Halomonas elongata DSM 2581 uid52781

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|307543620|ref|YP_003896099.1| hypothetical protein HELO_1031 [Halomonas elongata DSM 2581]
    MIDQLFEFVQNHPLLVGAFLLVLLAWALYEVRSSGANGVSTSEATQLVNREDAVVLDIRETKEFKAGHIAGARNIPQSRI
    DDRIAELDKFKDKPVIVV
    CKHGQSSGAVQGKLAKAGFERALKLKGGMTQWQSDGLPLVKK

    >gi|307543867|ref|YP_003896346.1| redoxin domain protein [Halomonas elongata DSM 2581]
    MDAIALGPVLLPLPRLYALAVTLLLLALSAFLLGLPRQRHVRWFNGLLIVWLVAARLGHVALHPAAYAEAPLDILKLWQP
    GFQGVVGLLAALAWTLWSLRDRLGALLGATGLTIGASLLWLALMALAPLGGGMALRQLPDITLENLEGESVELSSLSGEH
    VLINLWATW
    CPPCRREMPLLDEVDDREDVTVVVVNQGEDLLPVVRYLDEQGLEFSHALLDPRQQLMVESASPGLPTTLLF
    DAEGRGVTQHVGELTRATLDDWLGAR

    >gi|307543981|ref|YP_003896460.1| iron-sulfur cluster assembly protein IscA [Halomonas elongata DSM 2581]
    MANLSITTAAAEQINRVLDERGHGLGLRVTVKPSGCSGYSYVLDFADEASNDDVAFEEHGVKVFVAPDALEMLDGSEVDY
    VSEGLNRFFRFNNPNVKDECGCGESFSV

    >gi|307543998|ref|YP_003896477.1| glutathione peroxidase [Halomonas elongata DSM 2581]
    MSIHDHDCRTHGGEPFNLRALRGQVLLIVNVASRCGFTSQLGELERLYRRHRDRGFTILAFPCNQFGRQSPESAAGFCSF
    GEQTYSVTFPLMEKVRVNGRHAHPLFVELKREAPGVLGTKAIKWNFTKFLVARDGRVVRRFPPRAGIRELNEALESILDE
    PWG

    >gi|307544095|ref|YP_003896574.1| methylated-DNA-- [Halomonas elongata DSM 2581]
    MTDALDYYQPPQSDALGLLRLSATASGITEIAFVMEKDAAPRPNEITERARQQLDEYFAGERRDFELPLAPRGTDFQRRV
    WEALATIPFGETRNYAEIAEQLGCKGGQRAVGAANGRNPISIVVP
    CHRVIGSDGQLTGYAGGIGRKQWLLAHEAGEIPFQ
    LA

    >gi|307544100|ref|YP_003896579.1| hypothetical protein HELO_1511 [Halomonas elongata DSM 2581]
    MFPSFSLRYARLPERMRAASQPIPVEDARLVAFNRELADELGFELAAFEADEAAEIFAGNRLPEGAEPVAMAYAGHQFGN
    FVPQLGDGRALLLGEVVDRHGRIRDIQLKGSGRTPFSRGGDGRSPLGPVLREYLVSEAMHALGIPTTRALAAVTTGERVF
    RRIPEPGAVLTRVASSHLRVGTFQYFAARGDTEAVRLLADEAIDRHYPHLADRTDDGERYLALLDAVAERQAELVARWMG
    VGFIHGVMNTDNTAISGETIDYGPCAFMDTFDPRTVFSSIDERGRYAYVNQSVIIQWNLARFAETLVPLIDSDGERAVER
    ATPIIRDFSERFDARWREVMCVKLGLVTEEEGDGELAQALLDAMRDGRADFHLTFRHLADAVDASAEAPRLRENFASQEE
    LEAWLPRWRERLAREGVSTDDIVARLNAANPAVIPRNHRVAEAIAAAEEDDFGPFEALLAVITDPYTTPDGDVDYMRPPR
    DEEKVLRTF
    CGT

    >gi|307544131|ref|YP_003896610.1| putative membrane transport ATPase [Halomonas elongata DSM 2581]
    MSDAHEHGCCGGHHTEPREAVAAPADSETLRLRIQEMDCPTEEALLRKALTSAPGVAALEFDLMARILSIHHHDADTEAL
    QARVRDLGMTPRPLDTDDDPSDEPPASDDTPWGRLILAALLALAAEIVGWTPWPWTDWLAPVLALPAITLVGLPTWRKGW
    VAIRHRTLNINALMSVAVTGALLIGHWSEAAMVMVLFTLAEHIESRSLERARRAIRDLLDSAPRQARRRAPSGEWENVAA
    ADVAIGDIVRVLPGERLPLDGEVMRGHPSLDESPITGESLPVDKAPGDSVFAGAINHDGDFDIRTTRVASDTTLARIIHA
    VEQAQASQAPTQRFIDRFAAVYTPVVFALAVLTALAWPWIAGGAWLDGIYRALVLLVIACPCALVISTPVTIVSGLSAAA
    RAGILIKGGRFLEQGRRLSWLALDKTGTLTRGEPTLEHWEPLDEPSDASSREALARQATLLAGRSTHPVSAAIHRALAPN
    ADDGSVDDFRELPGQGVEGRVDGQPLWLGNRRLAEARGLIDATLAERIETLERRGASVVALGSSERVLALFAVRDPLKPT
    SLAAIEALHGLGVKTLMLSGDNRHAVSAIATEAGIDSARGELLPEDKLAIIEEHGHRGVIGMVGDGINDAPALARADIGF
    SMGAAGSDVAIETADVALMDDDLGKLPTFLRLSRATYAVLVQNIVLALGIKAVFMVLAFTGQATLWMAVFADLGASLLVI
    GNGLRLLRSRLA

    >gi|307544276|ref|YP_003896755.1| methionine sulfoxide reductase B [Halomonas elongata DSM 2581]
    MQRRHFLGLLGLGGLSGLAPSLANARPKPDLSPAPGLETLELSEAEWRERLTEERFEILRKGGTEPAFSSPLDKETRKGV
    YHCAGCDLPLFESAMKYDSGTGWPSFFTHIEGHLLTELDLVLLIPRTEYHCARCGGHQGHLFDDGPEPTGLRW
    CNNGLAL
    RFVPA

    >gi|307544279|ref|YP_003896758.1| K03611 disulfide bond formation protein DsbB [Halomonas elongata DSM 2581]
    MIMELENWSVRRWSLAGLAFCVLMMAVALGLEHGAGLEPCPLCIFQRVAVIAAGVVFAIAALHDPKGRAGAAIYGLLGVV
    AVGTGIGLAGRHLWLQSLPADQVPS
    CGPGLDYMMEILPLREVLATVLTGSGECAEISASLLGLSLPGWTLIGFVVLMLAP
    LGLLARSLRRDHGYRWQGVPGRD

    >gi|307544320|ref|YP_003896799.1| thiosulfate sulfurtransferase [Halomonas elongata DSM 2581]
    MSSEDNLLPLIVEPERLAEHLDAPELLIVDVPLKAESHQQGHVPGAVYLDHRRLLRGEGDVPNELPSEEALSRLFSDLGL
    TRDTHVVAYDDEGGGWAGRLLWTLELLGHTRYSYLNGGIHAWRAAGQPVSTESRTPTPSDYEAEILQPEAAIDRHEIAER
    LGEPGFAVWDARSREEYLGTKGDNKRLGHIPGAVNLDWTDAMDKERQLRIRDYAELITELEALGLTPDMEIATH
    CQSHHR
    SGFTWLVGKALGFNMRGYAGSWKEWGNRDDTPIEKP

    >gi|307544325|ref|YP_003896804.1| K03671 thioredoxin 1 [Halomonas elongata DSM 2581]
    MANNVDVTNANFEQEVLNAEIPVLLKFWAPWCGPCKVMAPVVDEVAEEREGNLKIVSINVDDAPEIAAEQGVRGVPTVML
    FKSGAKVASLVGAQSKSQLTQFIDQNA

    >gi|307544475|ref|YP_003896954.1| adenylyltransferase [Halomonas elongata DSM 2581]
    MNDEALLRYSRQIMLDAIDIEGQERLLAGHALVVGAGGLGSPVALYLAAAGMGRLTLADDDEVELSNLQRQIAHGMADIG
    RPKAESARDAGLALNPDCEIRALTSRLDGEALRAAVAQADVVLDCTDRFSSRYAVNEACRHAGVPLVSGAAIRFSGQLAV
    FDPRDPQSPCYACLYPPGEGGDEELR
    CAENGVVAPLVGLIGCFQALEAIKLVSGAGSVHRGLSTFDGLTGQWRHFKVPRD
    PECPVCHG

    >gi|307544597|ref|YP_003897076.1| thiosulfate sulfurtransferase [Halomonas elongata DSM 2581]
    MSDVLIGAEELHHWLQEQPTPVVLDCRARLGDPEAGIRLWREGHVPTSRHLDLDRDLASSPGVRGRHPLPEPGDFAATLR
    RLGVEPGRPVVVYDDMGGQLAAARAWWMLAQWAGHPDVRVLDGGLPAWREAGGTLVEGEQAETSASDWAPVFDDDTWVEA
    DEVFSSRALKLDARSRERFRGENEPVDALAGHIPGARCRPSADNLDESGRFKSPEALREAFPGASDVISY
    CGSGVTACHN
    ILAHAVAGLPLPKLYVGSWSEWIRDPARPVATGD

    >gi|307544605|ref|YP_003897084.1| methionine sulfoxide reductase B [Halomonas elongata DSM 2581]
    MKCRQDKETAMRKKIEKSDAEWREQLTPEQYHVTREKGTERPFTGDYQVTEEHGIYHCVCCHAPLFENEHKFEAGCGWPS
    FDRPLTSECVEERADNSHGMQRIEVTCARCNAHLGHVFPDGPPETTGQRF
    CINSVALDFHSGE

    >gi|307544743|ref|YP_003897222.1| hypothetical protein HELO_2153 [Halomonas elongata DSM 2581]
    MSLTPSNMLALNSPLPSFHLPDAQGRMVSSDDYAEQPLLVVFMCNHCPFVKHLAGALADFARQYQDRGLAVVGINSNDFL
    ANPEDRPERMLEEARERGYTFPYLVDETQDVARAFDAACTPDFFLFDRHHKLAYRGQFDDSRPSQDIPVTGRDLRAAADA
    VLAGQSPDETQKPSMGCNIKWK

    >gi|307544772|ref|YP_003897251.1| thiol:disulfide interchange protein precursor [Halomonas elongata DSM 2581]
    MNASAVEHSGTGPEPQAISAVSIAPSMPSEKGNPVSQLRRLACLVLLLLPMAAQAEWFSSNDGSDFLPVMEAFQPSVWHD
    GDTLKIGFENADGYYLYRHQFDVASRDPNVTLGELELPPGEAKTDEFLGDVNVYYDRVVLEAPLDTPHQGPLDLTLTFQG
    CADAGLCYPPETIELQAPEGQAPAAFADWQAPSAGSGTATRSTASQTTGLTAGDAPRSEDGHFNALIRDASLPLVLGLFL
    LAGLGLTFTPCVLPMVPILSSIIVGQNPSRPRAFALSASYVAGMAITYAVVGMLMGLFGAGLNLQARLQSAPVLIVFAIL
    FGLFALAMFGVFNLRLSPRLASRLDAWQDKAQHSGPIGLALAGALSVLVVSPCVSAPLAGALVFISSTGDALVGGAALLA
    LALGMGIPLLLVGTFGTTLLPRTGPWMNGVKSAFGILLLGVAIWLVARLLPGAVVLLLWAALAIGTALALGALNPGQAQG
    WPRVRQAAGLLLLTWGITLVIGASRGAQDPLRPLAPAGATLSAASTETAPQEVTVVESLDELQAALAASDQPAMVNVTAE
    W
    CISCTIMERDVFPAPRVVAALEGFRRIDVDVTESGETSREVLDHFGLFGPPGLLFFDGNRELREARVQGEIDAPDLATH
    LREIAAWMQRNKA

    >gi|307544808|ref|YP_003897287.1| Na(+)-translocating NADH-quinone reductase subunit D [Halomonas elongata DSM 2581]
    MSAPTAKGVLTTPIFKNNPIALQILGICSALAVTSSMSVSLVMSLAVIFVTAFSNLFVSLIRHHIPSSIRIIVQMTIIAS
    LVIVVDQILKAYAYEMSKQLSVFVGLIITN
    CIVMGRAEGFAMTNTPGLSFLDGVGNGLGYGFILMTVGFFRELLGSGSVF
    GFTVLQTVQDGGWYVPNGLLLLPPSAFFIIGLIIWVLRAINPEQVEENEFEMKANTQPKEAV

    >gi|307544809|ref|YP_003897288.1| Na(+)-translocating NADH-quinone reductase subunit E [Halomonas elongata DSM 2581]
    MEHYLSLFVASVFVENMALAFFLGMCTFLAVSKKVSSAFGLGIAVIVVLTITVPVNNLILTYLLGEGALTWTGIPGAENI
    DLTFLGYLSYIGVIAAIVQILEMFLDKYVPALYNALGVFLPLITVN
    CAILGATLFMSERNYNLGESVVYGLGAGVGWALA
    ITALAGIREKLKYSDVPASLQGLGITFITVGLMSLGFMSFSGIQL

    >gi|307544915|ref|YP_003897394.1| alkylhydroperoxidase like protein, AhpD family [Halomonas elongata DSM 2581]
    MQEYVSRADFYRLQPALVKGLQSTQEAVAASGIEPGLIHLVFLRASQLNGCAFCQRMHSEEARGDGERQARLDVLPAWRE
    SPGFSERERAALAWTEALTLLAESEVDESLRDRVKASFSLEEQLSLTSLVVVINGWNRIVLSCGFRPEIDER

    >gi|307545130|ref|YP_003897609.1| glutaredoxin 1 [Halomonas elongata DSM 2581]
    MFVVIFGRPACPFCVRAQALAEKLESAGAIEGFRYVDIHEEGITKADLEKTIGKPVQTVPQIFADQTHIGGFTEFDQWVT
    EQGLLATTAQ

    >gi|307545135|ref|YP_003897614.1| K07397 putative redox protein [Halomonas elongata DSM 2581]
    MSIRLRSERNGRLRERATIDGFEDLLVDVPEEYGGDGLAPDPHDYFDLSLGACKAITARMYARRKGWPLESVEVTVNRDE
    RDEARGVYRLEVIMQFHGDLDETQRARLEEISDK
    CPIHRLMTTSEVEITTRRST

    >gi|307545168|ref|YP_003897647.1| methionine sulfoxide reductase A [Halomonas elongata DSM 2581]
    MSAPTADAPVGRDAPMEITAVHTVNGQRMTPPWPEGMQEIVLGLGCFWGAERLFWQLPGVHVTAVGYAGGVTPNPTYKET
    CTGRTGHAEVVRVVFDPAVIELDSLLRHFWEAHDPTQGNRQGNDIGPQYRSIILTVDDEQRATAERSRDAYGKALEAQGK
    GPITTEIMPLEAFYYAEEYHQQYLDKNPGGYCGLKGTGVSCPIG

    >gi|307545177|ref|YP_003897656.1| glutathione reductase [Halomonas elongata DSM 2581]
    MSDFDYDLFVIGAGSGGVRAARTAAATGARVAVAEDRYLGGTCVNVGCVPKKLYSYAAHFHEAFEDSGGFGWQLAEEPSF
    DWATLRDNKIGEIKRLNGIYGRLLDNADVRLINGRASVVDAHHVEVGGETVSAEKILVAVGGWPWVPDFPGNELTLNSNQ
    IFDLDDFPQRFLVLGGGYIAVEFASIFNGLGSESHLVYRGELFLRGFDNEVREFTRDEMAKKGVNLHFNTNIEAIEKVET
    GLKVTLTDGRTLEVDAVLAATGRRPHLAGLGLDRLDVATNDDGSLKVNERFETSMPSILALGDVTGGPELTPVALEEAMK
    LVEHHFGDTVPEPLDYERVATAVFCHPNIGTVGLSEEAARERFEAIRVYSADFRPMKHTLSGSSERSLMKLIVDDASDVV
    VGAHMVGEEAGEIIQGIAIAVRAGLTKAQFDQTVGIHPTGAEEFVTMRTPTRR

    >gi|307545202|ref|YP_003897681.1| arsenate reductase [Halomonas elongata DSM 2581]
    MLTLLHNPRCSKSRQALALLEERGADVQVRRYLDDPLDEKELRSLMSRLDADGTALVRTNEAEWKALDADIDDPDQVVRA
    IVAHPKILQRPIADDGQRAVIGRPPEDVLVLLD

    >gi|307545216|ref|YP_003897695.1| hypothetical protein HELO_2626 [Halomonas elongata DSM 2581]
    MRYAILLMGAPYSHQASHSALRFARAVLARGHQLETVFFYHDGVYNASRLAAPPQDEPHLVDGWTALNAEHGVALQVCIA
    AALRRGLLDEREASRHGKSGYSVEAPFELTGLGQLVDLGLNCDRLVTFSS

    >gi|307545322|ref|YP_003897801.1| K07112 [Halomonas elongata DSM 2581]
    MSQVASAAPPVREAGVDRFVVGLALIGMVVLGGLIYLETAPFLLALFAIGGLLGVALYHGAFGFTAGWRNLVTKKRGAGM
    RAQLLLFALTALIMVPLLGSGREGMVGAVAPVGTSLVVGSFLFGIGMQLGGG
    CGSGTLFTVGAGNLRMLVTLLFFIIGAV
    VGSLHLPWWLDLPAVDPISLIDSVGVTGAIAIQWLGLGAVALWVNRIERRAHGEIEHGELRLLPTEGRAWRALFTGRWPF
    LWAILVLAVGNALTLVIGGSPWGITFAFNLWGAKALQAVGVDMGQFEFWSWAYPAQALSDSVLVNIPSVMNFGLLLGAML
    AAGMASRFNEASRQKPQGRPFLAAVVGGLLLGYGARLGFG
    CNIGALFSGLASASVHAWVWFACAFAGSLVGIRLRPWFRL
    AN

    >gi|307545323|ref|YP_003897802.1| rhodanese domain protein [Halomonas elongata DSM 2581]
    MWRSMLTTALLMLGMSPALAADVPPLVTADWLAQRLGDDNLVVLDVRSGIDEGGDRGSFEAAHIPGSLYSSYTDDGWRET
    RDGVSGLLPPISSLERLIGGLGIGNDDTVVIVPAGTGPTDFGSAARVYWTFKVLSHDEVAILDGGFAGWKAQGHEVASGT
    SERPEFADFQGQLREDLLATADEVTSARERGSQLVDARPADYFRGENQSPAATAPGTIPGSRNLPHQTLLGENQQAWYLG
    QDVIQSRIREAGLQGDRPTVSF
    CNTGHWAATDWFVLSEIAGFDDVSLYDGSMAEWTQDEERPLAVAKRGLGKVLEFFGLG
    S

    >gi|307545335|ref|YP_003897814.1| hypothetical protein HELO_2745 [Halomonas elongata DSM 2581]
    MSTTVENIQRQISENPILIYMKGTPQLPQCGFSAQTVQALMACGERFAFVNVLDNPDIRAELPKVANWPTFPQLWVEGEL
    VGGCDIVVEMYENGELETLIKETAAKHQDDEQPEG

    >gi|307545531|ref|YP_003898010.1| K09136 hypothetical protein [Halomonas elongata DSM 2581]
    MEIKVNYLDNLRLEAKFDDFTVISDQPIRYKGDGSAPGPFDYFLASSAMCAAYFVKVYCNARDIPTENIRLSQNNIVDPE
    NRYKQIFKIQVELPEDLSDKDRQGIMRSIERCSVKRVVQNVPEFQIETVENLDEDAQALLMAEPEEGASTWIEGKDLPLE
    QTIANMTSILESLGMQIEIASWRNIVPHVWSLHIRDAHSNMCFTNGKGSTKESALCSALGEFIERLSCNFFYNDQFFGEE
    IANSEFVHYPDEKWFQPGPNDELPEGILDAYCREFYDPDGELRGSNLIDTNSGKVERGIVSLPFVRQSDGEVIYFPSNLI
    ENLYLSNGMSAGNTLHEAQVQCLSEIFERAVKKQIIEEEIALPDVPHEVLAKYPEILEGVEALEKQGFPVLVKDASLGGQ
    YPVMCVTLMNPRTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDFMPPTFNSLAVTEPNNFVEHFIDSSGLVSWRF
    FSARADVEFVEWDFSGTNEEEAERLFGILEELGLEAYMAVHEDLGAPVCRILVPGYSEVYPVEDLIWDNTNKALLFREDI
    LHIHELSDEQLGDLLERLEETQIDDHEDIITLIGIEFDENTVWGQLTILELKLLINLALGQHEEALERVEMFLQFNDNTV
    ERGLFYQAVNAVLEIALDDELELDDYLYNFTRMFGEATMQAVVGSVNGEVRFHGLEPTNMRLEGLERHQRLIESYKKLHA
    HRAAKAEMMVAEA

    >gi|307545541|ref|YP_003898020.1| possible transcriptional regulatory protein [Halomonas elongata DSM 2581]
    MCDTTLAIQPTTDDFEARLVQALNHGGLLLLTSLGYRTGLLEAMAGQPPITSQALAERTGLQERYVREWLGGMVAAEVVE
    TDSATASYWLPDERAALLTDRGEANLAVYAQFMPLLGSVEDDVLRCFREGGGVPYSRYPRFQEVMASDSGQTVLPALFDG
    ILPLAPGLIERLESGIRVLDCACGRGRALLAMAERFPASRFTGYDLSEEAIGWARAQAERAGLTNLNFEVRDLSDFDTTA
    TPGAFELVTTFDGIHDQGQPRRLLKGIHRSLTSDGIYLVQDIHASSHHHLDREHPLGAMLYAVSISH
    CMTVSLAQGGEGL
    GTMWGRERALAYLEEAGFRDIQVHQLEHDIQNDYFVCRP

    >gi|307545666|ref|YP_003898145.1| peptide methionine sulfoxide reductase [Halomonas elongata DSM 2581]
    MPISPLSARCCSLLLIAGFASPAMADNTDTASAVFAAGCFWCVEEAYDKVEGVVSTISGFSGGDVADPSYDQVVAGGTGH
    AEAVKVEYDPSRVDYDTLLYVFWRNVDPFAENRQFCDEGPSYRSALFPMDAEQRRLAEASREAVAERFDRQVATEISDFE
    AFYPAETYHQNFYDKNPLRYRFYKSACGRSDRLEEIWGDEAEASARS

    >gi|307545700|ref|YP_003898179.1| dihydrolipoyl dehydrogenase [Halomonas elongata DSM 2581]
    MADKFDVIVIGAGPGGYVAAIRAAQLGLKTACVEKWVNKEGKTVHGGTCLNVGCIPSKALLESSHKFVEARDHFEEIGID
    MEAPTPNIAKMLEFKEKVIAKNVGGISALFKANGVTAIDGTGKVTGSKEVEVTDHDGKSTTYEADNIVVAAGSVPVEIPP
    TPLTDDLIVDSAGALEFQEAPKRLGVIGAGVIGLELGSVWSRLGSEVTILEAMDDFLPMVDKTIAKDAQKLFKKQGLDIK
    LGARVTGSEVKDNEVVVKYTDAKGEQEITFDKLIVCVGRRPYTKGVIGEGVGVELDERGFISVDDQCRTNVPSVYAIGDC
    VRGLMLAHKASEEGVMVADIIAGHKAEMNYDAIPSVIYTAPEVAWVGMTEEEAKSAGIKVETGSFPFSANGRALANNAPD
    GQVKIVADAETDRILGVHILGQHAGELIAQGVIAMEFGSSAEDLALTCYAHPSTSEAVHEAALAVGGHAIHMANRKKRK

    >gi|307545764|ref|YP_003898243.1| osmotically inducible protein OsmC [Halomonas elongata DSM 2581]
    MSIKKNGSAVWQGGLKDGKGTVSTQSGVLDEVSYSFAKRFEGEGGSNPEELIGAAHASCYSMALSMILGEAGYTPERIAT
    QATVSLEQDADGFSINAIHLETRASVPGADQAAFEDAANKAKAG
    CPVSRLFNAEISLDAKLES

    >gi|307545802|ref|YP_003898281.1| redoxin domain protein [Halomonas elongata DSM 2581]
    MTIAIGDRIPDITLKTNGEQGPEDISTGELFAGKRVVLFAVPGAFTPGCSNTHMPGFVVNADKLLDKVDVVACMAVNDAF
    VMDAWQKDQNAERITMLADGNAEFARALGLEMDVSAGGMGTRSKRFALIANDGVVEYLGVDAKGVEQSSAETVLAQL

    >gi|307546069|ref|YP_003898548.1| thiosulfate sulfurtransferase [Halomonas elongata DSM 2581]
    MTSSSFQHLDVATLADWLDAARPLTLVDIRDPASFAAGHLPGSRHLDNDGVPALLAEAERETPLVVVCYHGNSSQQAAAW
    LAGQGFEDVYSLDGGFTDWRSKHPERVASGNVDGA

    >gi|307546078|ref|YP_003898557.1| K07397 putative redox protein [Halomonas elongata DSM 2581]
    MKASVKWTDGRQFVTESGSGHSVVIDGPPDHGGRNTGPRPMEMLLMGLGACTSFDVLEILEKSRAPVSDCVASIEAERAD
    SVPSVFTKIHVHFTVSGQGLKEKQVKRAVELSAEKYCSASIMLANGGVDVTHSFTIVEQ

    >gi|307546132|ref|YP_003898611.1| heavy metal translocating P-type ATPase [Halomonas elongata DSM 2581]
    MTASVASSASELHACYHCGEPVTEPSPWTLEIDGCRHPLCCPGCQAVARAIVDGGLASYYRFRTALPERPLDRHDATAEQ
    WSLFDDPGLQARFVHDDDAGVHASLSVDGIT
    CAACAWLIEHRLNALEGVTGSAVDLTHHRLRLGWDPQRITLSRLLAELA
    AIGYPSRPFEPDEAQRRLQRESHQQLRRLIVAALGMMQALMFSLPFYLAGDTGLDADFDRLFHWLALALTTPVVLYAAQP
    FFLQAWRDLRTRTLGMDVPVSLAIGSAYLASAWAVISGRGEVYFDSVSMFTFFLLFGRHLEARARRRGGAAGNALANLLP
    MSATRLDDAGEPRILPASELRAGDRVLVKPGHRVPADGVIESGASSLDESTLTGETQPVTRRIGDAVTGGSQNLESPLTL
    RITRAGSDTRVAGLLDLTDRAFAERPRIALKSARLAHHFVLQVLLIAAAVALAWWFIAPERAFWVTLSVLVVTCPCALAL
    ATPTALTAAHGRLQRRGALLTRADALESLAGIDRVIFDKTGTLTTGEIQLIDTRTVEDGDPRRLQAIAAALEAHSEHPIA
    RAFRAHRLPGVTADDVTRQPGAGLEGRIAGTSWRLGRPDFAADQAPAPPDDGPWLLLAEEGRPRAWFALDDRLSDDADAT
    LAALRLAGIEVELLSGDAEPRVRELAERLDIADWRAAMRPEDKLDRLRVHQSRGERVAMVGDGVNDVPVLAGADVAFAMN
    GATDLARTRADVILLTPRLQRVAEAIGLARATQRVIRQNLGWALLYNLLALPLAACGLVPPWLAAIGMSLSSLVVVANAL
    RLARPGRFHHPTAPVSS

    >gi|307546171|ref|YP_003898650.1| K03564 bacterioferritin comigratory protein [Halomonas elongata DSM 2581]
    MSISVGQPVPDFTATATGDTQLSLSELRGKQVVIYFYPKASTPGCTTEGGDFRDNKAAFDAANTVIIGVSRDGIRAQENF
    KAKQDFNFTLISDKDETVCRLFDVIKLKKLYGKEHLGIERSTFLIDVDGKLAREWRGVKVKGHVAEVLEAAQALHAGE

    >gi|307546194|ref|YP_003898673.1| K07401 selenoprotein W-related protein [Halomonas elongata DSM 2581]
    MSRIRIHYCTQCQWLLRSAWYAQELLSTFGEALEEVALAPSHGGHFEIFFDDESLWERKRDGGFPDSKVLKRMVRDRLDP
    ERDLGHVDR

    >gi|307546314|ref|YP_003898793.1| K02199 cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE [Halomonas elongata DSM 2581]
    MKRRLLLLLPLLGFLVLGGFLYRGLSMDPSHRDSAMVARDFPAFDLATLADPERRVDASLLEGEVTLVNVWGEWCPTCKQ
    EMPQLLELAERGVRLVGVDYKDTRAKGQAFLEEFGNPFEVNIFDPEGSLGFDLGVYGAPETFLVDADGVIRYHHTGYIAP
    KDVSRVIMPEVEKWRE

    >gi|307546342|ref|YP_003898821.1| glutamate synthase (NADPH), small subunit [Halomonas elongata DSM 2581]
    MANRLNNDFQFIDVGRQDPEKKPARTRAKQFAEIYEPYKPQDAAAQAHRCLHCGNPYCEWKCPVHNYIPNWLQLVSEGNI
    LEAAELSHRTNSLPEVCGRVCPQDRLCEGDCTLNDGFGAVTIGSVEKYITDTAFAMGWRPDMSKVTWTDKKVAIIGAGPA
    GLGCADILVRNGVKPVVFDKYPEIGGLLTFGIPEFKLEKTVMERRRAVFEEMGVEFCLGVEIGRDMPFEQLLEEYDAVFL
    GMGTYKYMEGGFPGEDLPGVHKALDYLVANVNH
    CLGFETDPADYVSLEGQRVVVLGGGDTAMDCNRTAIRQGAASVTCAY
    RRDEDNMPGSRKEVANAREEGVDFLFNRQPVAVIGEDRVEGIKVVRTRLGEPDENGRQRPEVVPGSEEVVPADAVVIAFG
    FQPSPAPWFETVGIELDEKGRVKAPEEGAYAFQTTNEKIFAGGDMVRGSDLVVTAVFEGRQAGEGILDYLDV

    >gi|307546361|ref|YP_003898840.1| ubiquinone/menaquinone biosynthesis methyltransferase [Halomonas elongata DSM 2581]
    MSPHRARPGLASFSAADSGAPRMTSDKHTTHFGYQEVPVTEKASRVADVFHSVASRYDVMNDLMSFGIHRVWKRLTIERA
    GVRPGHSVLDIAGGTGDLTFKFSRLVGPRGRVVLADINESMLRVGRDKLLDRGVGGNVEYVQANAETLPFPDNSFDCITI
    AFGLRNVTDQDAALRSMTRVLKPGGRLLVLEFSKPRSALLNRAYDEYSFRLLPRMGE
    CVAGDADSYRYLAESIRMHPDQE
    TLKGMMETAGLERVEYTNLTGGIVALHRGIKL

    >gi|307546398|ref|YP_003898877.1| hypothetical protein HELO_3808 [Halomonas elongata DSM 2581]
    MMMLMMIKNCDTCRRARKALEGKGIPFQTHDLREDGLSAALLEHILEHVPVMTLLNKRSTTWRQLDDADKADIDANKARE
    LMLANPTLLKRPLLDTGDDILVGFRDGDYDNL

    >gi|307546404|ref|YP_003898883.1| thioredoxin reductase [Halomonas elongata DSM 2581]
    MSEARHERLIILGSGPAGYTAAVYAARANLKPLLITGIQAGGQLTTTTDVDNWPGDDIGVQGPELMERMKRHAERFETEV
    LFDHVHEVELRERPFTLKGDNGTYTCDALIIATGASARYLGLESESRFMGQGVSA
    CATCDGFFYRNQDVVVVGGGNTAVE
    EALYLSNIASKVTLVHRRDSLRAEKILQDKLFDKVENGNIEVIWNHTLDEVLGDNTGVTGARLKSTEDGSTRELDAPGVF
    IAIGHSPNTGIFEGQLDMAGGYIKVQSGLEGNATATSVPGVFAAGDVMDHVYRQAVTSAGSGCMAALDAERYLDEL

    >gi|307546443|ref|YP_003898922.1| copper-translocating P-type ATPase [Halomonas elongata DSM 2581]
    MSTRYERQIPGMSCQGCVSRMRSAIQARDSEAEVVGEPADKRLTVTTSLDDDALDETLSEAGYPPGPAAADDATPASDEP
    APASASHEAQADTGDIRRLSISGMT
    CASCVRTVQGALESVPGITEASVNFGTHTAQVRGSADFDALVGAVESVGYGAEPV
    LDMREAERTRAEREGVEYRRLMRGAAWSLALAVPLMASMLFFHPQPIGAGRLYWLVVGMLTLAVMVLPGRHFFLNAWKNL
    RHRQANMDTLIAMGTGTAWLYSMAVVVFASALPEAARGIYFEASAMIIGLVLLGNALELRARGRTSEALRRLLDLQSRTA
    RVIRDGEEREVDIDAVREGDHLRVRPGERLPVDGDVLEGSSHVDESMLTGEPLPVAKAVGDEVSAGTVNGKGGLVYRATR
    VGADTRLGRITEQVASAQNSRPPIGQLADRISSIFVPAVMIIAVITALVWFNLGAEPRIIHMLVTATTVLIIACPCALGL
    ATPISTMVGVGKAAEHGVLVRTGEALQTASRLTTLVVDKTGTLTEGKPRVTETEILDGDRDQVLALVAALERGSEHPLAN
    ALLAYTEEAGVEAATIHDFQSVTGGGVTARTEQGTALLLGNARLLRDQDVALDAGQDIAERLQRQARSVVHLAIDGRLAA
    IFGISDPLRDDSVAAIQRLQADGLKVVMLTGDNAHTAEAIAREVGIDDFRADLLPEDKHAEIERLQGEGEVVGMVGDGIN
    DAPALALADVGFAIGQGTDVAIESAGITLIRDSLHGVVAAIEISRATLRNIRQNLMGAFGYNLLGIPIAAGVLYPLTGTL
    LSPMIAGAAMSLSSITVVGNASRLRLFTPRDATDTRETTS

    >gi|307546448|ref|YP_003898927.1| thiol:disulfide interchange protein DsbC [Halomonas elongata DSM 2581]
    MKVSTLSLAGGLLAAALTLPTMAWAAAPESLENIEVSGHSMPVKDVRETPMADIYEVRLETGETFYTNAEGNYFLVGDLF
    EKTDTGLVNLTEKARNAERRARVDEVPDDQRVTFRGAETPKARVVVFTDTT
    CPYCQRLHEEVPRFNELGIAVDYLAFPRG
    GMNSPGARELEQVWCADNSSEALSAAFRDESLESDATCDNPVEEQYHLGLELGVQGTPAIILPDGSLVPGYVPAERLAAM
    LGLDD

    >gi|307546483|ref|YP_003898962.1| bifunctional regulatory protein/DNA repair protein [Halomonas elongata DSM 2581]
    MATQRPCDTERDRRWQAVVQRDASADGSFVYAVLTTGVYCRPSCPSRRAKPENVSFHDSPQDAEAAGYRPCKRCAPDALS
    SPIAVLVERACRIIEQADEPLGLLELAERVGLSSSYLHHRFKAVTGLTPRAYAKAHQAHRVREALSDPDGDVTQAIHGAG
    FRSSGRFYENADAMLGMTPTTYKRGGRDTAIRFAVGECSLGSVLVACSARGVCAILLGDDPDDLVRDLQDRFPQAELDAG
    EASFESWVAQVIGLIDDPALGTELPLDIRGTAFQQRVWQALREIPAGTTASYTEIAERIGSPAAVRAVARACAANPLAVA
    IP
    CHRVVRQDGNLSGYRWGIERKRALLEREADA

    >gi|307546654|ref|YP_003899133.1| thiol:disulfide interchange protein DsbC [Halomonas elongata DSM 2581]
    MKRSTTTALATVLFTMSSASAGEIPSVLEELTLGGQAVTPSSVEPAPMNGWYEVRLRTGETLYTDANARYVLAGQLFENR
    NDQVVNLTAQQRREQRLAQLDELDDSAYITYSAEGEEKSAITVFTDIT
    CPYCQQLHQDISELNAAGITVRYLPFPRRGVS
    SPSGQRMASIWCSKYPRHALNQAFNGQTAPVGDEAKVCQPTLEQVYSLAQQFGVRGTPATVLPNGELGEGYRPVDQLVQA
    VSRATGNH

    >gi|307546688|ref|YP_003899167.1| K00520 mercuric reductase [Halomonas elongata DSM 2581]
    MKYLRPLLAVLLLAVIAGIVASGVLDFLSLDYLKAEQASFQAWFAAEPVIVAGGFFLLYTVMAALSLPGATLLTVLGGAL
    FGLGWGLLIISFASALGATLAALLARTLARSFLEKRFSSQLERVNAGIRREGAFYLFTLRLIPLFPFFVINLVLGLTRMR
    LRTFYWVSQLGMLPGTAVFVNAGRELGNLESLSGILSPSLIASFALIGLFPWLARALVALGKRRRLARRFRRPRRFDHDI
    VVIGGGSAGLVASYIAAAVKADVALVERDRMGGD
    CLNTGCVPSKALIRAARSAKEVRQASAFGVHAGEPRVDFAAVMAHV
    RRAIDEVAPHDSRSRYEGLGVEVMEGQARLDDPWRVVVTTANGERVLTTRHVIIASGARPRVPDLPGLEQVEVLTSDSLW
    TLEALPERLLVLGGGPIGCELGQSFARLGSRVDLVEMGPQLLPREDPEVADEVASSLRGEGLHLYLGYRALRVVATDEGH
    ALEIQGDGEVVERLGFSHLLVAVGRQANVEGMGLEALGVETREDGTLRVDETLQSVLPNVWACGDVTGPYQLTHASAHQA
    WHATVNALFGEFKRFKVSYRAMPAVTFTDPEVARVGLNEREARERHIAYEVTRYALHDLDRALAEGDATGFVKVLTVPGR
    DRILGATIVGTGAGEMLAEFTLAITRGIGLNKLLGTIHPYPTRSEAVKATAGVWKNAHKPERLLGWLGRYFRWRRG

    >gi|307546695|ref|YP_003899174.1| selenophosphate synthetase [Halomonas elongata DSM 2581]
    MSAIRLTQYSHGAGCGCKIAPDVLDGILAKAGPGASHSRLIVGNQGREDAAVYDLGDGRGMIATTDFFMPIVDDPFDFGR
    IAATNAISDVYAMGGSPVMALGILGWPLDKLGADIAGDVVGGAQAVCRELGLALAGGHSIDAPEPIFGLAVNGLVDLEHL
    KLNKGAQVGDLLYLTKPLGVGMLTTAEKQGRLEPGHQGLARQTMLETNRIGMDLARIQGVHAMTDVTGFGLAGHLTEMCV
    ASDVAARIDFRRLPRLAEAEAYRRQGAVPGGTGRNREALGAALPAMDEAHWQWLCDPQTSGGLLLSVHPSWEDDIERVGR
    SYGLELEPFGEVVAARGEARIEVRG

    >gi|307546854|ref|YP_003899333.1| K03673 thiol:disulfide interchange protein DsbA [Halomonas elongata DSM 2581]
    MLKSLMVALAGLGLSTMTMAAPLVEGQHYSTLDEPVKTHVEDGKIEVTEAFWYGCPHCYALEDTLNAWVDGLPDDVVFER
    MPATMGGAWNKHAAAFYAAKDLGIQQDLHSDFFDAIHEQGRQLTDPDEIATFFSDYGVSKDEALEALDSFGVKSQVNQAH
    ARMRNMKLMGVPALIVDGRYVVTPSSAGSLDNMPRIAEDLVDKVREERAN

    >gi|307546891|ref|YP_003899370.1| peroxidase [Halomonas elongata DSM 2581]
    MNGGCSAQGGVHSALSMVRSKPELSVNSTEHMASGCFHTRHHRAMLETVEPAPRPRCHLPIHQEANMALQLGDTAPDFTQ
    ESTAGTINFHEWAGDSWVILFSHPKDFTPV
    CTTELGEVSRLKPEFDKRNTKAIGLSVDPLEDHEAWAGDIQETQGQGLNF
    PLLADGDRKVSDLYGMIHPNANDTLTVRSVFIIDPNKKVRLTITYPASTGRNFAEVLRVLDSLQLTDEHKLATPVNWQDG
    DDCIIVPAVSNEEAKTLFPEGWDEQKPYLRLVKQPKRS

    >gi|307546919|ref|YP_003899398.1| alkyl hydroperoxide reductase subunit F [Halomonas elongata DSM 2581]
    MLDDNLKSQLNAYLQKVTRPFEIVATLDDGDKSRELHTLLQEVAGLSDKITLREDGDDARAPSFALYREGESTGVVFAGI
    PMGHEFTSLVLALLQVGGHPPKASDETIEQIKSLPEGLHFETYFSQS
    CQNCPDVVQALNLMAVLNPGISHVAIDGALFKD
    EVEAREVMSVPGIFLNGEPFDQGRMSLEQILAKVDNGAQEREAEKLNAMPAFDLLTVGGGPAGAAAAVYAARKGIRTGVA
    AERFGGQVLDTLGIENLISVPYTEGPKLAAALEEHVKQYDVDIMNLQRAVELVPASEPGGEHEVRFASGASLKSRTLVLA
    TGARWREMNVPGEAEYRNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGLVKEVVLIEFMDELRADEVLQNKLA
    SLPNVEIIKGARTTQINGDGAKVSGLTYEERASGELRDIELEGVFVQIGLVPNTEWLRDSSIELSAHGEIITDERGMTSV
    PGIFAAGDVTTVPYKQIVISLGEGSRAALGAFDYLIRQ

    >gi|307546920|ref|YP_003899399.1| alkyl hydroperoxide reductase, C22 subunit, thioredoxin-like (detoxification of hydroperoxides) [Halomonas elongata DSM 2581]
    MSLLNTEVLPFKATAYHNGEFIDVTDESLKGQWSIFFFYPADFTFVCPTELGDLADNYEEFKKLGVEIYSVSTDTHFTHK
    AWHDSSETIGKLQYPMLADPTHVVSRNFDVLIEEDGVADRGTFVVDPDGKIQIIELNAGNIGRNAEELLRKVKAAQYVRA
    NPNEVCPAKWEEGEETLAPSLDLVGKI

    >gi|307547021|ref|YP_003899500.1| K06191 glutaredoxin-like protein NrdH [Halomonas elongata DSM 2581]
    MFIKIYSSPDCMQCHATYRALDKQGLDYTVVDISEEPEAADTVRQLGYRQLPVVVAADEHWSGFRPERIRQLAS

    >gi|307547049|ref|YP_003899528.1| hypothetical protein HELO_4459 [Halomonas elongata DSM 2581]
    MSGVASFVPTPLLLSDSAKARLRSLVEEEGNRELKLRVYVTGGGCSGFQYGFDFAESVAEDDTLVEFDDVALVVDPLSYQ
    YLVGSTVDFEEGLAGARFMIQNPNATTTCGCGASFMV