTRALGMERDMSNGAMGIRSKRYAMILNNGVVEWLGVDESGLANSSAEAVLGAL

    >gi|261855178|ref|YP_003262461.1| Rhodanese domain protein [Halothiobacillus neapolitanus c2]
    MNFKKFVFVPAVIAASFAAQAAYAVTVPGPLVDPAWLNAHLKDVKVLQVSGTMKSFTTAPEMKEIKGKNVAVTVSGHVPG
    ASFVDFKTVRVSRDIDGKMVKGVIPDKAAFEKLVQSWGVNKGQPIVIVPKGLSTPDVDEATRLYWQLKYYGQDNMAILNG
    GMAQWLADGMPAATDAPAVSAGNWVASAERKNILATYQEVKKAVEHPGAVEFADARPTNQYMGVFTKPKELPGHLPGAKN
    VPPDLLTTADGASARFLPKASYESMFKTVGLNSGKEIIDY
    CNTGHLASGLWFVTHEIVGDKKARLYDGSIVEYSMYDGAK
    MNDPAMLGK

    >gi|261855185|ref|YP_003262468.1| Redoxin domain protein [Halothiobacillus neapolitanus c2]
    MPRIRPLFLPLLALPVIALMLWFMPPAANASGYPPFPAQTQWFNVSKPLTGAQLQGRVVLLDFFTPGCINCIHMIPIQQQ
    LKQKFGDDLLVVGVTSPKFTASQQADNMTPFLRRYHVDEPVFIDSGMTWWQHYGVFAWPTMLLLNPEGKVIHSFVGERSY
    TDMAAVIQSAVESARAANTLTHPKLPLKPLSADNHFMVLPTKIAVNDNRVAISDTGHDQVRIFDHEGKLLATIGDGKAGF
    ADGSFATAEFNRPQGIAWLGNDLYVADTDNQRIRRIDFASQTVSTVVGNGQRVFLNEVTAAAKDTPLNSPWGLEAVDGDL
    FIAMAGDHAVWRYDPKTRKLDVYAGTGDEGLHDGERLLAQFAQSSGLAYHDHNLYVADPESSSIRQINMQTSLTITLVGK
    GLFSFGDRDGAADQALLQHPQGLAYLNGALYIADTFNNAIRKLNLDTLQVSTVAKNLAQPNGLAVLNDHTLLIADTYRDR
    IVALNIINGETTAWPPKK

    >gi|261855257|ref|YP_003262540.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Halothiobacillus neapolitanus c2]
    MSELIKGSVVPSFTGATTDGGQICETTYSGKWLVLYFYPRDNTPGCTTEAQDFQRLLPSFDEADAVVVGVSNDDQASHAR
    FCAKQGLSFPLIADTEQTVSRAFDVIREKSMYGKTFEGIERSTFLIAPDGQIHTVWRKVKVPGHAEAVLAAIREAGRS

    >gi|261855284|ref|YP_003262567.1| cytochrome c biogenesis protein transmembrane region [Halothiobacillus neapolitanus c2]
    MQQMEWPLIQILAQTTTLRNLREEFGSQSSETAPNKRCLNRMSMYKLLKAVLTSLVLFSTVFLNYSARSADLLNPEEAFH
    ASAELNGASIDLKFHVADGYHLYRDRIAITSQTESLKLGKPVLPEGVIDNDPYFGKLVVYKKDFTVQVPIEASQPGEAKL
    KLKYQGCSDTQGVCYPPQTQEVTIKLPASATKPASPESSSLSSLSSLGGDGGQQPLDPEQAFKASIQVKNNEIQLHWDIA
    DNYHLYRDRIKVGLDDTDAKITTGSIPNGKVVDDPGFGKVQVFYHTLDAKVGIKPGSSDSAVVVAGSQGCADMGLCYPPI
    EHAWKVNFKTGSVEPLATAPKATLEKVVSLPSSMNSASTRAPQPAQSEPVQRSQTDAITHELQTGSLWTIILGFLVIGLL
    LAFTPCVFPMIPILAGIIAGQGDKITTRKAFVLSVVYVLAMAVTYTVAGILAGLFGSNLQAAFQNPWILTAFAGVFIALA
    FSMFGFFELQLPSSLQSKIMQVQNNQQGGTLVGVAIMGLLSALIVGPCMAPPLAGALIYIGQTGDAVLGGTALFAMSIGM
    GLPLIIVGTLGGKFLPRAGAWMDAVKNVFGVLMLGVAIWMLERIIPDIVAQALWGILLIGAAVYLSATDPLKEAASGWSR
    LWKTIGVILLIWGSLILVGVATGGKGSVFTPLAGVGMGTQVGGAQSAAALSFTPVKNLADLNTKLAQAKAEGKPVMLDFY
    ADW
    CVSCKEMEHNTFSDPTVIAGLKPFVLLQADVTANNADDKALFKRFGVLGPPTIVFFNAKGEEQKAQQVVGYEPPQTF
    MKHIEAASAP

    >gi|261855351|ref|YP_003262634.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Halothiobacillus neapolitanus c2]
    MRPSPRFTIAILHTSVWRHVLSGLLLLMLASPVFSAPFEFSAQDVNGKTHTLSNERGNWVVINIWATWCPPCRKELPELA
    AFDKEHAKDHIKVWGLSVDMAASPDELSMFAQEHQIGYPIFKMNPQKLSVFGNIPGIPTTFLINPQGELVARHVGAITAQ
    QLMQMIKNNS

    >gi|261855352|ref|YP_003262635.1| hypothetical protein Hneap_0739 [Halothiobacillus neapolitanus c2]
    MNSTFEGTGQPAINVSNGFANIGRRLMAALVLSLSFLGSAFWLPVAHADGFWDDSFYDMPADLKQAKADGKTGVFLFFQM
    AD
    CPFCHRMETTVFTDPDVKAFMKKHFITASIDIEGDVMMTDFQGKSISQKEFAFKQFRVRATPVMAFIDTDGKVATLFT
    GPTRSAEEFLTLAKFVTSGAYKQPGMNFFKYRKEHSE

    >gi|261855530|ref|YP_003262813.1| heavy metal translocating P-type ATPase [Halothiobacillus neapolitanus c2]
    MKLIDLYIRIDGMTCASCSARVERGLAKLPGVAAASVNLATEQATIQFDPQQIRTTDLIEVIRDVGYAPVVAEIDLAIEG
    MT
    CASCVGRVERALKRLPAVVDAVVNLATERAHVRYIPAMIEPNELIAAVTEAGYGASLVDGFADGHSDGVKSDDNRQQE
    SLSAMKRDVILAAGFSLGIMFLSMGAMFIPEFERVMDGISPFPNFWDWVQLSLASVVLFGPGRRFFKPGFIAYRHLSPDM
    NSLVATGTGAAYAYSVLVLVFPFLFPVEARHVYFDSSAVVIAAVLAGKYLEALAKGRTSAAIRKLIDLQAKTAHILDESG
    VERDVPLAQLHKGDRFVVRPGERIPTDGRVIEGRAHIDQSMLTGEPLPVTKGQGDEVVGGTVDQDGRLVIEATSVGRDTV
    LAQIIKLVENAQTGKLPIQGLADRVVRVFTPVVLAIALITFITWIVLTGNVSVALVAAVAVLVVACPCAMGLATPAAIMV
    GTGRAAELGVLFRKGEALETLSHVDTVLFDKTGTLTEGRPTLSDIGGPSPDEALRMAAALEGGSEHPLGRAIVIAADQRK
    LILPIAEDFRSIAGYGIEGMIEGHKVRVGSRHFLERESVDLGSNPTEVAQLEEAGHTAVFVSSDNLFLGWLAIADRLKPE
    AKSVVDALRQRGIKIAMVTGDAKRTAQTVAALLGIDEVHAEIRPQDKARVVSELQSKGRRVAFVGDGINDAPALAQADVG
    IALASGTDIAIEAADVTLTRGQLREVVTAITVARHTLSNIRGNLFWAFFYNILLIPIAAGVAVSIGIHLNPMVAGVAMGL
    SSIFVLGNSLRLKGLKAFQPVPITQSTNIPTHPIT

    >gi|261855532|ref|YP_003262815.1| Heavy metal transport/detoxification protein [Halothiobacillus neapolitanus c2]
    MSEIKLNITGMTCEHCVRAVTKALKDVPGVTDVEVNLQPGSAVVHGEMDPTDLISAVISEGYVAVIQS

    >gi|261855628|ref|YP_003262911.1| Rhodanese domain protein [Halothiobacillus neapolitanus c2]
    MVKKTISMTFLAVSLYSSLLVSSLLASSLLSSSACTAAEKSELRVNITTDLPSITVIDHGKSVVIMRNQNPDHTVNPDYA
    MTSRDCPPFCIQPMQLLPGVHTIGELEMLQFLKKKAEGDKSIEIIDSRTPDWYRKGTIPSAVNIPWTQIYRGSSTYEPLV
    VESLLTDTFNAKVQDGIWDFRGAKTLVLFCNGPW
    CGQSPTNIKELVSMGYPADKIYWYRGGMQSWSNLGLTTVQPPQ

    >gi|261855640|ref|YP_003262923.1| Thioredoxin domain protein [Halothiobacillus neapolitanus c2]
    MPDMTVPAVLFALVLLILLGQWLVVRRAKSMRGQTVPEQLVHACQSVEGSDHSVNSFEDRSDMNVLVAFDAPNCGACRKM
    APALANIAERYPGRVFCLSVVEHRTLAQTLRIMGTPTMLLVRNGQIVGVFVGITPLSRLFQRLQFTWPEIVPVDTSSGKL
    EKPVIPL

    >gi|261855647|ref|YP_003262930.1| UBA/THIF-type NAD/FAD binding protein [Halothiobacillus neapolitanus c2]
    MNDEQLLRYSRHIMLPEIDYEGQERIRGARVLIAGLGGLGSPVALYLAAAGVGELVLADFDTVDLSNLQRQVIHDTASVG
    LPKIDSAARRIAAINPDVKLRLVHDKLTNENLPKLLTDVDLVCDCSDNFALRFSLNAACVDAQKPLVSGAAIRMEGQVTV
    FDTRQPESPCYRCLYQEEGEDALS
    CSETGVLSPLVGMIGSLQASEAIKMLSGFGDPLVGRLALFDLKRAEFRTIRYRRDP
    DCPVCTNRPDSSR

    >gi|261855656|ref|YP_003262939.1| Peroxiredoxin [Halothiobacillus neapolitanus c2]
    MSDVSISLPRLNERAPEFDAPTTHGRKTLKDYEGKWLVLFSHPADFTPVCSTEFMAFAKAAPDFNAINCDLLGLSIDSNY
    SHIAWERNIKEKFGVEITFPIIADLSMNVASMFGMVHPGASDTQAVRATFVIDPEGILRAMLYYPMSNGRSIPEILRLVK
    ALQTSTKYGVATPEGWQPGDKVIVPPPATAQEAEARVNSGEYECVDWYFCKKSL

    >gi|261855657|ref|YP_003262940.1| hypothetical protein Hneap_1057 [Halothiobacillus neapolitanus c2]
    MFDHHLHRSRQQRLIPFWASMLLTLFIFNAPIYAQTATAAQDRVVAQNLMNDLADSSWIQDGTGSKIVYLFFDPNCPYCH
    HVFDSLMKIRKDSPDLQFRWIPLGMLGSNSTAKAGAIIQAPDPLKAFMTNEKNYGFLNSDTGGGILPAKQVDAASQTILV
    ENLSILQGQNLYGIPVVVFQADDGKPFYFSGQRSEAQLREILAHVEAGSFGGGQPIKGQQNK

    >gi|261855749|ref|YP_003263032.1| glutaredoxin-like protein [Halothiobacillus neapolitanus c2]
    MDVLERIDQFVKQNPVLIFMKGTPQFPSCGFSSRTAEALKACDVPFGYVNVLADPEIFENLPRYRDWPTFPQVYVNGELI
    GGCDITLEMFERGELQPLVEAAVKVQEGNQQA

    >gi|261855798|ref|YP_003263081.1| iron-sulfur cluster assembly accessory protein [Halothiobacillus neapolitanus c2]
    MTPTTNTALTQAKERAAAHSTADQLDVTEAAAAHIQRTMAEQPDALGLRVGVTKSGCSGFGYVMDFAQSIEPNDLAFIAK
    TSSGEELLIVCDEASFPVIKGATLDYVVNGLSRLLQFNNPNVVDSCGCGESFTIKEEDATHA

    >gi|261855809|ref|YP_003263092.1| mercuric reductase [Halothiobacillus neapolitanus c2]
    MTTLKITGMTCDSCAVHVKDALEKVPGVRSAEVSYAKGSARLAIEAGTSPDALTAAVARLGYRATLADAPVAPVGGGLLG
    KMCEWLGSDDKAGGDGDKLHIAVIGSGGAAMAAALKAVEQGARVTLIERGTIGGT
    CVNVGCVPSKIMIRAAHIAHLRRES
    PFDSGITVAEPAIQRTALLAQQQGRVDELRHAKYEGILEGNPAITVLRGEARFKDHQSLTVRLVDGGERIVTFDRCLVAT
    GASPAVPPIPGLKDTPYWTSTEALVSETIPKRLAVIGSSVVALELAQAFARLGAKVTILARSTLFFREDPAIGEAVTAAF
    RMEGIEVREHTQASQVAYINGEGDGEFVLTTTHGELRADKLLIATGRSPNTLSLALDAAGVTLNPQGAIVIDPGMRTSVE
    HIYAAGDCTDQPQFVYVAAAAGTRAAINMTGGDTALNLTAMPAVVFTDPQVATVGYSEAEAHHDGIETDSRTLTLDNVPR
    ALANFDTRGFIKLVVEEGSGRLIGVQAVAPEAGELIQTAALAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFNKDVKQL
    SC
    CAG

    >gi|261855811|ref|YP_003263094.1| mercuric transport protein periplasmic component [Halothiobacillus neapolitanus c2]
    MKKLFASLALAAVVAPVWAATQTVTLAVPGMTCAACPITVKKALSKVEGVSKVDVGFEKREAVVTFDNAKTSVPKLTKAT
    EDAGYPSSVKQ

    >gi|261855812|ref|YP_003263095.1| Mercuric transport protein MerT [Halothiobacillus neapolitanus c2]
    MSESQNGRGALFAGGLAAILASTCCLGPLVLVALGFSGAWIGNLTVLEPYRPIFIGAALVALFFAWKRIYRPVQACKPGE
    VCAIPQVRTTYKLIFWIVAVLVLVALGFPYVVPFFY

    >gi|261855855|ref|YP_003263138.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Halothiobacillus neapolitanus c2]
    MKSGLLLLSSLIMVLSLAWSGAVLAALKVGETAPSFNLPDQKGVMHSLADYRGKWLVLYFYPKDETPGCTTEACTFRDDI
    ATIQSMGAVVVGISEDSIDSHARFAKKYHLPFTLLADDDGATAQEYDSLFSILGMMKFAKRHTFIISPDGRLAAKFMDVD
    PDDHSKNVIAKLTSLINGSPK

    >gi|261855882|ref|YP_003263165.1| Glutathione S-transferase domain protein [Halothiobacillus neapolitanus c2]
    MLTLYQFESCPFCWKVKSLLHFSKIPYTIVEVNPMNSKELEPLGLKKVPVLVDVEQVVSESSVVMDYINEHYAHLANDDT
    VPEWREWVDNTLVHYIPPIIYKDFGTAWQTFGQVLKPSGFGVMKRTMIRLAGSLAMSKSSQKKARERGISDAPTGLTEAV
    AHWVNDGLAGRTFHGGETPDLADLSVFGVFRSTDGLAAVSLAKASSPTFAKWYEQLKSMTASTAL

    >gi|261855964|ref|YP_003263247.1| protein of unknown function DUF395 YeeE/YedE [Halothiobacillus neapolitanus c2]
    MTLSNFSWLTDSPIFSTTLWPAWVAGGAIGILAFAQRWMTDQPLGCSAAFGNACARMGSRLPLFQGPAHSTVTDWKLWFL
    VGIFLGGLLASLSTGSWAEPSHFGSLYTALMPHSDAGRVLWWLFGGVLIGMGSRLAGG
    CTSGHTINGVAMGSPASIVASI
    FFFAAAVGTAQIAQHLLNAIGG

    >gi|261856007|ref|YP_003263290.1| glutathione peroxidase [Halothiobacillus neapolitanus c2]
    MKRRQFLQTCALGAVSFSLPTWAASCPLLNQTVRTLDDDKEVNLCATYGGQVVLVVNTASYCGFTPQFKGLEKLYADYQS
    QGFAVLGFPSNDFAQDPKDEKQIKDFCEMTYGVKFPMFAKTRVRKDDADPLFKTLATAAGGDYPSWNFHKYLIGRDGKLF
    GSYGSTTTPAALQPIIEKALAAHA

    >gi|261856148|ref|YP_003263431.1| dihydrolipoamide dehydrogenase [Halothiobacillus neapolitanus c2]
    MASLETIKLPDIGVSGKVEIIEVLVEAGQIVEAETSMLTLESDKATMEIPAPKSGKIVELLIKVGDQVGTGDPIATMEVA
    TESAGESAPAAAEPAPAAPKAEATAATATPVAAPADLNADHQCDVVVLGAGPGGYTAAFRAADLGKKVILIERFEKIGGV
    CLNVGCIPSKALLHVSGILNETREMGSHGITFAEPKIDLDGLRGFKNGVIDKLTGGLKQLAKQRKVTILHGVGHFASANH
    IRITAADGSQSTVQFEHAIIAAGSQPVKLPFIPHDDHRVIDSTGALELADIPKRMLIIGGGIIGLEMAQVYASLGSKITI
    VELADNIIPGADKDLVRPLLKDIKKRYENIYLGSKVTGVTATADGLDVTFEGKSAPATDRFDRILVAVGRAPNGRKLNLE
    AAGVTVDQRGFIPVDARMQTNVPHIFAIGDIVGQPMLAHKAVHEGKVAAEVICGMKSAFTPITIPSVAYTDPEIAWAGKT
    EDQLKEEGIAYEKGAFPWAASGRSLSIGRDEGLTKALFCAETHRLLGVGIVGPNAGELIAEAVLAMEMGADMSDIALTIH
    PHPTLSETLGFAAEMAEGTITDLLPPKKR

    >gi|261856159|ref|YP_003263442.1| Rhodanese domain protein [Halothiobacillus neapolitanus c2]
    MKFIAASEFKARFEHAQNPVLIDLSQSSQLFLADAHWIDFNQIVRNEGERAGLLPDNAEFNRALAQTGITPDSTVFLFDD
    SQGLAASRLAWSLALCGLQEIYLIDGGREALLTAGWPVVTKPAAPKPASNLTFDFSAHHCHADAIAAQLGKPDGWLIIDA
    RSEEEYRGTDKRSRNAGHIPGAVHFDWQWFFDPEKPGYLLPDDVIRAKLSEKGINAKPNEKKGQTVAVY
    CQSHRRSSLMF
    CVLKHLGFQDVRGYPGAWSDWGNRDDLPAELATTE

    >gi|261856290|ref|YP_003263573.1| hypothetical protein Hneap_1701 [Halothiobacillus neapolitanus c2]
    MSLIKITPPEQAEGQLAETYRDIQNLFGMVPNALQISSANPELLANRWQATRYFRNHPTLGRALLATIRLLVSDANHCAY
    CVDFNAAMLINACDQTPEQVAATRQDPSQAPLSAKDKALLLFTLKSLHTPADVNSEDVAALHALGWTDRDLLDAVTHAAY
    NRAVDMILNTFKVERDF

    >gi|261856342|ref|YP_003263625.1| thioredoxin [Halothiobacillus neapolitanus c2]
    MSDLPYIFDVTAAEFQTRVIDASFETPVLVDFWAEWCGPCRTLKPMLEQITESYGGKLQLAKVNTDVEAQLAGHFGIRSL
    PTVMLVINGAPVDQFMGALPESQVREFLEKHIVSEVRALRNQAREQADAGAIEEAIDLLKQANAIEPNNADVLIDLAEII
    SKTGDHDQAMQIIDALPIDVATRKDVKELKARIHLAQHAGDGPSVEDLKARIEADDNDLDAREQLASRCAMMQDYECALA
    QFFAIMQRDRQFKDDAGRRGLLDIFELLGSDHALTKIWRRKMFGLLH

    >gi|261856369|ref|YP_003263652.1| electron transport complex, RnfABCDGE type, E subunit [Halothiobacillus neapolitanus c2]
    MSDISYRDLAVQGLWKNNPGLVQILGMCPMMAISNTVVNSLGLAMATILTMVVSNGLASVIRHWVRPEVRLPVFVMVVAS
    VVTVIELWMNAYLNTLYHVLGIFLPLIVTN
    CIVIARVEGFAARNPVLPSLYDGLMMGLGFGLVLVALGVIRELLGFGTLL
    ANAQQLFGPMAANWTIHVLPEQAHFLLAILPPGAFMALAILIAIKQAIEQCRAARLAQPVALELPKAATAS

    >gi|261856374|ref|YP_003263657.1| electron transport complex, RnfABCDGE type, A subunit [Halothiobacillus neapolitanus c2]
    MTEYVLILVSTVLVNNFVLVKFLGLCPFFGVSKKIETAIGMSLATTFVLTLSAIASYLTETFILEPLGLTYLRTIMFIVV
    IAVVVNFTEMVVRKTSPLLHNVLGIYLPLITTN
    CAVLGVALLNVQQAHNFVESALYGFGASIGFSMVLILFSALRERINV
    ADVPMAFEGVPIALITAGLMALGFMGFAGMVKV

    >gi|261856406|ref|YP_003263689.1| Rhodanese domain protein [Halothiobacillus neapolitanus c2]
    MYCGRTGLGLACALLLSGATVGMAVASADEMKFPLRAQYETVGVKPISTADLLAHFNNYTIIDARSEYEYQTLHIEGAES
    VPLSSPGFDQSVKALADKTKKPLVFYCNGTT
    CEKSYKAAVRAIQSGVKQVLVYDAGIFHWAEANPGKTDLLGKKMQSAGQ
    LISKADFAAHLLSPRDFYERVMGDPNAIVLDIRDAGQRAGVSLFQMRDVHVPLDNARLEDWVSRSKQENRAMFFIDATGH
    QVQWLQYYLKEQGLHNYWFMKGGAKAFYDTL

    >gi|261856460|ref|YP_003263743.1| heavy metal translocating P-type ATPase [Halothiobacillus neapolitanus c2]
    MSTVAVSEEKYTSATEEEVCFHCGLPVPPGSTFHSHVLGEDRPMCCPGCQAVADAIVENGMEDYYRHRTEPGVRPADNMS
    RMLEELSVFDRPEMQKSFVANRAGDTREASLILEGIV
    CSACVWLTERHVRQLPGVISFSVNFSTHRAQVSWDNRQIKLSE
    ILHAIAAIGYRAHPYDPNRQDRVFKRERHLLMQRLAVAGLVYLQVMMISLSLYFGDYLGINDQLRYFFWWMSLILSTPIV
    LYSGQAFFKPAWRDLKQKQVGMDLPVSLSIILAYAGSAWAVVTNSGHIYFDSVTMFIALLLGGRLLELSARHKAGEMSES
    LTRLVPAVAHRIEPDGSVLAIPAFDLVEDDRVLIRPGDAVPADGVVHEGESSVNAAMLTGESVPESKYPGAELVAGTINT
    ESPLVMTVRKVGQDTLVSSIVRLIDRAQSQKPKISELADRFARKFVFALLGITVVITAIWLWIDPSKAFWVAVAILAITC
    PCSISLATPSAIAVAVGRMTRSGVLVTRGYALEGLAHATHVVFDKTGTLTDGQLAVQRVESMSSFSADELLLWSGSLEQQ
    TEHSVGRAIVVAAKRNGALLPVTDVKNHPGRGMTGMVFGHGITVGNQRLFDELGIAAHIDFSASADLQVLIAIDGNLAGV
    VHLSDTIRADAKAALDEIVSLGLKPMILSGDHEARVAQMAKSLGVELAEGGLLPAEKLARVEQLQSQGAVVLMVGDGIND
    APVLAQAQVSMAMGGGTVIARHSSDIVLINDQLKQIPFSLRYSRRVMANIKENLGWSVVYNAIAIPLAAAGFVQPWAAAI
    GMSLSSILVVGNALRLRWD

    >gi|261856471|ref|YP_003263754.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Halothiobacillus neapolitanus c2]
    MLSKRRIGMQVVLLLLLSMAFGRAWADFTLPYGDQGNELDVKVVGGEHQRGPLFLWFTNQYGRTTGAEAIAHALARRGAT
    VWMVDLLDSLLLQRSNEVVRGLNGKGVAALMTAGVKTGRPVTVVGLDRMAVPILRGLRDWQASATNPDAITGAVLLFPNL
    YRGTPVAGEPPSFLGIVAATNMPVMILEPERGVNRNRLGSLLDALQGAGSPTFARIIPDVRDYFPLHLKTAQNASLKNLP
    DFMKPEEAKAMQALPNELLESSTLLAQAPHSAKVLPLDHALDKPIQQRFGLIPVTNQQAKNFALPDLNGNVHRLVHGALE
    SRPAVTLVNFWASW
    CPHCIQEIPSMNRLAESYPEGKLRVLSINFKESTAHVRHFMKQFSVHFPVLIDRQGDVAAQWGVFA
    FPSSFLVDDRGRILYSVNASIDWDTPKVKALIDQIIREEKRSAALAR

    >gi|261856492|ref|YP_003263775.1| Rhodanese domain protein [Halothiobacillus neapolitanus c2]
    MSSFKNIAPEELQSRLNEVLLIDVRGPSETARGIIQGAKLIPLHLVPMNVDQFKSEKDVVIYCHSGARSAQACHFLAGQG
    LTGLHNLEGGVMYWAGSGLTLVAPE

    >gi|261856514|ref|YP_003263797.1| methylated-DNA/protein-cysteine methyltransferase [Halothiobacillus neapolitanus c2]
    MLQQKQNATITYTGVETPIGLVFAAFSRGALYRISSGTETEFLQNISPTAGEVPIRADSILNDYARQILAVFTGDTPAHL
    PLYLETLTPFQQKVLNMTAKIPRGQVRSYGWIAQAIGSPNAHRAVGTALAQNPLPFVIP
    CHRVVRADGQLGSYSGGGTAV
    KARLLTLEEVPVAQAAGKFIVPKPFEPIYQP

    >gi|261856559|ref|YP_003263842.1| electron transport protein SCO1/SenC [Halothiobacillus neapolitanus c2]
    MSHARYGRRFPHVSLMLVRVLALLALGAFVSLGISACGDQSQTGSINERAVNIQRLSAFEPKDLLVMRSLKSPISVPPAE
    FMTANGLVKTPELFKGHWTLFYIGYTF
    CPDVCPTELTALAGLLPKLQQSLPGVKWQIVFLSVDPERDTPKRINEYVHYFD
    KQFIGMTGARSMIDKVTKPMKAGYRISAHNPGDASYEIDHDTAYRLISPDGKMVAILPSPHDPAAMDQALVRFFKEVVQ

    >gi|261856622|ref|YP_003263905.1| Disulphide bond isomerase, DsbC/G-like protein [Halothiobacillus neapolitanus c2]
    MSFSRSVTFRALFFGAMATSTVMASVSMARADQASDEQTIRKELAQSMAQLPIDSVAPSPIKGIYQIVSKGQIAYVTADG
    HYLFAGNLLDLKNQVNLTEKVRDQERVALLKTVPTDHKVIFAADGAKKGTVTILTDPT
    CPFCEKLHREIPALQKAGIEVQ
    TILTPRAGKGSPGYVESSQIMCSKDKIKNVDIAMARKPLSGDACKDSMIDANMALAEQLGMSGTPYIILPDGSAVPGYRP
    ASMLIPVITEQTTTE

    >gi|261856632|ref|YP_003263915.1| OsmC family protein [Halothiobacillus neapolitanus c2]
    MKARVKWVEGMAFMAESDSGHGIMLDGSPEIGGRNLGARPMEMVLMGLGGCTAIDVMVILGKQRQPVEDCWIELDAERAD
    VAAPKVFTKIHVHYVVKGSGLDPKQVERAVKLSAEKYCSVSAMLKGSVDITYDFEIKS

    >gi|261856723|ref|YP_003264006.1| iron-sulfur cluster assembly accessory protein [Halothiobacillus neapolitanus c2]
    MNTEVIEAAVDEAPLIFTENAANKVRSLIEEEGNPDLKLRVFITGGGCSGFQYGFMFEEAAQEDDAQVERGGVTLLVDPM
    SIQYLEGAEIDYKEDITGAQFVIRNPMASTTCGCGSSFSI

    >gi|261856726|ref|YP_003264009.1| Redoxin domain protein [Halothiobacillus neapolitanus c2]
    MNAEPNFSAQRRLLIGGAALGLFSALTGCSTETPVNLSGLAVQNLDGKPVELSSLLGKPTAITFWATTCPGCVEEIPHMI
    ALYDKFSAKGVNVVGMAMSYDSLNQLKAMVSEKKIPYTVLQDKTGAAAAAFGPVRLTPTFFVLDAKGNIRYQKIGPFDKT
    RVDQLLTALTSS

    >gi|261856747|ref|YP_003264030.1| DSBA oxidoreductase [Halothiobacillus neapolitanus c2]
    MSFSGFFRLSFLLRRWLGLGLLGALLVSPMTQAAPSAGSSEPVTLQENVNYRAVITDETPPSDGKILVQEMFWYGCPHCF
    HLEHPLEAWRKTLPANVDFEPYAVPLTPGWVPLTKAFYAAKFMGVLPQTHLKVFNDIHVKHIRPVTRDQIADMYADLGVD
    RDKFLQMYDSFGVDNAVRQAGVVAQDAGVTGVPAMLVNGKYLVTGDMAGSNEAMMPIVDALIAKIEAEKKAKS

    >gi|261856754|ref|YP_003264037.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Halothiobacillus neapolitanus c2]
    MSTAVEFDLIVLGGGSGGLAVAERAVQYGQRVAVIEPAHLGGTCVNLGCVPKKVMWYAANMAHTRHEAEGWGFAAVHDQI
    DFGKLVAGRNQFVDNIRSYWGGYANELGITVIQGKGVLTSASTVAVNDQTYTAPHIVLSTGGVPFVPPVPGKELGITSDG
    FFDLTAQPARVAVIGGGYIGVELAGVLRSFGSEVTLLDMLDSVIAPFDSMIREVATENLRTLGVEMRLPFRVQALTETAE
    GKFITSAADEQLGPFDEIIWAVGRAPNTRALGLDAAGVTVQPNGIIPTDDYQNTNVPGVYAIGDITGRAPLTPVAIAAGR
    QLAERLFNGRAQARLDYNTIPTVVFAHPPIGTVGLTEEAARAEFGDQAVTIFETRFTPMRYALSAHGFKTAMKLVCVDEE
    QRVVGLHLVGDGADEMLQGFAVAVKAGLTKAQFDATVAIHPTSSEELVTMKTPRDSA

    >gi|261856755|ref|YP_003264038.1| Redoxin domain protein [Halothiobacillus neapolitanus c2]
    MLENREGQRVPNVTFRMRENNQWVDVTTDDLFKGKTVAVFSLPGAFTPTCSSSHVPRFNELAPVFFKHGVDEILCLSVND
    TFVMNEWAADQNAEHIRFIPDGNGEFSEGMGMLVDKENLGFGKRSWRYSMLVKDGVIEKMFIEPNVEGDPYEVSDADTML
    DWLAPNAVKPHSVMLFSRRT
    CPFCARAKGMLRDAGMAFDEILVGEHVNLRGLRAATGSESVPQVFIDGQLIGGSDKLAEW
    LMANQ

    >gi|261856789|ref|YP_003264072.1| Rhodanese domain protein [Halothiobacillus neapolitanus c2]
    MSSVLLTAPQMKTLMDTEPTVVIDARNPDAYAAGHIPGAVNIHDIFTFLATSSPEGLEELKVKFAETFGKAGLSGKETAI
    IYEDAMNTGFGMSCRGYFLLSYFGYPKVNILHGGYQAWLAESLPVSTEVPTPIPASFPLIDTGTDLMIGKDEILAALDSE
    SPVLLDVRDIDEWIGTSSSPYGKDFCPRKGRLPGAVWIEWYRLMKPGAVPMFKAPEEVLAECATVGISKDTPVYLY
    CFKG
    ARASNTLVALKSAGIENVKLYFGSWNEWSRDPSLPIEEGLPYAVA

    >gi|261856792|ref|YP_003264075.1| OsmC family protein [Halothiobacillus neapolitanus c2]
    MAEKGKANPNTIVTLKAKTVCEGQFRNLTYIRSLDPVIVDEPPHLLGEDTAPNPSEALMAALGACLAVGVHANATARGIK
    LTKLELHIEGDINVTAVWGTGDLDDDKPLGFTAIRVKFDLETVDPMSESEKDALLQHAKKWSPVANTMTRPVALDCALI

    >gi|261856807|ref|YP_003264090.1| hypothetical protein Hneap_2228 [Halothiobacillus neapolitanus c2]
    MIRRTIHHLPLRHLVFLLLLAMMLVPSTQAADSRATAVAIASELTTTTWIGQGDGQKIVYFFFDPNCPHCNEAYERIKPI
    LAADKDIQMRYVPMGVLLPSSAGKAAAIIQSADPLAAYHRMEEGYGFSSQGDGGAIEPIKDISPATQKALDANYAILKNN
    HIPGMPLIVFQGDDGKPFMLFGTKSAEFYRKLLAHVAPGPFGGGHPIP

    >gi|261856826|ref|YP_003264109.1| arsenate reductase-like protein [Halothiobacillus neapolitanus c2]
    MMTLFGIPQCDTVKKARAWLVDHGVDYLFHDYKKAGVPEDLLDRWLAEFGWETVINRRGTSWRRLPQAERDAMTTTLARA
    AALNNPSLIKRPILVSDDVTLVGFDPEQWQHALIQEAINQ

    >gi|261856850|ref|YP_003264133.1| peptide methionine sulfoxide reductase [Halothiobacillus neapolitanus c2]
    MASNVHAADTGAGQTSAAATDSIVLGMGCFWGAEKRMSEIPGVVDVESGYAGGDKARVGYREILNDEQAIRRGALDERNH
    AEVIKVTFDPAKVSLKTILIKFWENHDPTQGDRQGNDVGSNYRSVIYYHDDAQKAVALETRDAYQTALTQAGRGTITTEI
    APLRNYNTAEEYHQDYLKKNPNGYCGLGGTGVAYPGSDQAASAPAPQLVAADLNADRQLIVFEAHDCPFCAQFKKDVLAD
    WRSPVPVVATLNPNPPKNWTLEKALFATPTIVLFEQGKEVSRYTGYNGDKDRFWKWLGFHLLTPEQQKIAFEQGTERPGT
    GSHLDEKRPGTFVDPITGAPLFRSDTKFNSGTGWPSFFNPLPGAIELREDNAYGMRRVEVISASSGIHLGHVFDDGPPPT
    GKRY
    CINGDVLNFVPDKP

    >gi|261856865|ref|YP_003264148.1| Ankyrin [Halothiobacillus neapolitanus c2]
    MHFKFLSTLGKRLSVLGAATLALTITACGGASSGTSITNTVWSASMMKNTDQASDQTGEPFRLNGRSAASVFSDSKVAEL
    ANEACDGAATKVKPLVQAGADVNGQGTQGITPLIWAMSCHNYAGISALLEQGANPNLPMANGSTAVYLAAGGSDPKILPL
    LLDHGGNPKEMKVFDHINNRHVYKSPLMNAAQMDRFENVKLLVTRGANVYYIEGPIPGCPFCGLTPLDVVKKPEIAIYLI
    RHSPDNKVRLQRYADFWWYHYSLLTPEERYKKYPDDYQASSELLQLLAERGVVPEDPAAPEEPPPSGSAEPQTKKDANQA
    KLDAFLKQREAEGQPCANGMAELGANGAPRCARLNPGAISATEWHQVKALSGVATQAGNKAPALYVFFDPN
    CPPCAQLWQ
    SRVSGKPFGDVPAVWIPVAYYSTDSLGKAAAILRQGDRAALERNFGAGYNVTKESGGITPVQPTRAESRHIAESRALWKD
    LGGGTPMLVFQTANGELIRFMGFPKNNISTLETIVQSLKQPKSKQPKLTPYKP

    >gi|261856866|ref|YP_003264149.1| hypothetical protein Hneap_2292 [Halothiobacillus neapolitanus c2]
    MLNARNFFLLAVLISFTALYPNQGRADDNDYATIVKEIYPAHYEKIPISYQDYQTQYRSFEGYLGDHFRVSDPGCVGGVV
    TLVDEVGAMYTVPPEVAGSIDKNVFFTWSHMLHGGTCQTGLVFSRDMKVKLVATYILGSVSLAGKITTPTVLTVYVKNPD
    DLKYLSVLERWAAAESRLTSAIPGMFAPKTYETRVYDLRCKTKGNRIDVPECRMHPAGLHAPSPAKSETQVWPSPDEHVN
    WAAMQSFWEQSMKLPGIDTGPADSPKHMLVYFDPN
    CPVCAQQWEQLIPYLDSVRIHWIPIAYFDKDSLSRAAALLAAAHP
    AQALLQNERAYDQKSHKGGYPIPSHIPSWARRAVQSNTREAERILGQIATPTLGFELEAGKKYYRFTGLMDATSIRTAVQ
    ALGRSPDSLPKQR

    >gi|261856873|ref|YP_003264156.1| hypothetical protein Hneap_2299 [Halothiobacillus neapolitanus c2]
    MNMRIRLVTVNLLFASAAFSNCYAATKHASKNDFIPPGKWVVVTPGYSSKLDDVDGSFYCVPKGNQAPDPIRLAAEIASS
    GSTGDYRWVGECKILKYAAQAHGFSAKLACSQTSERSGIKTSGPLLVKGEYNKPNEYIVTIRDPGQPPDPAADTTNYRKI
    SDTCTLNPRLTIVGPKTSIAQPLNPFLDVLSGLPEGTETNIPSAEPDASTPAKSETQVWPSPDEHVNWAAMQSFWERSMK
    LPGIDTGPADSPKHMLVYFDPN
    CPVCAQQWEQLIPYLDSVRIHWIPIAYFDKDSLSRAAALLTAAHPAQALLQNERAYDQ
    KSHKGGYPIPSHIPSWALRAVQSNTREAERILGQIATPTLGFELEPGKKYYRFTGLMDATSIRTAVHELGHAPEPSHKR

    >gi|261856876|ref|YP_003264159.1| Ankyrin [Halothiobacillus neapolitanus c2]
    MHFKFLSTLGKCLSVLGAATLALTITACGGASSGTSITNTVWSASMMKNTAQASDQTGEPFRLNGRSAASVFSDSKVAEL
    ANAACDGAATRVKPLVQAGADVNGQGTQRITPLIWAMSCHNYAGISALLEQGANPNLPMAGGETAVYLAAGGSDPKILPL
    LLDHGGNPKVMKVFDHINNRVAYESPLFNAAQMDRFENVKLLVTRGANVYFIRHPIPGCPVCGLTPLDVSKAEIAIYLIR
    HSPDNKVRLQRYADLWYEYSQLTSEEQRKRAPDDYQTIAELLQLLAERGVVPKDHNGIAPPPSGSSEPQTKKDANQAKLD
    AFLKQREAEGNPCANGRAKLGTDGAPRCARLDPGAISATEWHQVKALSGVATQAGNKAPALYVFFDPN
    CPPCAQLWQSRV
    SGKPFGDVPAVWIPVAYYSADSLGKAAAILRQGDRAALERNFGAGYNVTKESGGITPVQPTRAESRHIAESRALWKDLGG
    GTPMLVFQTANGKRIRFMGFPQNHLSTLETIVQSLKQPKSKQPKLTPYKP

    >gi|261856914|ref|YP_003264197.1| thioredoxin [Halothiobacillus neapolitanus c2]
    MSDKIAYVNDSNFDQEVLKSDLPVLVDYWAEWCGPCRMIAPILDEIADQYDGKVKVAKLNIDENPETPRQHAIRGIPTLM
    LFKNGKVEGTKVGAVSKSQLTAFIDGAL

    >gi|261856921|ref|YP_003264204.1| thioredoxin [Halothiobacillus neapolitanus c2]
    MSETSSIHVVCPKCDAVNRIPGERKGSGQCGKCGAELFSGQPITLTDQNFARQIGRNDLPVLVDFWATWCGPCQMMAPVF
    EQLAGRQKTKLRVGKLETEQAPQTAARFGIRSIPTLILFRGGQEVARTSGAMPLQALESWLQQQGVR

    >gi|261856922|ref|YP_003264205.1| glutaredoxin 3 [Halothiobacillus neapolitanus c2]
    MSEQTGSSSDTSSDVPIVEVYLSAFCPYCHFAKRLLKEQGLEFSTISVDFHSDRRAEMEQRSGRETVPQIFIGQTHVGGY
    DDLSALVSSGKLPALLEKERTRPHIQPNVQPDVHE

    >gi|261856923|ref|YP_003264206.1| Rhodanese domain protein [Halothiobacillus neapolitanus c2]
    MQEYIDFLMRHWALSLAAVVLIVLLLGNEMTRGMKKFRDMTAAEFARLIGRENVLLIDVRETDEFRGEHIKGARHIALGT
    VASKLSEFEKHKADQILLY
    CRSGNRSASAANMFVKAGFTQVAHLAGGITAWKAEKFPVVRK

    >gi|261856970|ref|YP_003264253.1| selenide, water dikinase [Halothiobacillus neapolitanus c2]
    MQYTSKEPVRLTQYSHGAGCGCKISPALLDEILKTSNIEKAHFSQLIVGNDSKDDAAVMDLGDGTGIISTTDFFMPIVDD
    PFTFGRIAATNAISDIYAMGGKPLMAIAIFGWPIDKLSAEVASAVIDGGKQACHDAGIPLAGGHSIDAPEPIFGLAVTGR
    VALDHLKRNDQAQVGDYLFLTKPLGIGILTTAQKSGVLRDEDRDTAPDLMCQLNQIGYELGHISEVHAMTDVTGFGLGGH
    LLELCQGSGTAAVIDLARIPKIRNIDRYLREKQIPGGTHRNFASYGKHLDDMTDEEKAIVCDPQTSGGLLISVAQTAVEQ
    VRELLKAKGKHAEPIGRIIAAEPNEKTVRFGAF