Halorhodospira halophila SL1 uid58473

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|121996871|ref|YP_001001658.1| RnfA-Nqr electron transport subunit [Halorhodospira halophila SL1]
    MDADSLSYIFLNAAIINNFVLALFLGICPILGVSGKLGTAFPMGVASAFVMLIASLAAYGINIVLGYFELEFLSLIAYIA
    VIASAVQLVEMFVKKFSPPLYRALGIFLPLITTN
    CAILGVALFQTSYEYNFLQSLTYSLGAGAGFILAIVLMAGLREQVD
    LSDVPSVARGAAMSLMLAGVLSLAFMGFAGLGG

    >gi|121996872|ref|YP_001001659.1| electron transport complex, RnfABCDGE type, E subunit [Halorhodospira halophila SL1]
    MAAKREQEPITMDTFLSGVWRENPVFVMLLGMCPVLAVTNTTENALAMGLATTFVLVCSTGLVSVLRDFIPKEVRIASYI
    VIIASFVTVVDYAIQAISLDIYNALGAFIQLIVAN
    CMILGRAEAFASRKPLGKTLVDALGVGAGFTLALLCLGTVRELLG
    AGEILGIQVFADRFEPWVIMLLPPGGFFVLAGWLLLFAWIKERQNQRAAAGKEATADGR

    >gi|121996883|ref|YP_001001670.1| disulphide bond formation protein DsbB [Halorhodospira halophila SL1]
    MSKMHAWLGSGRCLLGLVAVLAATAGVIVAGAEHWGGLQPCSLCWTQRGILAVLMVVALLGVLFWPRGRGGRWLLGGALI
    IVTAAGLAAAGRHLYVMWNPEVVD
    CGMSPEVMLQMLPWREFLIELVTGNTDCAEAAVLFGIPLPVASFFGFTVLGAASVY
    AVFRLR

    >gi|121996884|ref|YP_001001671.1| alkylhydroperoxidase [Halorhodospira halophila SL1]
    MYKDWASTADELSTLFKEVRKGQPDVAKGFSAIAQAATADGALSPKTKELIAVAISVATRCDGCIAFHTKAAVKHGATRD
    EILEMIGVSVYMGGGPSLTYGAQALEAYDQFAAQG

    >gi|121996885|ref|YP_001001672.1| rhodanese domain-containing protein [Halorhodospira halophila SL1]
    MEQQIPKRRVLEQFAVIAKAVGHEYRLELLELVAQRERSVEALTQLTQLPVGSVSQHLQQLRRAGLVTARKEGKYVYYSL
    ADEQVLTLMSTLRRVAERNISEVNQLVAQYLADDQDLDAVSSAELLERLQRDEVTLIDVRPPEEYASGHLPGAINVPLEE
    LEAHLQELPTEQQVVAY
    CRGPFCALARDAVRRLRRRGVDATRLNQGFPEWKAEGLPVQ

    >gi|121996895|ref|YP_001001682.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Halorhodospira halophila SL1]
    MLKRILIPLAIAVPVLGLLYVGLGMDSRELPSPLVGEPAPAFELEDLDNSGETLTHEDFTGDVAVVHVWSSTCPVCHEDF
    PHLERLSEHGVQVYAFNYRDDRAQAQRYLQVRGNPYDRIAHDPEGEAGMEWGVYATPETYVLDKDGTITYKEIGPLDEEV
    VEEEILSLVD

    >gi|121996910|ref|YP_001001697.1| redoxin domain-containing protein [Halorhodospira halophila SL1]
    MPIEEGQPAPDFTLQDADTNRVTLSELRGQPVIVYFYPRDETPGCTKEACAFRDVWTELQSAGAVVLGISPDDAAAHQRF
    RDRHELPFTLLSDPEKEVMSRYGAWGEKNMYGRKSMGVIRSTVLIDAEGIVRKHWRRVSKAAEHPRKVLEALQRMT

    >gi|121997022|ref|YP_001001809.1| glutaredoxin [Halorhodospira halophila SL1]
    MSDERPAASPSEDPGEQRRLQRRIDRAVEGLVLYERPWCPFCMRVNLTLRSLGIDLERRDIGQDPQAARELEEQGGKRMV
    PCLYIPDGGAGQWLYESGDIAAYLSALVEELGPDTREG

    >gi|121997033|ref|YP_001001820.1| rhodanese domain-containing protein [Halorhodospira halophila SL1]
    MLLLEPGDLQVLQEREAVLVVDIGDDDGRYRQTHIPGAVHLPYGHLTRADPPVMGLVPDTTALAERLGAVGIDDGVTVIA
    YDSDGGGRASRLLWTLDLLGHPRHGLLNGGLQGWLAEEGPVEGGQVTPAPRAYPAQVRHPECLVDRDWVRDHLDDPGVTF
    LDARSRGEYTGTDVRARRGGHIPGAVHLDWQALMDPEDPPLLRPAPQVQELLRERGIDDPEQEVVVH
    CQTHHRSSLTYVV
    LRALGYQRVRAYAGSWSEWGNDPQLPVREGAE

    >gi|121997092|ref|YP_001001879.1| electron transport complex, RnfABCDGE type, A subunit [Halorhodospira halophila SL1]
    MTEYLLLLIGVALVNNVVLTQFLGLCPFMGVSNRLDTALGMGLATTFVLTLAAAAGWVIEHALLIPLGLEFLRILSFILV
    IAGTVQFTEMAVARVSPTLHQVLGVFLPLITTN
    CAVLGVALLNIQEAHTFAQSLVFGVGAALGFTLVLVLFAGLRERLAT
    AAVPAAFAGAPIGFVVAGLLSLAFMGLTGLPEGG

    >gi|121997097|ref|YP_001001884.1| SoxR-reducing system protein RsxE [Halorhodospira halophila SL1]
    MADTDAGLAGPAPAAEAGRWRRIAREGLWDNNVVFAQLLALCPLLAVTSTATNGLGLGLATLFVMVLSAVLVSTLRGLIT
    DPVRIPVFILLIATLVTVVDLFMEAHLNPLYQALGLFIPLIVTN
    CAILARAEVFASRHPPAEAAFDGLMMGLGFTAILLV
    LGGVRELLGAGTLFDQAGLMLGDAFAFLEITVFPDYPGFLLMVLPPGGFIALGFLMAGKRLLDRRREAQTA

    >gi|121997119|ref|YP_001001906.1| hypothetical protein Hhal_0310 [Halorhodospira halophila SL1]
    MHPPVSALDSLPWEATYAALPAAFHVRLEPTPVGHPRWVQLNLPLARQLGLDPERLTTPEALAVFAGNRVPAGADPIAQA
    YAGHQFGHFVPQLGDGRALLLGELIDVDGVRRDIQLKGAGRTPFSRGGDGRSPIGPVVREYLASEAMAALGVPTTRSLAA
    VATGETVWRQGPEPGGVLTRVAASHVRVGTFEYFGQRGDRSALRRLADYVLYRHYPHCAQAPRPHQALLEAVAAATAELI
    AAWMHIGFIHGVMNTDNLSVAGETIDYGPFGFLDAFDPATVYSSIDRFGRYAFDQQPAIGEWNLARLAEALLPLLDDDPD
    TAVDLAREALSGYRPRFEAAHRAGLRAKIGLAEERPGDDDLVHDLLRRMAAEGADWTLTFRRLSDLDGADARGDEPFRGG
    FRDPQAADDWLAAWRGRLMAERRSDAQRRAAMRAVNPAFVLRNHLAQWAVDAATERLDFAPMERLLVVLGDPFSDQPEHA
    DLARPPEPGQAVTRTF
    CGT

    >gi|121997249|ref|YP_001002036.1| redoxin domain-containing protein [Halorhodospira halophila SL1]
    MVRTESTMLPIGTPAPDFTLTDTDGRPVSLREDLAGGEGVLIAFICNHCPFVKHLRDHLAHFGRECQERGIAVAAISANN
    PETHPDDGPERMAEEKEAAGYTFPYLFDPDQSVAKAYRAACTPDFYLFDAGLKLYYRGRFDDSTPRNDRPITGADLRGAV
    DALLEGAVPPHPQYPSIGCNIKWREGNEPDYFTAGG

    >gi|121997389|ref|YP_001002176.1| redox-active disulfide protein 2 [Halorhodospira halophila SL1]
    MKAIKVLGSGCAKCNNTAERIEQVAADLGLAAQVQKETGPEALVQYGVMSTPAVVVDEQLVHSGSVPEPEQIKEWLQ

    >gi|121997443|ref|YP_001002230.1| dihydrolipoamide dehydrogenase [Halorhodospira halophila SL1]
    MTDLDTDVAIIGAGSAGLRAYRSAAAHTNRVLLIEGGQYGTTCASVGCMPSKLLIAAADAAHRAHDAAGFGIHAGSVEVN
    GAEVMERVRSLRDKFVSGVVANTEKIPAERRIHGYARFEDARTLRLDDGRRIRAQRTVIATGSRPNVLPMFDGLGDRAVV
    NDDLFRWTDLPESVVVFGPGVIGMELGQALHRLGVRVRIFGIGGFLGPLTDPRVKDAAEEIFGDELALDTDAQVESLERE
    GNEVVVRFRDQSGALVEERFEYLLAATGRRPNVDNLGLETTGITIDDTGVPVFDHSTMQCGDQPIFIAGDANNESPVMPD
    AFDEGEIAGTNAGRYPDVQPGRRHCSMSIVFTEPQMALVGTRYADLPKDDYAIGEFDFSGQPRAIVMRENHGLIRLYGRP
    SDGTFLGGEVLGPRAEHLGHLLAWATDAAMTVDRMLDLPYYHPVLETGIRNALHDLKHKMRA

    >gi|121997444|ref|YP_001002231.1| rhodanese domain-containing protein [Halorhodospira halophila SL1]
    MAEPINQRKLLEQLAGIGKALGHAYRLELLELLAQRERNVDELTRLTGIPLASVSQHLQQLRRTGMISARKEGTRVYYTL
    ADEQVTALLGMLREVAERNIAEVRRMTEQYSHDSEALDAIGSEELLERLRAGMVTLIDVRPPEEFAAGHLPGAINIPAEE
    LEAHLDELPAGREIVAY
    CRGPYCALSIDAVRQLRTRGRQAYRLARGFPEWKAQGLPVQ

    >gi|121997489|ref|YP_001002276.1| rhodanese domain-containing protein [Halorhodospira halophila SL1]
    MTELLHWIEEDPVRFVALAAVAILGGRLLWRRLTRRYRPIPVTEAVCWVNDGETLFLDVRTTPETRGGVLPGAVHIPKHQ
    LRRRLQELRSHSAAGGPVVVY
    CHSGMRSAGAAHLLTRHGFEPVYNLQGGVMAWHAQGLPFESGPGARDE

    >gi|121997516|ref|YP_001002303.1| electron transport complex, RnfABCDGE type, A subunit [Halorhodospira halophila SL1]
    MDLLLLAVAAVLVNNFVLTQFLGLCPFLGVSRKVETAAGMAAATAFVLTLASVLSYLAFTYILVPLDAEYLRTPTFILII
    AIAVQLTEMAVRFTSPMLQQVLGLYLPLITTN
    CAVLGVALLNLRGDHDLIASAVYGAAAAAGFGLVLVIFAALRERLESA
    EVPRAFRGAPIALVSAGILSMGFMGFAGLAQAGERELATDREDMVEVEVTTLTLEEGGAPAPVILLGEPDSEQMVPIFIG
    PSEAQAIHDALHGVEPPRPMTHDLFGNVLRATGYTLQAVYIDAIVDGAYVAALALAPEDGGEVRYIDSRSSDAIALALRA
    EATIYAAPEVLEAAQEREQQRPRDESLRMTRLDLVPGPTT

    >gi|121997520|ref|YP_001002307.1| electron transport complex, RnfABCDGE type, E subunit [Halorhodospira halophila SL1]
    MSETPTPRSIFRDGLWGNNAALVQLLGLCPLLAVTTTAVAGLGLGIATLLVVTASSVVVSLIRNLVPQDVRIPVFILVIA
    AFVTIVELVVAAWLHDLYRTLGLFLPLIVTN
    CAILARAEAFASRQPVGPAALDGIATGTGFAAVLIVLGALRELIGRGTL
    LDGAEQLFGPIAANWTLELVDGDVFLLAILPPGAFIGLALLLAIKNRIDDRHGR

    >gi|121997526|ref|YP_001002313.1| glutaredoxin-like protein [Halorhodospira halophila SL1]
    MSDESVQQTIARQVSENPILLYMKGSPEQPMCGFSQRAAQALAGCGREFAYVDVLQDERIRQGIKDYGDWPTIPQLYIDG
    ELVGGCDIIMEMFDSGELQQLVDAAGAGASG

    >gi|121997670|ref|YP_001002457.1| iron-sulfur cluster insertion protein ErpA [Halorhodospira halophila SL1]
    MSDIAEPETHAPADDQLLIFTDAAADKVRELLDGEEGGDVKLRVFITGGGCSGFQYGFTFDETVEEGDTIIEKRGVKIVV
    DPVSGIYLQGAEVDFSSGLEGEQFIIRNPNATTTCGCGSSFAI

    >gi|121997734|ref|YP_001002521.1| thioredoxin domain-containing protein [Halorhodospira halophila SL1]
    MSASPNVVDVTVENFKEQAIDASMQQPVLIYFWAQWCEPCKTLSPLLEKLADEYKGGFRLAKVDCDQQQQLAAQVGVQSL
    PTALLVKEGQPVDQFMGAVPEGELRQWLGQYVEAPEADPYEQARELMSEGRSAEAVPYLRAAREQRPDDAGVTIDLARAL
    LQSGDADEAFTLIEGLSTNDQQDPRAQGILARKEFAERVRDLPPLETLEQRVEADAGDGQARLELALRLVVAGGELEALD
    HLLHLVQRDRERRDEAHQVALQVLGMLGPEHPEARRYRQRLFQLLH

    >gi|121997791|ref|YP_001002578.1| UBA/THIF-type NAD/FAD binding protein [Halorhodospira halophila SL1]
    MNDEQLMRYSRQIMLPELDITGQERLAASRALIVGAGGLGSPVALYLGAAGVGELRIADDDVVDLSNLQRQIAHRQDALG
    QPKAASATRAVTARNPEITVTPLEERLDGERLGAEVGAADVVIDATDNFATRFALNAACVAAHRPLVSAAVIRWELQVSA
    FRPGGRPCYRCIYAEGDEPQLT
    CSESGVLGPLPGVAGSLEAVEAIKILTGAGTPLFGRLLVVDALRMRLRTLTVNGDPHC
    PVCAEAP

    >gi|121997826|ref|YP_001002613.1| dihydrolipoamide dehydrogenase [Halorhodospira halophila SL1]
    MAEQQVKVPDIGGFEAVEVIEVLVGPGDRIESEQSLITLESDKASMEVPASAAGVVREVHVAVGDTVSEGAPILTLEAEA
    EADAAGGNEERAAPPGESAEAPSPGPVEPTAPAPAAAAAGAPQDPDCDVVVLGAGPGGYSAAFRAADLGLKVVLVDRYPV
    LGGV
    CLNVGCIPSKALLHAAKVVDEADQFAAHGIAFGKPKIDLEQLNDWKRGIIKQLTQGLAGIAKQRKVEVVTGEAAFA
    DAHHLHVSGDDGARTISFRH
    CIVAAGSRPAIPPSLAVDDPRVMDSTGALKLEEIPDRLLVVGGGIIGLEMASVYSGLGSK
    VTVVELSDRLMPGADPDLVKVLRKRLAKRCEAIHLNTEVTGVKANKKSLTVTMNGQDAPESDRFDRILVAVGRRPNSDRI
    GVEAAGLAPGEDGCLSVDEHMRTAVPHIHAVGDIVGQPMLAHKAVHEGKVAAEVIAGEKSAWDARAIPSVAYTDPEVAWV
    GLTEEQAKAEGVAYEKGAFPWAANGRALSLDASDGVSKILFDAETGRVLGGGIVGPGAGDLIGEIGLALEMGADAHDIGL
    TVHPHPTLSETVAMAAEMASGSITDLLPPKKRK

    >gi|121997875|ref|YP_001002662.1| dihydrolipoamide dehydrogenase [Halorhodospira halophila SL1]
    MSNHYDVIVIGAGPAGYSAAIRCAQLGMRTAVVDAFVFKDGEPALGGTCLNVGCIPSKALLDSSEQYHKVTHQLSAHGIT
    AQGVELDVEKMIARKDRVVKDLTGGIRQLFKANKIEWLHGHGQLVEAKTVEVRRPDGSTERHSADSVVLATGSQSVELGA
    APLDHERIVNSDRALDFTEVPERLGIIGAGVIGLEMGSVWSRLGSEVVLLEAQDEFLGPVDRQVARTAQKEFKKQGLDIR
    LGCRVTGTRVDGSVTVSYEDKNGKQELEVDRLIVCVGRRPNTDDLCSKEVDLLLDERGFINVDEDCKTNLPDVYAVGDVV
    RGPMLAHKGQEEGIVVAERIAGKGGHLNYETIPWVIYTDPEIAWVGRTEEQLKKAGIPYNTGVFGFAANGRARAMDQTAG
    MVKLIAHAETDRLLGAHIIGPQASELIAEAVVTMEFAGSAEDIARTIHAHPTLSETVHEAALAVGKRAIHKAN

    >gi|121997953|ref|YP_001002740.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Halorhodospira halophila SL1]
    MRGSISRRSFLQLGASSLGVAALGPLVGPLTAHAGQQLDARIVVIGGGSAGATAAKYLKHYAPGLRVTLLEPNETYYTCY
    AGNWYLGGFRELETLGHGYGNLRDRHDVEVIHDRAMAIDPGSKEVDTRTNGKLTYDRLIVAPGIEFAWDRVEGMGPEDTE
    AIPHAWEGGRPFEVLRRQLKDLEDGGTVLVCPPEEPYRCPPGPYERMALIAHYLKQEKPRAKILGLDPKETFSKQDLFKQ
    GWEALYGDMIEWIPGSQGGAPERISVSDRKVFTDGGAQAHTGDVINFIPPQRAGAIAQEADLVDDTGWCPVNQKTFESTR
    HSDIYIIGDAAVAGAMPKSAHAANNHGKLVAATIASDLRGDSLPDFPTVNTCYSLVSPEWGITIAGVYEHQEGEITEIEG
    AGGLSPLDADRDQREIEAMYAPGWYESITEDIFG

    >gi|121997983|ref|YP_001002770.1| redoxin domain-containing protein [Halorhodospira halophila SL1]
    MATVTLKGTPFRTCGELPGTGSAAPDFRLVDGELQDHRLADFAGRRLVLNIVPSLDTPVCGASAKRFDELARDNTGVTFA
    TVSADLPFAQQRFCGTEGVGNVAMLSAMRDAAFARDYGVRIEEGPMEGLCARAVVIIDEGGQVAYTQLVPEIAEEPDYDD
    VQRAL

    >gi|121998117|ref|YP_001002904.1| hypothetical protein Hhal_1335 [Halorhodospira halophila SL1]
    MSRAMRQGILGLLGGALLMVGCSDGTPGESAKADVFDQLADSHYITHGESDFRVYAVKDPHCPACTNLKNAVENGATPSV
    EWRWVPVGFLGSGAQADAAAMIEDEKDIDGYDAVQANMQLAQDLGVRSVPTVFYRDTDGEVRFFVGGDQQALDALERMAS
    E

    >gi|121998152|ref|YP_001002939.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Halorhodospira halophila SL1]
    MNKRLLLPLLLTLPVLGLLYVGLTLDSRSLPSPLVGKPAPDFELESLRDAGVTLTRDDFIGEIALVNVWASWCDSCRHEH
    TYWRQLADRGIPIHAFNYRDSRENAHRYLEFFGDPFREIAYDPRAEAGMEWGVYATPETYVLDAEGIIRHKHIGPVNAEV
    LRNDILPLIEELEAERS

    >gi|121998162|ref|YP_001002949.1| peptide methionine sulfoxide reductase [Halorhodospira halophila SL1]
    MAETRAATFGGGCFWCIEGVFQRLRGVEAVVSGYAGGEVEAPTYRQVCTGTTGHAEVVQVRFDPEQISYRELLEVFFTIH
    DPTQRNRQGPDVGSQYRSIILYTDEEQRRTAVEVIGEIDAAGELPAPVVTEVEPLYTFYPAEPEHQRYYDGAPEAPYCRA
    MIAPKIARARERYPDRFAEG

    >gi|121998372|ref|YP_001003159.1| methylated-DNA--protein-cysteine methyltransferase [Halorhodospira halophila SL1]
    MGGDSAPHGVARLAGVFLGVSLDGEGCVARIRISLRLPTAASGPADRQVHDVVRCLEAWERDPLAPARLPRAPAASPFQA
    RLREALLALEPGQTVSYGELARHLGTSPRAVGAGCRANPLPLLVP
    CHRVVGSRGAGGYAGTAGGSLTRFKAWLLAQEQR

    >gi|121998374|ref|YP_001003161.1| methionine-R-sulfoxide reductase [Halorhodospira halophila SL1]
    MAKIEKSEAQWREVLTPEQFAVTRQGSTETPFSGAYYHCDRSGVYRCVCCNSALFSSRTKFESGTGWPSFWAPVDDDQVV
    IREDRSLGMVREEVLCATCDAHLGHVFADGPPPTQLRY
    CINSVALQLDEESAPE

    >gi|121998468|ref|YP_001003255.1| glutaredoxin family protein [Halorhodospira halophila SL1]
    MSHPKEGQPVPRVTFRTRVNGQWQDVTTDELFKGKTVVVFALPGAFTPTCSSTHLPRYNELAPVFWDNGVDDIVCLSVND
    AFVMEEWRRDQHAENVTFIPDGNGEFTEGMGMLVDKNDLGFGKRSWRYAMVVRDGVIEQMFVEPEKPGDPFEVSDADTML
    RHINPEAPHPSFVTLFSKPG
    CPHCARAKALLEEHGYDYEEICLGEGITTRSVRAATGSGMVPQVLIDGRLVGGADDLEAR
    LGRTRSAA

    >gi|121998482|ref|YP_001003269.1| redoxin domain-containing protein [Halorhodospira halophila SL1]
    MSALNQTVALGPLVLSIGQILLILALVVALIAGGLAARRSGVSVSDSLFSLVLVGLVGARVLFVFHYWESFESLWGVVDI
    RDGGFDPVGGVVAGLAYLAWRFWRSPQQRRALVTAVVAGGIVWGVTAGPLLVIDQQSRSVPDVAVSTLEGEHTDLPALIE
    ETGKPVVVNLWATW
    CPACQQEKPVFEQAQEREDGVKFVFVNQGEDAGQVQGYLEEHAPSLDNILMDPHQRWSDATGTRGL
    PATFFYDEQGQLVDSHTGQVSSASLESGLERLR

    >gi|121998572|ref|YP_001003359.1| iron-sulfur cluster assembly accessory protein [Halorhodospira halophila SL1]
    MPVTLTERAARHVEKMLASEDAAQGLRLGIKASGCSGFAYVVDYAQEIGEQDLVVENHGVKVVVAQQHRPFLEGTEVDYV
    RDGINYRFDFRNPNVRDLCGCGESFAV

    >gi|121998723|ref|YP_001003510.1| protein-disulfide isomerase-like protein [Halorhodospira halophila SL1]
    MRRESTSARAPRIRTARRAARVLVFGGCMGAATASVGMMPEEIAETLEAMPEEDLIVYEPEEGEAEHSVTVFTDVTCPHC
    QDLHAELDAYLEQGIRVRYAAFALSDASRALMDQVWCSDDRHEALEAAKSGEEPEAGACDASPVEDHQEVAQQIGVPGTP
    TMATPGGELSFRLTPEDLADLLEQEAH

    >gi|121998732|ref|YP_001003519.1| DsrE family protein [Halorhodospira halophila SL1]
    MQFGILVNEGPYQHQASDSAYQFAVAALEQGHEVPRVFFYMDGVHNANRLQEPQQDDRNIVRRWSELAERHQIDLVVCVA
    AALRRGVKDEILAPGFRISGLGQLVEAGIQADRLVTFGD

    >gi|121998835|ref|YP_001003622.1| thioredoxin [Halorhodospira halophila SL1]
    MSDAIVHATDQNFEQEVLQASVPVLVDYWAEWCGPCKMIGPILEEIAADYGDRLKVVKLNIDENPETPPKYGIRGIPTLM
    LFKGGNVEATKVGALSKSQLTAFIDSNL

    >gi|121998885|ref|YP_001003672.1| glutathione S-transferase domain-containing protein [Halorhodospira halophila SL1]
    MIRLYTGAQCIHSHRARLALALKGVEAERVPVDPDQPPTALLEHNPYGDVPTLVDRDIALYHPEIIIDYLDERYPHPPLL
    PVDPVSRAKARLVVHRMQRDWYALYDQIEDGTGAQTQQARRALTESLVAAAELFEGQPYFLSDELTIMDLTILPLLWRLP
    AAGVDLPEPAAAITQYAEQQFATDAFRISLTREEQALRA

    >gi|121998964|ref|YP_001003751.1| heavy metal translocating P-type ATPase [Halorhodospira halophila SL1]
    MAEARIELSVEGMSCASCVARVERIAGRLPGVTEASVSLATERATIAYDPAQVSPAAIAEALTRGGFRASPRKSDEEAAA
    GRDRELSDLWRDLVIAATLTIPLVLVAMGPMLWPALADAMAALAPERAWLWVEWALATPVLGWAGRRFFIHGLPALRRLA
    PEMNTLVMLGTSAAWCYSTTVLIAPGLFPEGARGVYFEAIGVIITLVLVGRYLELKSRGRASQAIQRLMALQVPTARVER
    DGVVSEVAVEEVRPGERVLVRPGERVPVDGEVVEGSSYIDESMVTGEPVPVGRGAGDEVIGGTINGSGAFSFRATRVGGD
    TVLGQIVRMVEGAQASKPPIQSLVDRVAGVVVWGAIFLALSAVVLWTALGFGIDHALVVAAAVLLIACPCAMGLATPMAI
    MVGTGRGAEQGILFRRGAAFQASAGIDTVVLDKTGTLTEGRPALTELVPRGGWQYDEVLARAAAVEAHSEHPLGEAVVAA
    ARERGLAVPAAEGVEAVAGFGIRGRVAGADVAIGARRYMETLGAAIEPDQAEQADALARRGRTPMYVAIDGRIAGLMAVA
    DPIKEGAKDAVVALQGMGLRTVMLTGDDRATAEAVAAELAIREVRAEVLPADKETAISDLQAEGRHVAFVGDGINDAPAL
    ARADVGVAVGTGTDVAIEAGDVVIMAGDPRSVARGLGLARQTFRTIRQNLFWAFVYNVTLMPVAAGALYPFFGVLLSPMM
    AAGAMSLSSLLVVTNSLRLRHTALPAQEALPSPA

    >gi|121999067|ref|YP_001003854.1| thioredoxin reductase [Halorhodospira halophila SL1]
    MAQQSKHCNVLILGSGPAGYTAAIYAARANLEPVLVTGMEMGGQLTTTTEVDNWPGEPEGIQGPELMDRMRRQAERFETE
    IIFDHIHTARVTGQPITLEGDQHRYTCDALIIATGASAKYLGLESEKRFMGKGVSA
    CATCDGFFYRNQPVAVIGGGNSAV
    QEALYLSNICSHVTLVHRRNNLRAEKILQRQLMERVEQGRVDICWNRALDEVVGDDSGVTGIRLRHTDSGEVSEREVSGV
    FIAIGHSPNTGLFEGQLAMSSGYIRVNSGLDGNATATSAPGVFAAGDVCDHVYRQAVTSAGTGCMAALDVERYLERLAHS


    >gi|121999116|ref|YP_001003903.1| cytochrome c biogenesis protein, transmembrane region [Halorhodospira halophila SL1]
    MTGRMRFDRGGLVAALWLALGLLVAATPAQGMVDQQEIFPFTVEQVGEDRLVARWDVAEDHYLYRHAFDFELRDGDNEII
    EVSYPSGEAFSDEFFGDVVIYRGTLQVHLQTAEPVGEGAQLYAEFQGCNEPESLCYPPSSLEAEIASGAVQYSDGSGGAG
    AAGGGGQGPMGELEALLGGGNLWAILGGFFAAGLLLAFTACIYPMIPILSGLIVGSQPGGGRPGTGRALWLSFVYVQGMA
    ITYALAGALAGLSGRAIQADLQGPVVTVAFSALFVALALAMFGLYNLQMPASVQGRLQAASSRLPGGQVAGVAAMGVLST
    LIVGACSGPALVAALAFIGNTGEVVLGAGALYIMALGMGAPLLAVGTAAGRWMPRSGPWMESVKQVFGFIFLGVAWWMSS
    RLMPDGLVLAGWAVLLLAAAVWLAWRLLRSRGTGGSVPARGAGATLAAVLAVAGAAQVLGAVTGAGDPLRPWVGITGDPY
    AQARAQVLEEWRHVETLDELEELLDEAREAGRPVVIDFSAEW
    CVYCVQLEERTLPDDRVQAALEGAEKVRIDVTDMTDAD
    RELMEAYGVYLPPAILFYNGEGEEQSEYRVAGFKDAEAFAERTREAFGG

    >gi|121999174|ref|YP_001003961.1| glutathione-disulfide reductase [Halorhodospira halophila SL1]
    MTDEYDLIVIGGGSGGMATARRAAAHGARVAMVERDRLGGTCVNVGCVPKKVMWYASETAAALERAADFGFSLEQAPEFD
    WGGLCRARDAYVERLNGIYASNVERAGIDLYRGTGELRDAHTVAVDGQPLRGRYILLAPGGRPSRPDIPGADYGIDSDGF
    FQLHEQPRRAVVVGAGYIAVELAGVLHHLGTETTLTVRRDGPLRGFDPLLRESLAESLEVDGFDLRTHFVPAACERQADG
    RLTLLAEDGQRIEDVDTVIWAIGRDAATADLGLERAGITPRADGTIPVDDYQRTEVDSVLAVGDVTGNDFPLTPVAIAAG
    RRLADRLFAGQSDSRLAYRDIPSVVFTHPPLGTVGMTEPEAEAAYGADQVTCYQTRFFPMNYALAPQAVKRRTAMKLVTV
    GAEERVVGVHIFGEAADEMLQGFAVAVRMGATKADFDNTVAIHPTSAEELVTL