Aminobacterium colombiense DSM 12261 uid47083

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|294101064|ref|YP_003552922.1| peptide methionine sulfoxide reductase [Aminobacterium colombiense DSM 12261]
    MTIIVIGVFLAIYPGIIFAEESNMEKEMAFMENILPAIDSVEHKRTELATFALGCFWGPDAQFGLLSGVISTKVGYTGGD
    RPDPTYHTLGNHTESIQVVYDPDVISYEDLLEVFTEGHDPTLPIFSRQYMSAIFYENEEQKAGAEGWKEHLQQETGRPVR
    TQILPLETFYLAEAYHQKYWLRMDSAFFQEYKKIYPSLDKLLQSTAVARVNGYLGGYGTLKELEAELLLLGLSEEGQRRL
    RNIVFSR

    >gi|294101073|ref|YP_003552931.1| heavy metal translocating P-type ATPase [Aminobacterium colombiense DSM 12261]
    MPLYRIKKLNCQSCASRIEADISALPGVSGVLFDIDTKILRVENDGSDLEEKIRAIVTRIEPGVTVTPVNNVENASSEKP
    SSGKSFLIKRFKEEGKGLGIAAILFIIGLAFREQLAATPYSLGEYSIFLAAYFLSGQEVLWSTVKNLKGLKGMDEFFLMS
    IATIAAILIGELPEAVAVMLFYRTGELFQELSASRSRSSIRALLAARPQFARLLSGGEERNVKPEDVAVNDHILVRPGEK
    IPLDGIIESGISQIDQSPLTGESIPVTAEPGKRVYGGSINLRGALTIRVTSAFEETTIARILEMVEFAVARKSPTERFIT
    TFARYYTPAVVMGALAVAAIPPLLGNGSFMNWIYRALVLLVISCPCALVISIPLGYFGGIGAGSRHGILIKGGNVLDAMN
    SAKVVAFDKTGTLTQGVFSVTKIVPQQGVSEEEILSLAASLEQGSNHPIARSITEAAGGIELLPPKDLEEISGKGLRGIV
    EGHRILAGNKKFLEGEGFQNLSDPERGTVVHIAKGGQYLGYIIVSDVIRPDAHSTLKALKKAGLAATIMLTGDTEKGAEW
    VAREIGVDQYVASLLPQDKVAELARLKSGLSANETTIFVGDGLNDAPALAAADIGIAMGGLGSEAAIETADVVILDDNPS
    KVADALVLARRTRKIVWQNIILALATKGFFIALGIAGMAGMWEAVFADVGVALLAVLNSMRTIRFEPA

    >gi|294101075|ref|YP_003552933.1| redox-active disulfide protein 2 [Aminobacterium colombiense DSM 12261]
    MKIQILGTGCPKCKKLAEMAEKVAQELDLDYEIEKVTDIKEIMSFGVLGTPGLVVDGKVLLSGRVPTEAVLKDLLREKAK


    >gi|294101122|ref|YP_003552980.1| electron transport complex, RnfABCDGE type, E subunit [Aminobacterium colombiense DSM 12261]
    MGMVLERLKNGIIKNNPIFVQVIGMCPTLAVTTSAENGLAMGLAATVVLMGSNMAISALKRFIPDEVRIPAFIIIIATFV
    TLIQFFMQAFLPGLNKALGIFIPLIVVN
    CIILGRAEAHASKNSVVSSLFDAIGMGLGFTLALVVLGSIRELLGSGSLFGA
    QLLPAGYSPALIMILAPGGFLTLGILMALINYINTRRKKENKRISHFADA

    >gi|294101123|ref|YP_003552981.1| electron transport complex, RnfABCDGE type, A subunit [Aminobacterium colombiense DSM 12261]
    MSFFAIFIDAFLVHNIVLSRFLGICAFLGVSNSVATAVGMGLAVVFVTTFSSLMTWIVYNLILVPLGITYLYTLAFILVI
    AALVQFVEMVVRKKWESLYWALGIYLPLITTN
    CAVLGVAVINMNEGYTLLQAIAHSLGASLGFLLAIVLMSGLRERFQDN
    TNMPKALRGLPISLVTAALMSIAFLGFNGLFS

    >gi|294101162|ref|YP_003553020.1| hypothetical protein Amico_0149 [Aminobacterium colombiense DSM 12261]
    MLKGFNSLLMSRLGPIITGGVVGLLAALLVRWGNPGNMGICVACFTRDIAGALGLHRAAVVQYLRPEIAGFILGSFVSAL
    VYREYVPRSGSAPVIRFFLGMFAMIGALVFLGCPWRAYLRLAGGDWNAIAGIAGLVAGIGIGIVFLWKGFSLGRSYEAPK
    GTGYFMPVAAIALLVLVIMAPAFGKDGTGPIFFSESGPGSAHAPIIISLIVGLLVGWMAQRSRFCTVGAIRDLVMVRDSH
    LFNGVLAFIVIAFATNIVIGKFHPGFEGQPIAHTNTLWNFMGMVLSGLAFTLAGG
    CPGRQLIMSGEGDGDAAVFVFGMLV
    GAAVSHNFSLASSGAGPAAFGPSATIVGLVFCLAVGLIMRQRLN

    >gi|294101294|ref|YP_003553152.1| Rhodanese domain protein [Aminobacterium colombiense DSM 12261]
    MKTISEVVARYFEDLKKGCNNLISCDQLGELMRKENVYILDIRKPEDYEEEHLEGAVNIFWSEVGDHLKEIPKDKKVVVC
    CYSGQSAGQVVSLMRILGFNACSLKGGMKCDLAHMPIEARCCDNQPEVCDS

    >gi|294101478|ref|YP_003553336.1| methionine-R-sulfoxide reductase [Aminobacterium colombiense DSM 12261]
    MKYTLLLLTVGTIIFFVTTSVCATTIERIEKTDEEWKAILTPDQYVITRKKGTEPPFSGAYWNLHEKGTYVCVCCGAVIF
    SSKEKFDSGSGWPSFWATVKDAPIATKLDSSFGMERTEVLCARCDAHLGHLFSDGPPPTGMRY
    CINSAALNFIAEEE

    >gi|294101482|ref|YP_003553340.1| methylated-DNA/protein-cysteinemethyltransferase [Aminobacterium colombiense DSM 12261]
    MRHLFFYQTPIGEIAIAEENDVITHLCFQSKDILKDMTIHETKILKEAGKQLKEYMEGKRKEFTLPLAPVGTEFMIRVWK
    SLCAIPYGETRSYKEIAESIGNKKASRAVGLANNRNPIPIFIP
    CHRVIGANGKLVGYGGGLHIKSFLLKLEMEYKN

    >gi|294101523|ref|YP_003553381.1| protein of unknown function DUF395 YeeE/YedE [Aminobacterium colombiense DSM 12261]
    MQRKMRPMNPYVAGSLAGLLSVASTWLSGKYFGASTSFVRSAGFVEKTLASEHFSTVGYLVKNAPKIDWQLMFVAGIFLG
    ALVSSLVSGTFRFQWVPDSWEDRFGKRIFPRAIIAFFGGIVAMFGARLADG
    CPSGHGLSGSLQLAVSGFIALVLFFGAGM
    LVARILYGRE

    >gi|294101726|ref|YP_003553584.1| thioredoxin reductase [Aminobacterium colombiense DSM 12261]
    MEKRELVIIGAGPAGLTSAIYGRRAGLDVLLIEKGVPGGQINITAEIENWPGVAHASGQELGDMFRVHAEKFNTEFRDAD
    VKKIELRDGSKVVVTDKGEIEAEAIILATGAYFRKLGCEGEVEHIGGGVSY
    CAVCDGAFFEDQVIAVVGGGNTAVEEACY
    LTNFASKVYIIHRRDAFRADRAATERTLSNPKIEPIWNSVVEKIEGDGMVENLVLKNVKTGEVSDLPVAGVFVFVGQAPH
    DECIRGLVEAKKGGWIVTNDDMETSVEGVFAAGDVRDKNLRQVVTAASDGAIAAMAASAYINEQVHLRSTLLDPERVVAF
    FYSSIVESQVRLSNAVEEMSKETGEKVAIIDGYRNARMVEKLELGEMPVVVELKKGVVASKKTVATASELSEFLK

    >gi|294102224|ref|YP_003554082.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Aminobacterium colombiense DSM 12261]
    MLTLRKRVLIIGGGPGGRFSYMTLRRMGEKSLSIVMNEDPTVICSLPYGVGRKLIPGGPEEEVVDLANSDRLPPEIVEDA
    IRGVVTELDAENHIARGTSTEGPFEIHFEKVLLAPGAVPWLPSVKGLLSDKEGYMRDLTEIMVGSEYVSKEKLAENIFVM
    RGADDARALDAFAEKSDQAVVVGSGAIGLEVVEALHDRGLAVTLVEALPHLIAAMDMDMAGKVSERLSEWGVSIYKNIQL
    TEVRSDRVVLSDGTEIKTDGVVFATGVRPNVKLARSAELSIERGIVVNEKMQSSHPDIYVVGDAAQISDAVTGRPILPLI
    GTLAMRQGLVASANIMGKEMFLPPATVWGLSAIFDLHWGSVGWTEELANTLGIQVFSITLPYHTREKAMVNGKEGLWKVV
    VSASDEKGLKKGQIIGFQVVIDGESPLFLTERFIDIITRRETVSGLFSHYFVHSPYHNTVEDPYLMLLFAAQEAMAH

    >gi|294102249|ref|YP_003554107.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Aminobacterium colombiense DSM 12261]
    MLNRMSLQLLRQWVDKVFTNPFPVPSMPDSLTAALKAAEEGKIKLNPPIEPQGYFRGRLDYDKERCIGCKLCIRVCPANA
    IEFLEEEKKIQIHVDRCCFCAQ
    CTEICPVKCLSMSKEYLISSYDRKAQIVRDSGPTKKKEEDIVVESAVKYEVDEEKCIG
    CTKCARNCPVNAISGELKKPHVIDKEKCVGCGKCAELCPKDAIHQVEVAAQAAKAAPEEK

    >gi|294102350|ref|YP_003554208.1| glutaredoxin-like protein, YruB-family [Aminobacterium colombiense DSM 12261]
    MIKVYSTPTCPWCTKAKEYLTSKGVEFEVVDVAKDREAAMDMVKRTKQMGVPVVQFGDVYIVGFDRTAIDAELAKIGK

    >gi|294102381|ref|YP_003554239.1| Thioredoxin domain protein [Aminobacterium colombiense DSM 12261]
    MAMVELTKDNFDAEVKGSSLPVLVDFWGPKCGPCMALLPNVHKMAEEFEGKVKFCSVDVSQNRRVAINCRVMGLPTFLFW
    KNGEEVARISGAEVTLEKIKENVEKLL

    >gi|294102431|ref|YP_003554289.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Aminobacterium colombiense DSM 12261]
    MLDLIQMGYEGPDFCLKDQFGTYVTLSSLKGRNILLSFHPLAWTEVCQAQVNSIDAHIKLFERLNTLPFALSVDSFAAKK
    AWSDALGIKKLQFLSDFWPHGDVARQYGVFVEKEGFSARVNIILNEKHEVIFAKGYELGEVPNLREIIFLLKDYTQTEIP
    NLDMEIQRCLKDAVGRTVCMKDSRSKGIDATN

    >gi|294102565|ref|YP_003554423.1| pyridine nucleotide-disulfide oxidoreductase dimerization region [Aminobacterium colombiense DSM 12261]
    MYDVIVLGGGPGGNKAAELAARNGLKTVMIEKARLGGTCLNRGCIPTKAYFARIIGGHGTIEEMWNHKEQIVEKLNSGIS
    TLMKMSGVEVVLGTGKIISTGETQIVEVQTSEGIRQIEGRNLIIATGARSLAMEFEGADLPGIITGDYAVTYPELWKYPD
    CEEVKSVAVIGAGVIAVELAVLLRRMGKEVTILKHSDQVLRRADKDVKKKLIQSLKKMKITMVDYFAPEKALLEGEQVKV
    CGTTPKGAVDINCDRLILASSMIPILDGYGLEDSAIEYSKKGIKVDKHMETNVPGVYAIGDVTGGMMLAHLAEYHGLSAI
    EHILGREYVINPDHVPWCVFCDPEIAVAGITEDEAEARNISVKVARAYFLGNGMAQALNNTDGFVKVIASQEDDRLLGVH
    IIGPEASSLIGEAALAVAQGMKAKDVARTIHPHPTLTECFKDALFRLEEDS

    >gi|294102566|ref|YP_003554424.1| dihydrolipoamide dehydrogenase [Aminobacterium colombiense DSM 12261]
    MAHSITMPKPGLTMTEGPAPIAEPLPSVGEQKKHVVIIGGGPGGYVAAIRASQLGARVTLVEKKRLGGVCLNVGCIPTKV
    LLHSVELFTAIKKASHLGIVAEKVSVDWNALMKRKEKVVDHLTGGVGILLKSNDVEVIDGFAKFLSPRSVGVKLKDGGET
    RIEADSFIIATGSEPVIPAIRGFDIPGVITSNEALSLEKVPSSMVVVGGGVIGMEFASIYASLGTKVTVVEMLPDILLNM
    DEELVQIIKGVLARSKVVFHTSSKVTEVKERAGVLAVSVESPDGTVTVEAEKVLVSVGRRPVINGLGLEKAGVITEKGRI
    RVDSYLRTNVSHIYGIGDCASPIMLAHVASREGIVAAENIMGRSVTMDYKTVPSAIYTSPEIASVGLTERQAREKGFKVK
    VGRFPLANNGKCIIMNDIDGLVKYVIHEKYNEILGVHIIGPRATDLIVEGALALRLEATAEEIISTIHAHPTIGEALAEG
    ALAALGRVIHLPAKK

    >gi|294102599|ref|YP_003554457.1| Thioredoxin domain protein [Aminobacterium colombiense DSM 12261]
    MKMRNVIIITILLLAIGGTFYIRENGRQQKEHNVIIAEAPTALPVIIDLSAAGCPACVQMSKVLDDFSAQYGDQVRVERV
    DVMQNSELAQKYEVRYVPTLVFEDGNGNILGKEVGYLSLEEIIIKLEEYGITLTSK

    >gi|294102601|ref|YP_003554459.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Aminobacterium colombiense DSM 12261]
    MTEKKSGCTVPIAKIEKQESQKEQVEAKSSQKEEGKMTIMVGRKAPDFTAPAYYKGTFTTVTLSDFAGKWVLLCFYPGDF
    TFV
    CATEVSAVADRYEEINGLGVEVISVSVDSQFVHKVWNDTELSKMAEGGVPFHMASDGGGNIGSAYGVYDSVAGVDVR
    GRFIIDPDGVIQAMEVLTPPVGRNVDEMIRQIKAFQLVRETGGSQVTPSGWQPGGKVLEPGIELVAKVWQKWNPRDVYKK


    >gi|294102620|ref|YP_003554478.1| protein of unknown function DUF255 [Aminobacterium colombiense DSM 12261]
    MKNKENRLITEKSPYLLQHAHNPVDWHPWGKEAFTKAQEENKPIFLSIGYSTCHWCHVMEKECFSDEEVAQLLNDACVSI
    KVDREERPDIDHVCMAVSLIMNGSGGWPLNLFLTPNGKPFFAASYIPKETSGRIPGLMDMVPRVKWLWLMQKEDVLKSAE
    SIMNALEKEMTNQKGTCPDKNLAKKAFQELSRNFDPLWGGFSKAPKFPMPPVLLFLLEYGKIFKEEKAIKMVEKTLDCMA
    MGGIRDHLGGGFARYSTDREWKIPHFEKMLYDQALLLKAYTAAWEMTGRDIYKKIAFEIAAYVLRDLRSPEGVFFAAEDA
    DSEGVEGRFYVWTEEEIRRLVPSEDRQLFLQAYGIHGEGNVLALPASLEELAATYNVELQKLDQSLQKSRALLFEARNRR
    VRPHCDRKILTDWNALMIEALAFAGRIFEERQFIEAARNAVDFLLEKAVYQEKEVYHSVADGKGHIPGLLNDYSFFIRAL
    LELEEATGEEDYGEKGMGLLRSMNDIFYDPKRGGYFMNSGLDELLFFRPWSGEDGVMVSGNSVAMMNLLRFNKRTGNKEY
    YEMARGIGEAFAQRVQQVPAMYTHLLTATLALSDE

    >gi|294102746|ref|YP_003554604.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Aminobacterium colombiense DSM 12261]
    MGKHLVVIGGTAAGLSAASKAKRMDPDIKVSVYERTGFIAYGACGLPYYIGDLVKTEGKLADFTPDELKEKRDISTYIHH
    EVTKIDADSKTLDVYDLRKNEFFKVPYDYLVIATGASPIIPDIPHVHANGVFFLRTVEDGMAIKNAIKERNVKKALIVGG
    GFIGLEMAEQLSFLGIEVTIVEALPRLLPLLDEEYSNAVKKNLEENNVYLHTGTTVSEIISENGNVVGVKTNNGEIFDTD
    MAIVSIGVRPNSSMAQNAGLKTGIKNAIVVDEYMKTSDESIWACGDCVQTFNFITKRETYVPLGTTANKQGRIAGGNIAG
    DKSTFKGVLASQITKVFDLYIASTGLTVDQAREAGFLPEEAKIVKKDKASYYPGGKDNNIKLIFDKNTGRLLGAQAIGSE
    SIAGRINLLATAITAGMTVAELSEVDLVYAPSVAPVYDPILIAASQAVKKVVLKRD

    >gi|294102752|ref|YP_003554610.1| Methyltransferase type 11 [Aminobacterium colombiense DSM 12261]
    MTDKKKHKAKSADEIRSKIRERYGAIAQSETSCCGQGASCCSPSSQPDISQVLGYSDAELSSTAKGANMGLGCGNPLGIA
    SLKPGDIVLDLGSGGGFDCFLAAQAVGKDGFVIGVDMTPNMIDKARSIAEKENYSNVEFRLGEIEHLPVADASVDIVISN
    CVINLSFHKQQVFLEIYRVLRKEGRVAIADIVALQNLPDEIRTNQNAYSG
    CVAGAALVKEVEEMLKNAGFKDIIITVKEE
    SREYIKDWFPGSGVENFVRSAYVEAKK

    >gi|294102778|ref|YP_003554636.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Aminobacterium colombiense DSM 12261]
    MEREKYVIIGGDAAGMSAAGQIRKLQPKAEIVAYERSPHTSYSACGMPYYIAGLVEKENKLIVRTPEEFMSKQNIRALVL
    HEVLSVDIQDRTVNVLDLKTGEVFADTFDHLLFATGSQPIRPAVEGLDGEGVFQLSVLQDGILLHQFIEERQPQRVVVVG
    GGYIGLEMAEAFCMRRMKVSLVDRSFQVMNTFDIDMAEHIAQAIRHVGTELYLGETVKAIERDSGRVKAVITDQRAIPAD
    MVILGLGVRPNSKLAKEAGLPLGAKDSILVDQAMATETEGIWAAGDCAQTWHMVTNRPFWIALGSVANKTGRAAGINMAG
    GEERFPGVIGTAVSKHCELEVARTGVSEKELEDLDFNYDTVTIKSKTQAGYYPDAGQIHVKMIAEKPGGRILGAQIVGNH
    GSAKRIDVVATAIAARMTVRELVDLDLGYAPPFSLPWDPIQIAARQLI

    >gi|294102802|ref|YP_003554660.1| Redoxin domain protein [Aminobacterium colombiense DSM 12261]
    MERTGIVTMKGKPLTLIGESLSVGDKAPDFAVLDQTLATKTLKDFEGRIKVISVTPSLDTPVCDLQIHWFNEDAANQPDD
    VAVLNISMDLPFAIKRFCSTKGIERAVALSDHRDASFGMNWGVLIKELRLLARAVFIADKDDVIRYIEIVPEATHEPDYE
    KALQALVKIIR

    >gi|294102873|ref|YP_003554731.1| heavy metal translocating P-type ATPase [Aminobacterium colombiense DSM 12261]
    MMTRGENSKKISFSVTGMTCATCARIVERSLKKVDGVIFAGVNLATETAFVVLDKDVSMEELEEAVRKAGYDVSYEQPED
    LDRRRYEGAKRNLLISWGITVPLMFLMVVHMAGFHMPWFPFVEAIGGAIVLFGAGRASMKGAWIALSHFHANMDVLVSLG
    ALAAWSTAILLLVGVKVTSFGAIGAMIIALHVTGRFIESHLRDRASKEIKSLLAIQAREARILDESGREIAVPIEAVKEG
    FILMVRPGERIPADGKIIDGATSVDESMITGESIPVQKKLEEEVTGGSLNLTGSIKVQATKIGEDSFLAQMIALIQEAQG
    AKIPIQAFADRVTNYFVPVVAALAVISGLFWFFGIHRFASFLDGASRYLPWVTSVRDPLSIAVFGFISTLVIACPCALGL
    ATPMALITGTGAASRKGLVIRNAEAIQTAKEVGIVLMDKTGTITQGSPEVVETNLSDDDMERVAALERHSIHPLAKAISS
    ARATQLEPVSMEEIAGEGVRGTVGDDLYFVGKTHDSSLYSRQLSMGRTVVEVRKNEKIAGFIAIEDPLRRDSIEAVERLK
    KLGIIPVMVTGDNERTAQAVAGRVGIEKIYAGIRPEEKLNILRDFQAHGKKVLMVGDGMNDAAALKGADIGVAIGTGTDL
    AIDSADIVVVRGGISSIADAIEISRQTFTVIRQNLFWAFAYNVIAIPLAMGALLHPAIAETAMAFSSISVILNSMRIRPS