Halothermothrix orenii H 168 uid58585

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|220931029|ref|YP_002507937.1| NADH dehydrogenase I subunit F [Halothermothrix orenii H 168]
    MIKSKTDLEEAIKKAKDKLQEEGLRILVCAGTGCVAGGSLEIFDELKKKVENLSLPVKVGLLEEKESNVTVKTSGCHGFC
    EKGPLVKIEPLGILFTKVSQDDVDEIINDTIKAGKLVDKLIYKSPDGEAYSNEKEIPFYANQNRIALSNCGNIDPEDLDD
    YLAHGGYKALSKALLEMSPEEVCKEVTESGLRGRGGGGFPTGKKWEFAYREKADQKYVIVNGDEGDPGAFMDRSIMEGDP
    HRVIEGITIAGYATGATKGYIYVRAEYPLAVKRLRKAINDAYDQGLLGEDILGSGFDFDLMIKEGAGAFVCGEETALMAS
    IEGKRGMPNPKPPFPAQSGLWGKPTTINNVETLANVPQIILKGADWFTSLGTENSPGTKTFAITGDVANTGLIEVPMGMT
    LRELVYDIGGGIKNNNKFKAVQIGGPSGGCLTEEHLDMPMDFDSLQEVGAMIGSGGLVVMDENTCMVEVARFFMEFTQNE
    SCGKCVLCREGTKQMLKILERIVEGKGTMEDLDLLEELALAVKDGSL
    CGLGKTAPNPVLTTLKYFRDEYEAHVKDKKCPA
    GVCEALKSYKINPDLCKGCSLCARKCPVDAISGKVKEPFVIDQDKCIKCGACYEACKFNAVEVG

    >gi|220931088|ref|YP_002507996.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Halothermothrix orenii H 168]
    MGKKIVIVGGVAGGASTAARLRRLDEEAEIIIMEKGDHISFANCGLPYHIGGVIKEREKLLVQTPESMEARFNIDVRVRN
    EVVRIDRDKKEIKVRDLNKNEIYCESYDFLILSPGAEPIKPPIDGVDFPNVFTLRNIPDTDNINEFISKNNPDRAVVVGG
    GFIGLEMAENLQERGLKVSLVEMAPQVMGNMDYEMAAMIHNHLREQGIDLHLNDGIASVNRKGGKTVVVLQSGREIETDL
    VIMAIGVRPSTKLAREAGLEIGESGGIKVNEYLQTSDRYIYAIGDAIEVIHLVTGQSVLIPLAGPANKQGRIVANIISGK
    SDKYKGTQGTAVARVFNLTVASTGASEKLLKKAGRDYLVSYTVSKNHAGYYPGAKPMTIKLLFTPDRGVVLGAQIVGYEG
    VDKRIDLLATAVRHEMTVYDLQELELAYAPPFGSAKDPVNMAGYTASNILDGLVEVVYWDDINNLDKNTILLDVREEVET
    QIGSINGSVNIPLNSLRERLDELDKDKDIIVY
    CAMGLRGYIGYRILKQHGFKKVKNLSGGYKLYKAVQDDKSEEINTAGY
    QELNLTSNPGAGRKAGEEISREMSSNRVKLDACGLQCPGPIMQVYHKMEELKDGDILEVTASDPGFLRDVEAWCDNTGNT
    LVDKEKQGDVYKAVIKKGRGFKVENNTSSEDTVATSKGKTMVVFSGELDKAIASFIIANGAASMGNKVTMFFTFWGLNIL
    RKDRAVNTKKGFMEKMFGKMMPRGSKKLPLSKMNMMGLGPRMIRKVMEGKGVDSLESLIKQARENGVNMVACQMSMDVMG
    IKKEELIDGVEVGGVASFLGAADKSNMSLFI

    >gi|220931324|ref|YP_002508232.1| OsmC family protein [Halothermothrix orenii H 168]
    MPNLKFSVTSKSENPTKTVVEARDFKIVIDEPENLGGTNDGPNPVEYVLAALSGCLNVVGHLVAKEMGFELKGIEFELEG
    DLDPAKFSGQDTDTRAGYQEIRVNIKPDTNADEDTLSKWLEAVETR
    CPVSDNLANATPVKISLG

    >gi|220931330|ref|YP_002508238.1| heavy metal translocating P-type ATPase [Halothermothrix orenii H 168]
    MAEEKTKKSTLEIEGMSCASCALNVEKALEKAEGVKMARVNFASEKAYLEYDPEMVDEEKLAEVVRATGYDVKDEKERVT
    LDIGGMT
    CAGCAATVEKALKGTEGVYEANVNIATEKGTVEYDPSILTKNDLKKVVANSGYEVIGFEGDNREVEQDDDLRK
    VEEARWKMWGTWAFTIPIIAWMIPEMFFGITWPGQTIFNLGMILLAVPPLFIFGRKTFRTAYRAVSHGGANMDVLIAMGT
    GAAFITGPAVFFTPIANYAGVAAMIMAFHLTGKYIEENAKGRASQAIKKLLELGAKKATILEDGEEKEVPVEEVKPGDLM
    LVRPGEKIPTDGEIIEGRTTIDESMATGESMPVERKKGDEVIGATVNQNGLIKVKATRVGKDTFLSQVIKMVEEAQGTKV
    PIQEFADRITGIFVPAVLITATLTFILWLIFPGFFREIGFWAQDYLPWVNPELETFTLAIFATIAVLVIACPCALGLATP
    TALMVGSGMGAENGVLIRNGEAIQTMKDVHTIVFDKTGTITKGQPEVTDIITAQNYSHRKLLKLAAGVEAGSEHPLAIAI
    LNKAREENVKPPEIKGFESITGKGVKGRIDGENVLVGSRRLMEENDVDLSGFIRDLNRLEEEAKTAIIVAREKEVIGIVA
    IADALKEDSIKAIRELKESGLKTAMITGDNERTARAIARKVGIDYVVAGVLPDGKVEEIRKLQRKSGVIAMVGDGINDAP
    ALTQANVGIAIGTGTDIAIESSDITLVRGDLSAVVTAVKLSRATFRKIRQNLFWAFIYNTIAIPVAIAGLLHPVIAEIAM
    ATSSITVVTNANLLRRVNIKPDYMKN

    >gi|220931655|ref|YP_002508563.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Halothermothrix orenii H 168]
    MYNYDLVVVGGGPAGLAAALEAYKNGVNKVLLLERDYYLGGILQQCIHNGFGLDYFKEELTGPEYAERFIEKLGDTKIKV
    MTETMVVRVTPDKKIYALNKKEGLFVVNARAIVLAMGCRERTREAIRIPGDRPAGIFTAGTAQRYINIEGYIPGREVVIL
    GSGDIGLIMARRLTLEGARVKGVFEIMPYSSGLVRNKVQCLDDFNIPLYLKHTVIRIYGRDRVEKVTVARVDEKFRVIPG
    SEKDIKCDTLLLSVGLIPENELSKEAGILLDNTTGGPVVNEVRETDIEGIFACGNVLQVHDLVDYVTEEGEITGRAVSSY
    LNKKRTVRKKPIKLVPEDNVRYIVPHQIDYKDQSRKRVKLFMRVKEPMEKVRVRLLDPQTGNEIVSYPKPIVTPGEMVTV
    YLPEALIKENMDKIKISINKEEGGGHD

    >gi|220931660|ref|YP_002508568.1| methylated-DNA--protein-cysteine methyltransferase [Halothermothrix orenii H 168]
    MIKNYYPSPLGLMEITLSLDGLVSITFVKNVDNKYKNLYSINFTCKQLYELNKEVYNQLNEYFTGQRRNFNLPLAPAGTD
    FQKKVWQELLNIPYGETCSYGDIARALGKPGAARAVGRANGKNPLPIVIP
    CHRVIGSNGELKGYACGLWRKRWLIEHESY
    YSKQGQYRGLL

    >gi|220931735|ref|YP_002508643.1| Carboxymuconolactone decarboxylase [Halothermothrix orenii H 168]
    MDDLKMFREYREKMNEKILSEKNLNINRFFNLDTRVYKDGYLSSKTKEMLGLVSSMVLRCDDCIKYHLIRCKEEGVIREE
    FFEIFSVALIVGGSIVIPHLRRAVDFLEELEKKQEKEK

    >gi|220931957|ref|YP_002508865.1| glutaredoxin [Halothermothrix orenii H 168]
    MPELILYYFEECPYCQKVLDYIKKNEVEVTLRNTRKDHEARRELEMIGGKYQVPCLLINGSPLYESDDIIRWFQENNS

    >gi|220931972|ref|YP_002508880.1| putative glutamate--cysteine ligase/putative amino acid ligase [Halothermothrix orenii H 168]
    MIEYTKSKYTNRLINEKSPYLLQHAHNPVDWYPWGNDAFMKAKSEDKPIFLSIGYSTCHWCHVMERESFKDEEVARLLNE
    NFISIKVDREERPDIDAVYMNVCQALTGSGGWPLTILLTPDKKPFFGGTYIPKNSRGGRMGLIDLLSRVTELWSKNNEKI
    IKNADKITSSIQRSMTDDSYKGHKETSLGKNTLEKAFDDLKVVFDVEYGGFGTAPKFPIPHQLIFLLHYWYRTGNDMALY
    MVEKTLTAMRCGGIFDHIGYGFHRYSTDRKWILPHFEKMLYDQALLTYSYSEAYLATENKKFLTTIKEIIDYVRRELKSD
    RGGFYSAQDAESEGVEGKYYTWSVKEIENILGKQADRFIETYSLKSDGNFIDEATGKKTGKNVLYLRNYKEEVEELKKER
    EKLFKVRQRRRPPFKDDKILTDWNGLMIAGLARAGQATGEIEYITMAREAADFIINNLYSSDNRLYHRFRKGEVSIKGNL
    NDYAFFIWGLLELYQDTFEVKYLKKALKLIDQQLNYFWDNKNGGFYFTPDDEEEILVRQKEIYDGATPSGNSVSIWNLYR
    IGHLTGNSDYEEIAENILRVFSDKIKNDPASYSMALIGLNSLLGPGYDVVVVGDKNKAKTHKILYSLKNEYIPNVNTLFK
    PAHNGKILTELGPFIENYHMINNLPTIYVCKDYSCRRPTNNVDEAISMLKK

    >gi|220932133|ref|YP_002509041.1| Alkyl hydroperoxide reductase [Halothermothrix orenii H 168]
    MENINNIPLIGDRFPEMEVKTTHGVKNLPEDYKGKWFILFSHPADFTPVCTTEFVAFQKRFDEFKKMDAELIGLSIDQVF
    SHIKWVEWINDNLDVEIKFPVIADDTGRVASKLGLIHPNKGTNTVRAVFIVDPEGIVRAILYYPQELGRNMDEILRMVKG
    LQISDDNNVAVPANWPDNELINDRVIIEPASDEETAKKRLKEHKCFDWWFCHKELK

    >gi|220932171|ref|YP_002509079.1| Heavy metal transport/detoxification protein [Halothermothrix orenii H 168]
    MEDKKIVLKVEGMKCDNCRDNVEKALKEVEGVEHVDTDLTTGEVKVLCEEKTGIDSLKRAIKKAGYKVK

    >gi|220932267|ref|YP_002509175.1| electron transport complex, RnfABCDGE type, A subunit [Halothermothrix orenii H 168]
    MSEEFTRILLIFISTVLVNNFILVRFLGICPFLGVSRHVETAFSMGLATTFVMTMTGAATWLINTYILEMFNLPFLQYVS
    FIIVIASLVQFVEMFIKKTSPVLYKALGIYLPLITTN
    CAILGLALLIPLNGYNFIESIVFGLSAGVGFTLAIVLMAGLRE
    TLEFADVPEALKGVPITLIIAGIMAMAFMGFSGMISI

    >gi|220932268|ref|YP_002509176.1| electron transport complex, RnfABCDGE type, E subunit [Halothermothrix orenii H 168]
    MLKEFIKGLWNENPIFRLVIGMCPTLAVTNTAENGLAMGLATTFVLLSSEIVISLIKKLIPNDVRIPSYILIIATFVTFV
    DYFLKAFFPTIAASLSLFVPLIVVN
    CLILGRQEAFASKNPLHLSIADALGMGAGFTWALFVLSVVREALGMGTIFGNPIF
    GAGYEPMIIMVLPGGAFISLGILVGIMNYISRLGNKGER

    >gi|220932344|ref|YP_002509252.1| Thioredoxin domain protein [Halothermothrix orenii H 168]
    MQELTDKNFQKEIKNNKYSIVVFTTEGCGSCLLAKKYVKEVAQQFEELKLFECRVDKAPQSIKKYSVQGAPTVKLFVKGE
    SVYTGFGVRTPTDLYYQLESFIPKPNYYEELFGDN

    >gi|220932369|ref|YP_002509277.1| methylamine-specific methylcobalamin coenzyme M methyltransferase [Halothermothrix orenii H 168]
    MNGKEKIYNVFKNGSQKEVPWVPFAGVHAGKLKGYTAREVLTDENKLFESLKEVNKIYRPDGQPVTFDLQIEAEILGCEL
    KWSEDSPPTVISHPLSGSEEVPDRIPARDEGRIPLVLNVMKKMKEEVGEKTALYGLLCGPFTLASHLRGTNLFMDMVLNP
    DYVKKLMAYTTEVARAIASYYIEAGMDVIAAVDPMVSQISPEHFKEFLNRSYTELFAFIRDEGAFSSFFVCGNASKNIEE
    MCLTEPDSISVDENVSLPEAKEITDKHGIVIGGNIPLTTVMLHGNQQDNMKYTVDLLNSVSRDNLIISPGCDMPYDTPVE
    NTVAVEQAVHETEKVREMVKNYEVREEDIEVELPDYDALEKPLIEVFTLDSDT
    CAACTYMKAAAVEAGKHFGDKVEVVEY
    KYTTPENIARIKKMGVEKLPSIYINGELKFSSIVPNRRELLEEVEKCL

    >gi|220932648|ref|YP_002509556.1| thioredoxin [Halothermothrix orenii H 168]
    MSRPVDVTDGNFSREVLKSDKPVVVDFWAEWCAPCRMLTPVIKKIAREYSDKVKVCKLNVDENQSTASRYGVMSIPTIIL
    FENGKVKKQVTGYMPKNTLVKKLGIE

    >gi|220932649|ref|YP_002509557.1| glutaredoxin-like domain protein [Halothermothrix orenii H 168]
    MAKIGSEDKERIKELFSENLEGDVNIHFFTDGDACEYCEDTREILDEISSLDDRINLTVNNLGEEEAERLGINRAPAIVF
    VDDEGEDLGVHFYGIPSGYEFNTLIEDIIDISNNGPRDLGDDIKEQIKAIDKDVRLQVFITPT
    CPYCPRAVRVAHQMAML
    NPKVRGEMIEAIEFRDLSEKYNVSGVPKTVINDGAAEQVGAVPAQVILNKIKEV

    >gi|220932656|ref|YP_002509564.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Halothermothrix orenii H 168]
    MKKKYWLTLGAVILVIAGLFFNSYYISGGSEDNVQTGTAIGLLAPDFTLTKLSGEEVSLSDFRGKKVFLNFWASWCPPCQ
    AEMPYIQKLYTEHGDDVAILGVDIGEDKGTVAEFMLVNGYTFPVALDKKREVAAKYLVRGIPTTYIIDEDGIVTHRHVGP
    LYYEQMTELLELDQNNTP

    >gi|220932842|ref|YP_002509750.1| redox-active disulfide protein 2 [Halothermothrix orenii H 168]
    MKKIEVLGSGCPKCQKTTDLIKNELRNLDVEAEIVKVEELDEIVNRGVMMTPAVVIDGEIKVEGKVPSSSEIRSWFE

    >gi|220932873|ref|YP_002509781.1| thioredoxin reductase [Halothermothrix orenii H 168]
    MAGNNKEKMIIIGGGPAGLTAAIYAARAGLNPMVIVGPEPGGQITTTSEIENYPGFPEGITGFDLMQKVIEQAQKFDVRL
    QYEVVENVDFNNSPYNIKTDGGEYQADSIIIATGASPRKLGLEKEEDFIGKGISY
    CATCDGAFFKDQEVAVVGGGDVALE
    EANYLTNFCSKVYLIHRRDQFRGTKILGDRVKNNSKVEILWDTEVRELLGGNKVEGLLVENNKTGEETRLENVKALFIAV
    GYKPNTDLFKGQLEVDDRGYIITNDRLMTSKEGIFAAGDVQDPHYRQVVTSAASGAIAAMEAGKYLETIED

    >gi|220932925|ref|YP_002509833.1| heavy metal translocating P-type ATPase [Halothermothrix orenii H 168]
    MLTNLKTRQETLPHNKKEGLSFIKKEYMLEGLFCANCAGKIVQEIKELPVVYDATLNLSTGRLIVFLKKQADFEAGLLIS
    QVQEIADRIEPGLTVKPSGQNENQNRTNKAGETSTLKNKITSENEGKHQSYDLLLISGILLFALTLYFDYRGFDFVPFGI
    PLLYSVAYLLVGRSVLKLTIYNIGKRNFFDENFLMTVATLGAFGVGEFAEGVSVMLFYKIGEYLQERAVKRSRRSIKEMM
    DLKPDYANLIREGKIVQVSPEQVKPGDKIIIKPGERIPLDGRVIKGKSRLDTSSLTGESVTRAINKGDKVLAGAINKNSV
    LTVEVIKEYRESTVSRILNLVEEASNRKAATEKFITKFARYYTPAVVGIAAFISLIPPLIFPGSSFSNWLYRGLVFLVIS
    CPCALVISIPLGYFAGIGRASRDGILVKGGNYLEGLANITRVIFDKTGTLSRGVFRVQEVSATGNYTGEKLLKLAATAEY
    YSHHPVADSIKEAYGKEPDLVNIEGYNEIPGQGIEATINGKEILLGNKTLMEREKVIGFKEASGEGSIVYVAVNKDYAGY
    IIISDELKSDSKKAIRSLKKLGIEDITMFTGDREKTAAAVSKRLGLDNYEASLLPGDKVAKLEEVLNGTYHGRVAFVGDG
    INDAPVLARADIGIAMGGLGSDAAVEAADVVIMTDEPSKLGKAIFIARRTRSIVWQNIVMSLGIKFLILVAGLFGLATMW
    AAVFADVGVALLAVLNSIRVLTLKK

    >gi|220932932|ref|YP_002509840.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Halothermothrix orenii H 168]
    MKIAIIGGVAAGTSAAAKAHRENPEAEIILFEKDENISYAGCGLPYYISGVTDSRQKVVINTPEAFTKKYKVEVRTGHRV
    DEIIPDKKLIRYRNLKNNRDGEYRYDKLIITTGASPVIPPIPGIKLNNILTLRTINHADMIKNILNKNKPERVSIIGAGL
    IGLEMAESFSKLGLKVTVIEKLPQVLPQFSPEMAQIVGAHLKENGVDLLLKDGVVKFTGDNSVEKVITESGQEIKTDLVL
    VSVGIRPNVELARKAGIKIGPTGAIAVNNKMQTSLSDIYAAGDCAESTDLVSGKSIWAPLGSTANKQGRVAGENAAGGNN
    RHDGVLKTAITKVFDLTVARTGLSEKEASEAGFDPIGVKIKAVNHAGYYPGLDKLHIKGVFDKKTKRIIGAEVIGKNGAD
    KRIDVLSTAIYSKLTTHDLFQLDLAYAPPYSTPKDAVARLGMVSQKKFK

    >gi|220932935|ref|YP_002509843.1| dihydrolipoamide dehydrogenase [Halothermothrix orenii H 168]
    MVELTLDGLLNNASEAKVTRVNVEEGEKINKGDLLFEVEANKAAIPVESNYEGKITKIAVKEGDVVKKGDLLATIEETEG
    EANQKQEDTNPEKAGNAMEADITIIGAGPGGYVAAIKAAQMGAKVVLVEKDKLGGT
    CLNRGCIPTKALVRSAEIYNYLKE
    ADDFGCHAENISLNMKKVIKRKDKIVSRLVKGIEFLMRKNGVKVIQGSGQIKDPETVYVKKDNGDVVINTSNIIIATGSV
    PAHLPIEGADLPGVINSAEALELEELPEKMVIVGGGVIGMEFAFIFNSFGVDVTVVEYLDDILASNDSDICSEITSIAEN
    RNIKIFTGSRVEKINETEDGKYIVSFTQNDKNKFVTGDKVLMAVGRKPFFEGIGVEELGLELNEKGRGIKVNDKMQTSIP
    NIYAIGDVTSKILLAHAASHQGIVAVKNIMGEECKMDYGAIPGAVFTDPEIATVGYNEKTATEAGIEYNVGVFPFKANGK
    VLTLGENKGFIKILTEKDTDKVIGCSMIGPHSTDLIAEVTLAVKNGLRAEDIAETIHAHPTTAEVIHEAALSAYEKPLHT
    FQ