Haliangium ochraceum DSM 14365

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|262193565|ref|YP_003264774.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Haliangium ochraceum DSM 14365]
    MLARMSRETRVDVAILGAGTAGSHALEQVRRTGKSFVVINGGPLGTTCARVGCMPSKLLVQAAELYHDRHRAARVGIRGT
    EALRVDMPAVLERVRALRDDFVASTIDSFYDKLSQNPDGTQPSKDERARRIDERLIEGYARFTAPGAVEVDGRIIRAERF
    IIATGSSPIVPDEWAALDERALTTDTLFEQRDLPARMAVLGLGVIGAEMGQALARLGIEVSAFDTSDEIAGLSDPAIAAC
    ARELLGRDMNLHLGCEAKPVHADEELRIDFGAGADAVAVTVDKVLVCIGRRPNTGDLGLDDIGAPLDDDGHPQFDAETMQ
    LGDLPIYLAGDASGPPLILHEAADEGRISGFVSSREQTRGFRRREPFGIVFTDPNIATVGEAWNQLDHDDVVVGEVDFSS
    QGRARVMVRDSGRLRIYGARDSGRVLGAAMCAPLGEHLAHLLAWSIEQKLTVFDLQQMPFYHPTLEEGLSTAIADLAAKV
    ARDAPSPVPELRPAERE

    >gi|262193712|ref|YP_003264921.1| Peroxidase [Haliangium ochraceum DSM 14365]
    MSLRIGSTAPDFTQESTAGTISFHEWLGDSWGVLFSHPKDFTPVCTTELGRASSLVEDFAKRNCKLLALSVDSVEDHNKW
    IGDIEETQQVKQSFPILGDTDRKVSQLYDMIHPEANDTLTVRSVFFVDPKKKIRAIITYPASTGRNFQEILRVIDSLQLT
    DHHQVATPADWKDGDDVVIVPSITDPKEIADKFPKGHKELKPYLRMTPQPNK

    >gi|262193851|ref|YP_003265060.1| hypothetical protein Hoch_0529 [Haliangium ochraceum DSM 14365]
    MKKFPVSIEYCVQCNYTPRAVRLTDELLTQFTHQIETLTMIPSGRGRFEVLVGDVLVFSKAELGRHAEPGEVVKLVAAEL
    AARAGS

    >gi|262194704|ref|YP_003265913.1| Redoxin domain protein [Haliangium ochraceum DSM 14365]
    MTRALRWACALIAVQAALIGAYWLVEQRRAPARDAGAEVGSDVGAEAVLGTQAPQTVDIAMPRLVVRARDGGRAPLPTPT
    RPTLVHVWATW
    CPPCRAELPGLLALPAAYPVDVVAIALDEDWRDVATFINGLSDNQVVLGDTVEVMSELGVHALPATFLV
    EPGGRMALRFDGARDWSDAAFLRSWMPEGPSED

    >gi|262194876|ref|YP_003266085.1| peroxiredoxin, Ohr subfamily [Haliangium ochraceum DSM 14365]
    MSLENVIYRAQAHVTGGRTGHATASTPALDLTLSTPRELGGGGGEGTNPEQLFAAGYSACFIGALKLVASRAKVALPEDL
    AVDGIVGIGPVGKGFGIEAELRVSMPGVPREQAESLVAKAHEV
    CPYSNATRNNIDVTLTVVE

    >gi|262195056|ref|YP_003266265.1| DSBA oxidoreductase [Haliangium ochraceum DSM 14365]
    MSCQRTPWKPLLAPLAALLMAGCATAPPPQAAAPANDAAHSDELARQAEQIEALTERVDRLEAANQQPDERELSLIEQQL
    QRIEDRLEAQPPRRAPARRPRPDPQLTYAVAVGDAPTWGPDNAKVTVVKAFEFA
    CPFCERSRATMDQIREEYGKDVRIVY
    KHYIVHHGQATIPAQAACAAGLQGKWRTMEQLIWEKGFKAGRNLSQDNMLKQAKRAGLRMKKFRADMNGACKEIVQNDQQ
    QMAKVGVVGTPGFFINGRFLAGAQPFPAFKALIDEELAKANERIAEGTQQSRYYETWVVERGKDSL

    >gi|262195115|ref|YP_003266324.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haliangium ochraceum DSM 14365]
    MMEVYDPFQGVGMLFGGLFSLLLLFSFSRASIALAIVAFFVLGGCSKSEDSGAASQAEVVAEIDKLAPEGAEPGAAQAAE
    AVAMNRADDGAELLAVGAPAPDFTAPTHDGTSVQLSALRGQPVVLYFYPKDETPG
    CTAEAQAFRDEMPAFEKLDATVIGV
    SLDSVESHKAFADNHSLNFPLAADPDGAIAAKYGVDTSRGVAARVTYLIAADGTVAAVFPEVRVDGHADEVLAALQAME

    >gi|262195136|ref|YP_003266345.1| DSBA oxidoreductase [Haliangium ochraceum DSM 14365]
    MYWNRSVLCGAATALALLTGCAGTQTEALDARVASLEARDERIQALEERLGVVEAQNQRLIAMFEGISSQLALLEAFGDA
    LGGAEPPSDEPGPETVFAVPVDGSPSEGPADAKVTIVKAFEFA
    CPFCERTRGTLSSIRERYGDEVRIVYKHFIVHQGQAE
    VPAQAVCAASMQGKFTAMKDAIWDRGFNQGGDLSEDNMLRQAKRLKLNMKRFKSDMNGPCRERVQRDHQAMAQVGVSGTP
    YFFINGRLLRGAQPLPAFTALIDAELAKAKQVIAEQGVAPADYYESYVVERGVTLN

    >gi|262195245|ref|YP_003266454.1| Methyltransferase type 11 [Haliangium ochraceum DSM 14365]
    MNSSEPNWNDIEGSGDADYFVGYLDTATAQSEMQRYKRRTYELLGLRPGARVLDAGCGTGDDVIELAGLVGEEGRAVGLD
    NSQAIVDEGRARAHRAGVAAEFHVGDIAELPFPDHAFDAVRADRVLMHIPDRERALSELVRVTRPGGRVVVREPDWDTMI
    VDGGDPLFARRLVHQHFDRVIRHPQAGRALFGM
    CQRAGLSAVHVADTSTLIITELATAHKLYGLDAAVEWMCAHEPNAAV
    EARAWLAQLEVADRSGSFFSAVTGFTVVGKKPGVRS

    >gi|262195414|ref|YP_003266623.1| iron-sulfur cluster assembly accessory protein [Haliangium ochraceum DSM 14365]
    MSQATETADVPQSLEEFLSITDTAASKVNEIREAESIEQEMGLRVRVVGGGCAGFSYDLYFDNTTDMDRTFGVNGVEVVV
    DEMSLMYLMGTEIDYVESLQGAGFKFNNPNVKSTCGCGSSFSM

    >gi|262195415|ref|YP_003266624.1| UBA/THIF-type NAD/FAD binding protein [Haliangium ochraceum DSM 14365]
    MPTFQNYLKGIKNEIKEIDAAGMKEVLDKGDSHVAVIDVREKDEYVQGYIPGATWIPRGFLELRIEEAVPERDQPVVLYC
    AGGTRSALAARALHELGYTDVTSMAGGFTSWKRNGNRFEMPVVMTPEQEMRYARHTMLPEVGVKGQVKLLESKVLCLGAG
    GLGSPSALYLAAAGVGTIGIVDDDVVDASNLQRQILHATDRVGMSKVDSAEKTLNGLNPDVQIKKFQERLTSDNVLEIIK
    DFDVIVDGADNFQTRYLLNDAALKLGKHVVHSSIYRFEGQLTVFTGDGHPCYRCLYPEPPPPEEAPS
    CQEAGVLGVLPGI
    MGVLQATEAVKLILGIGTSLSGRLLVFDALKTKFRELKLRQDPNCPTCGEGVDRSQIELIDYVQFCAGA

    >gi|262195420|ref|YP_003266629.1| iron-sulfur cluster assembly accessory protein [Haliangium ochraceum DSM 14365]
    MSETITITETAASEIKRQQSKRGAEQAAIRIGIRGGGCTGFAYLFDWVDGAPKDTDKVFSAHGVSVYVDPKSFNYLKGTE
    LDFETSIMGHGFKFNNPNAKGTCGCGESVQF

    >gi|262195565|ref|YP_003266774.1| DSBA oxidoreductase [Haliangium ochraceum DSM 14365]
    MNIEIWTDVMCPFCYIGKRKLEAALSEFVHADDITLVWRSYLLRPNLQTAPEKRLHHFLSTSKGLSLEQAQMLNARVSEM
    AARVGLRYRLDDAVLANTFDAHRLLQLAKQHGLGGAMEERLLGAYLCEGANVADRELLRALGVEVGLSENQIDAMLAGEQ
    CASEVERDLREARALGVSGVPFFLFDRKYAVPGARDSEVFAQVLRKSFAEWRADGEALAPSSERALCTPEGECG

    >gi|262195572|ref|YP_003266781.1| protein of unknown function DUF395 YeeE/YedE [Haliangium ochraceum DSM 14365]
    MTEFTPIASTLGGVLIGLSAALLLLSHGKIAGISGITGGLMHRPPPGDIAWRVAFVAGLVGTGALLGLLWPSAFHMTLQR
    SPALLVVAGLLVGFGTRLGNG
    CTSGHGVCGISRLSPRSMVATATFMATGALTVFAVRVWFGGAL

    >gi|262195702|ref|YP_003266911.1| hypothetical protein Hoch_2482 [Haliangium ochraceum DSM 14365]
    MRTRFVFPAALLGLFLGCSGSPGTKKTAEPAERNLTIFATTELRGQVEPCGCTTNPLGDLARTAEMIDQVRASKRPVLVV
    DGGSLLYTEVPVPAHLRAQEQLKADLLREAFDQTLKVAAVGLGPNDFGFGPSGIKLPRQAANVPGDSGVPIAAPKVVELE
    GVRVGLFGVVAPELLAGHGIEAGDPVAAAREALASLQKQSPQIVVGLAYMDRKQAADLARAVPGIDFLVVGDADADPANL
    TETAQRIDDTYLIRPIDRGQVVSRIDITLRKGDGPLADAGGEARANALLPSLEAQRQELAADLDKWRADTSADPAFLATK
    EKQLAGIDEDIKKLREQPLQPPESGSWFVLAQVPISKGMACDQEIQNAKIAFDKAAGEANLAAAKASPKPGPPAPPEGVA
    GYVGAEECSYCHDEATEFWQTTRHFQAWETLETAGKQFNYECIGCHVTGWDRPGGATLAVNEHLRDVQCETCHGAGSLHI
    AADGADSPRTVVREPPVALCVGCHSKEHSDTFDFAAYLRDVTGPGHGAAFREQLGDGPTGRELRAAGLAKAGSSIGAGCR
    K

    >gi|262195866|ref|YP_003267075.1| hypothetical protein Hoch_2650 [Haliangium ochraceum DSM 14365]
    MHRVPWSLTLLVALLAASATACGSAAPAAESPASDPDNAGGSDGSGDAATGDAHHGGAGDSASGEIALATIDGQPDSLSA
    HRAPVTVVALWATY
    CSPCLRELHLVEALYQHYRDDEGVSVLLVSVDEADEDSSERISGILGERDMRVPAFIDLEHALIER
    VAPRDHNGKAYYAVPMLAVIDAEFGLRRKLALAQGTSEAGFMAEMSPLIEAARRGEPAPPDEPYQAPLGGGFAGKRSITL
    TVENVSDEQLGGYLGSLRRQIADLYPDLHGHQLDVIMVEVEQKLRAQGGGKLKLDIPMGHTGAH

    >gi|262196045|ref|YP_003267254.1| Heavy metal transport/detoxification protein [Haliangium ochraceum DSM 14365]
    MKLCPRCESKGRTIKPVTLEAQVVPARLDQLGEHDGWRLCTSESCEVVYFRDDEVVVLGETRGVPFHKSEDPQRLVCFCF
    EHSVADVEADVAENGTSTIQVSIKAECKAGRDDCERKNPQGR
    CCLGNVGQVVKRAAPDDADGGGAGCCGDKAAENEAESC
    CAPKTTASEASSATDDTTARSGLLASGGALVAAVLSSAC
    CWLPFAAIGLGASSAGVGAFFEAWRVPLLLATVALLGSGFY
    LVYRKPRCAPGEACEVPNPRLQRFNRGMLWLTTVFVAVFAFFPEYVGAFTGGGGEVAEAAPTQTTVRYQVEGMTCAGCEG
    HAREAIEALPGVASVAVSYRDGSAEVVWSGQPNDAAVADAVAEFGYSATPLR

    >gi|262196420|ref|YP_003267629.1| dihydrolipoamide dehydrogenase [Haliangium ochraceum DSM 14365]
    MSAIERYDAVIIGSGPGGYAAGIRLGQLGVKTAVIERETPGGVCLNVGCIPSKALIHAAKTYEKMSSSASMGITLSAPPT
    LDMDAMQTWKRGVVTKLTRGVAQLLKSAGTKLVRGTGRLAGHSQGRHRVEVSGEDACVIEAEHVVVATGSRPIEIPGFAV
    DGERVLDSTGALALTRVPDHLVVIGGGYIGLELGTVYAKLGSKVTVVEALDSVLAGMEPECVAVVARKLRKKGVEVLTGA
    RAKAWRPGASASAAVLSIDTAKGPRELETDAILVSVGRRPNSENLGLAEAGVQLDERGFIPVDAALRTNVAGIYAIGDVA
    GGVMLAHKATKEAEVVAEVIAGHDEVQDARTIPAVVFTDPEIASAGMTEAQARAAGHEDLKIGKFPFAALGRALSVDDTD
    GFAKVIGDARSGEILGVHVVGTGASDLISEAALAIESGSELRDLALTVHPHPTLSESLKEAAAAALGEAIHIVNR

    >gi|262196458|ref|YP_003267667.1| Protein-disulfide reductase [Haliangium ochraceum DSM 14365]
    MPKRLPPVLAALLVLLVPALAFAQGGGFEDQLARGWLWAHLAVFGAGFLTSLTPCVYPMIPIVVGVFGARDEDVTRQKAF
    ALASAYVLGMGAMYAVLGIVFALIGKQFGSILSDPKVVFPIVALYLALAASMFGAFELNLPASLQARLSRVGGRGYGGAF
    GMGLVGGLTAAPCTGPILVGILGYVATTRDVVAGASLLFTYAIGMGVLFWLLAAFTVSLPKSGRWMESVKSFGGIALLAV
    SIFFLRPIFPAIAEFGGSELSVLALAIGLIVLGIALGAIHLSFHAGWPVRIRKGLGVLFTVVGLTLAVNWTLSAERELPW
    HYDEQAAFAAAEAEDKGVMIDFAADW
    CTPCAELELTFATDEVYEALSEDYVFLKFDVSKGTEEDEAKQEKWNAETLPAVV
    FTDAAGEELGRVSEYLKPAPFLAVVHAASAKLRGHEPEAAAATPAAAAELAAVAAEPAAAQASADDIAVPAAGAATVKGA
    AEDTADKAEVKIEGHGELSWRTDERAAFAEAAATGKRVVVDFHGTW
    CTGCVEMDENAWSEPAVASVIDEAFVPLRLDVTE
    GNPADEALQAKYAADSLPMVIVVDTEGVEHGRLAGAASSTDLIGLLTTCSS

    >gi|262196615|ref|YP_003267824.1| peptide methionine sulfoxide reductase [Haliangium ochraceum DSM 14365]
    MSFAWSHCRFAVVSVALVALAAAAPACKGSSSHSSSPPASAAAAADETGSAPSSSWLLKRIPAPEDDIPRADGDTRRAVF
    AGG
    CFWCVEAIFEELDGVEAVVSGYAGGSEDSASYEQVLRGDTGHAEAVEVRYDPAQVSYGTLLRVFFATHDPTQLNRQG
    PDVGEQYRSAVFFASEDEERVARAYIAQLGRAAAFDKPIVTTLEPLTGFYEAEEHHQDYARRNPGAGYIRVNSAPKVEKL
    RKQFPELLGEQEGEGASAGEAE

    >gi|262196672|ref|YP_003267881.1| Thioredoxin domain protein [Haliangium ochraceum DSM 14365]
    MRIAIASVFLGLCVAACGGSSPEPAEPAHPVEPGAADDAAAIEPVAPQFELSNPAGDLVAVEDVLVPGQVTVVDFYADWC
    APCKVLEKKLAGEIHQEPRISVRKIDVGQAEPEAVTAQYGIENLPHVRIYDPEGKLLHDLPGTAAERTGALALEALGDL

    >gi|262196710|ref|YP_003267919.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haliangium ochraceum DSM 14365]
    MFGSRSHTSLVRALLLATALILGSAGLASADAVLGQPAPAFELKDVDGKTVKLSDFRGKTVVIEWFNPGCPFIKYAHGEG
    PLKDPAKRPGGDRADVVWLAINSSASGKQGHGVALNKRAKAEWKIPYPVLIDESGTVGRAYGAKTTPHMYIVDVKGKLVY
    HGGLDNAPLGRGKGKTENFVASALADLAAGRSVQNAETKPYGCSVKY

    >gi|262196712|ref|YP_003267921.1| OsmC family protein [Haliangium ochraceum DSM 14365]
    MSNDFKTFFEQMQSTLADNAHAGRVRFTSDSHQVEGVRSTVRLRNFELVVDEPPALSGTDQGPNPVELILAALGTCQEIT
    YRFYADKMDIPLHGVAVTVKGSLDLRGFFAVDDEVRPGYKEIEAEVRIDSPASAEDIARLVEEVERHCPVLDCLSRGVPV
    KSKVAHRDASGVRTAVA

    >gi|262196817|ref|YP_003268026.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haliangium ochraceum DSM 14365]
    MATPKVGEFAPDFTVEDTEGQTHTLSEMVSRGPVILAFFPKAFTPGCKRELTSYRDRYDEFRAHDAQILAVSTDKEATQA
    SFRRSIGAPFAFISDSDGTLTRSYGVKTPLVTFAKRTTFVIGKERRLLHVESGGDAIDPGGAAEACSLY

    >gi|262196889|ref|YP_003268098.1| dihydrolipoamide dehydrogenase [Haliangium ochraceum DSM 14365]
    MSEKNKYQVAVIGSGPGGYVAAIRAAQLGLDTVCIEREELGGICLNWGCIPTKALLRSAEVLDLCRRADEFGIKVENVSF
    DFAAIIKRSRGVSSKINKGVGYLLRKNKIDHIAGTAKLAGAGRIDIALKDGGTRSVSADSIIIATGARARSLPGLEFDGE
    RIIEYRKAMTLSERPSSMVVVGAGAIGVEFASFYEALGTEVTIVEYLDRLVPNEDEEISAELERAFKKRGIKLLTGHGVK
    SAKVSGDGVEVEVEPKDGGEAKQIKVDVVLSAVGVTGNVEDLGLEDIGVSVERGFIKVDEHMQTGVKGVYAIGDIIGPPA
    LAHVASAEGVYAAEHIAGKNPFPVPYDAIPACTYCHPEIGSVGLTEAKAREQGIPIKVGRFPFKPLGKTMAAGEYPGMVK
    IIWHADDGSLVGAHMIGPAVTDLIAEMTLAKTTEVNADSLNYTIHAHPTFAEAIKEASEDAYGHAIHI

    >gi|262197069|ref|YP_003268278.1| glutaredoxin-like protein [Haliangium ochraceum DSM 14365]
    MSLDQGLKQRIESIIASDQVVLFMKGNRSFPQCGFSSTVVQILNSMVPNYTTVNVLADPEVRQGIKEFSDWPTIPQLYVE
    GEFVGGCDIVREMFENGELARLLGSQEVEAPTITITDAAAAALKSALSAEGGEGDVIHLAVDARFQHNLDLGPKTEHGIE
    VASNGVLLEVNRMSARLADGLTIDFVEEGLQRGFRMDNPNRPPEVVELSPAELKAKLDAGEIKELIDVRSPEERKTAQIA
    DSRLLDDATMQQLTQLDVDTPLAFY
    CHRGQRSKAAAEHFRDRGFRKVYNLSGGIDAWSTEVDSDVPRY

    >gi|262197321|ref|YP_003268530.1| putative periplasmic substrate-binding protein [Haliangium ochraceum DSM 14365]
    MSPADANATSDAAPPRIASLLPSATEICFALGLGPQVVGVSHECDHPDAARALPALTRARIDARASSAEIDRQVRELAAS
    ASDALSIYEIEREQMRALAPTLIVTQDTCEV
    CAVSRAEVERAAAELLGHACQVLSLSPLTLDDVLADIGRVGEAAGRAEA
    AAALVASLRQRLDALRARTRELPRPRVLVLEWIEPPMCAGHWTPELIRAAGAEPVAGHDGAPTRSEAWETLRQRAGDIDA
    VLVAACGFGVEQSVREIDAVRARFPALPVIVIDGNAYFNRPGPRLIDSAELAAQMLHPEHLPAPPPTRARRFPPLASA

    >gi|262197358|ref|YP_003268567.1| UBA/THIF-type NAD/FAD binding protein [Haliangium ochraceum DSM 14365]
    MSERLHAAVIGAGGLGGPVAYALAQAGVGLTLCDHDRVELSNLQRQVQFATGDIGARKVDALAAELGRRGAAPGSVRALP
    LRFDGDSAAEVLAGADIVIDGSDDFATKFAVNDLATRAGLPFVIGSVLRYSGQVFAHDPARQRGCYRCLFEEPPSPDEAG
    PT
    CADAGVLGAAVAVIGGYVARAALALLAQRQGRPGAADAPFAGGGLWVFDDVRALERVRRVGFAARASCPACRPQRPEP
    LSPPEYHAT

    >gi|262197522|ref|YP_003268731.1| Methyltransferase type 11 [Haliangium ochraceum DSM 14365]
    MFNARAYKKKTKRWFDAIASVYDEGLSALLLSLHQKMLEQARLQTGETVLNLGCGTGMDSFLTAPLIGEEGSVVGIDIAP
    EMVRLANEKAGSRGLDNVTFQVMDAEKLKFKANHFDAIISQWALMFFPNDRGALREAYRVLKPGGRFALSVVGRPENSPF
    LMVPFRVVAKTLPGVAISEGGPPTFRFAREGALEAALSQAGFVSTWSGRYASMITVKDADTYWELFTKWVGGFAYRFAQE
    PAEVREPIIREIKETVAQHATADGIRLQIESVIAVGYKPGEGDALDTSKRYVVRTPDELIQTAQVRAQAIDVGDAQQAQQ
    QEALLIDVRQRDEFERSHIAGARHIPRGRIEELLTQEIPDTRHSII
    CYCDSGERSSLAAAALLNLGYSKAYWLTDGIAGW
    EQAGGTLSSGEQTRS

    >gi|262197602|ref|YP_003268811.1| peptide methionine sulfoxide reductase [Haliangium ochraceum DSM 14365]
    MLSRMIFAARKSKMPAPDEALPGRQTPMHITNQHFVHGTPLQPPFPDRLESAYFAMGCFWGAERYFWKIPGVYSTAVGYA
    AGYTPNPSYEEVCSGRTGHNEVVLVIFDPEIVSYERLLQAFWENHDPTQGMRQGNDVGTQYRSGIYTTSVAQKQAAEESR
    TAFQRALDQVGYGAITTEILEAPSFYYAEDYHQQYLAKNPNGYCGIGGTGVSCPIGVGSHSAQ

    >gi|262197626|ref|YP_003268835.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haliangium ochraceum DSM 14365]
    MSRGRRWRPRRTIERIGAALVAPRVAMEAADSGADAPKSGSDAALLIALSVLAAATREVVTALWLATSESAMTGIATLAR
    ILSQAAATDLVFLLVAGVVVFALAGRKRSFGRDLDLAFVAYVPIAAVRLLAELGLTVTGIGVSAYVQQAATALAYGWAGV
    LILLACQTARARTDDSLHRDGSGSGRESAAVLAEQTALIPAVAPRSVGRAGVALLLLAALLTVWHLVAVARDLEAVRPVT
    HGDAAPTFHIHGIDERGAVAGEHLRLEDLRGQVVLLEFWATW
    CDPCIAGLPALDAIHDRYRERGVAVVSINLDDAAKARA
    LFDELDIDVPLYADDELTSHRYKVESVPHMVLIDRAGTIRYVARGLTDEDRLGREIESLLGE

    >gi|262197654|ref|YP_003268863.1| protein of unknown function DUF255 [Haliangium ochraceum DSM 14365]
    MPNRLAHESSPYLLQHKDNPVDWYPWGEEAFAAAQEQGKPVFVSIGYAACHWCHVMAHESFEDAEIAAVMNELFVNVKID
    REERPDVDAVYMNALQILGEGGGWPLSAFCTPDGKPYFLGTYFPPQDRYGRPGFASVLRTMAKVFEDQRDKVDQNTEAIV
    DGLRRVDEHFRRGALSGEVGALRADLLITAGRQLAQRSDPQHGGLGSKPKFPSSTTHALLARAGRLAFGAPAREAFLKQA
    RSMARGGIYDHLGGGFARYSVDERWLVPHFEKMLYDNGQLLGIYGDAYAMDQDPAFARVIDETITWLEDEMQHPSGALYA
    SQDADSEGEEGKYYVWTPEEIRAVLGPVDAIFFERAYGVSETGNFEHGTTVLSRVSDPGGDSDEAALASARARLLAARKQ
    RVAPETDTKVLAGWNGLAVRGAVRAWETTGNARALALAVRVAEFLAGHMLHEGGTRLWRVFKDGSTKLDGTLDDYAFVAH
    GFLHLAEATGDARWWRHGAALIDTILERFYEERDGVGIFYMTPGDDTLLVHRPESNSDHAIPAGASVAVACLLRLAQVAE
    DKRALDIAERYLAGRVPQAGENPFAFSRLLSALDLYLHGQVVVVSAGEGADELLAAARRVYAPARMLVPALAESWAADSL
    LAGKDAAADGRAQAYVCRGQTCSAPVSDAQALRELLTATPA

    >gi|262197770|ref|YP_003268979.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haliangium ochraceum DSM 14365]
    MSFLWVAAALLALSATSACNKDAKRDAGDTDEGVGAAAETAAGDTEVAADSPAGEAARQWYRAWFQGSPEVGEIPFFMQL
    PVAPLRGEVVVKQGDGLLRGEARWFGAEASANLPLLRTRLYLRSDAKGQLSGHMTSASPVSDHAESLPLRAEPVDEVDNR
    KRFRDVAACGAAPEAANGQGQGQDEPKAFAGEWLASFEERGEVGLSVVEREPGVWTGAAAFSNGTVVSLVGNAFGERLCL
    SGFDGVNPTLMVLDLQAGGRRLSGRWAAGVSEETQSEFTAERREQAIAHDTGGVRFTPNQTRLPLAKLGLAEFAGKPVII
    EFGASW
    CPPCLDAVPLFRSIYEAHHGNGLEIVTLLFELEDDDELLLRKAEAFTREYEIPWPVMPVRGEIAPYWKVVPHEP
    EVTEVNLPVTLFVNADGTIRDAHMGFPPPNSGAPFDALRQRYEAAAKELVGGGRGE

    >gi|262197888|ref|YP_003269097.1| DSBA oxidoreductase [Haliangium ochraceum DSM 14365]
    MKRTGMMMLSMLTALAISACVPTESSPQVGEKLDEINGRLDKIEQTLRSNRAGAAAANRGRQPQRRPGPDPEKTYSVAVE
    GAPAVGPADAKVTVVKAFEFA
    CPFCERARGTMDQIREEYGDDVRIVYKHYIVHPGSATVPAQASCAAGMQGKWKAMEDLI
    WDKAFKAGRDLSEGKMEELAKEAGLDMAKYKADMEGACKELVQKDHQQMAKVGVTGTPGFFINGRFLRGAQPFPAFKAVI
    DEEMKKADERIGKGTPKGKYYDEWVISKGEKSL

    >gi|262197922|ref|YP_003269131.1| AIR synthase related protein [Haliangium ochraceum DSM 14365]
    MSSLSLHELVAALKCSAGLDGKRDIQEAATGLPALVHGPWGQQPVALGDDTAAIPDGDGYLLLASEAMAPDFVQADAEFA
    GYCSVMVNLSDVAAMGGRPLAVVDALWAGSAADARPIWRGMQRAAAALKVPVVGGHSNLRSPFPALAVSILGRARTLLSS
    FAARPGDTLIAAYDLRGAMHPAFPFWNCHPGAPPERLRADLELLPGLAESGLCDAGKDISMAGLIGTSLMLLESSGVGAT
    VFVDEIPRPAAIALEDWLLAFPSFGYLLSVRDPHVAAVLARFEDAGLAAAAVGVVHKEQTLFLARTRGARTPVAFWDIAR
    SPLTGFSRPEREYA

    >gi|262198169|ref|YP_003269378.1| dihydrolipoamide dehydrogenase [Haliangium ochraceum DSM 14365]
    MPKHDMIVIGAGPGGYVAAIRAAQLGLDVASVEREAALGGTCVRVGCIPSKALLESSERYHEAKHGLSAHGIEVGEVGFD
    LGAMMARKDKVVKSNCDGVAYLFKKNQVTRYRGHAEIQAPGKVVVHADGEDQVLEAEHIVIATGSSVAKLRGVEPDGDRI
    GTSTEALAYPEVPERLVVIGAGYIGLELGSVWQRLGSQVTVLEYMDRILPGMDAEIAADALKVFKKQGLQFHLGARVTGA
    ALTDAGDVEVQVDGMEPLRCDRVLLATGRSPNTEGLGLDAVGVACDERGRVTVDERFRTNVEGIYAIGDVIAGPMLAHKA
    EEEGVALAEMIVTGHGHVDYDTVPGIVYTEPEIATVGKTEEQLKEAGVAYAKGVFPYQANGRARALGATEGKVKVLADER
    SDRILGVHIIGSRAGDLIAEAVAAMTFGASSEDLARTMHAHPTLSEILKEAALGVAKRAIHI

    >gi|262198263|ref|YP_003269472.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Haliangium ochraceum DSM 14365]
    MNSRHYDAIIIGTGPGGEGAAMKLAKDGKNVAVVEKYFDVGGGCTHWGTIPSKALRHAVQRVADYRRDHVLRRIIGPVQI
    TYPELLKTAESVIRQQSNMRERFYYRNRVDIIGGRARLADAHTVVVETSAGSHERCTADHIVIATGSRPYHPPDIDFEHP
    RVRDSDSILHLDFTPRSVTIYGAGVIGCEYASIFASLGVKVNLINTRDRLLSFLDDEITDALGYHLRDQGVVLRHNEEYE
    RVEPRSDGVVLQLKSGKRVKTDVLLWANGRSGNTRDMGLEEQGIEIDHRGQLAVNETYQTTCPHVFAVGDVVGFPSLASA
    SYDQGRFAATHIIEGKCDDRLVKHIPAGIYTSPEISSLGPTERELTAQRVPYEVGRAFFRSIARAQITGHTVGMLKILFH
    TETHELLGIHCFGQQAAEIIHIGQAIMAQSGEANSVNYFVDTTFNYPTMAEAYRIAALNGLNRMFE

    >gi|262198283|ref|YP_003269492.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haliangium ochraceum DSM 14365]
    MLSIRRSITTSIFTAMATSLVVSLALLGGCSKQSGSEEPTPLGQGSAAGQSGQAVGGEADGDNPEGMASAAGQSGYAVNP
    DGPPSAGDKAVDGTVETADGTELALSSAWQSGPAVVVFYRGHW
    CGYCQKQFKALAAEHDELANMGVTLVAVSAAREDPAE
    MQQKSGATFPLYVDPDLELIKAWGVFDSENEIAKPATFVIDADGTVAYAYVGADKADRPAWDEVKAKLAAM

    >gi|262198298|ref|YP_003269507.1| Redoxin domain protein [Haliangium ochraceum DSM 14365]
    MSISVGDKFPSVTVKHLTAEGLKELSTDTLFSGKKVVLFAVPGAFTPSCSKTHLPGYVNNADELKGKGVDEIVCMAVNDP
    FVMDAWAEQQSAKGKVTMLPDGNGELTEKLGLGMDGSGAGLGTRCKRFSMLVEDGVIKSLDVEEKASDVSVSGAESCLAN
    LG

    >gi|262198307|ref|YP_003269516.1| arsenate reductase related protein [Haliangium ochraceum DSM 14365]
    MSAEDVRAQRLRYTRGVSLTVYQYPKCNTCRKALRWLDERGIAYEARDIVAEPPSRALLGRLPAMAEVPVKKLFNTSGQS
    YRQGGFKDKLSTMSETQALDALAADGKLIKRPLLIGEGFALVGFREGDWTEQLG

    >gi|262198340|ref|YP_003269549.1| alkyl hydroperoxide reductase/thiol specific antioxidant/Mal allergen [Haliangium ochraceum DSM 14365]
    MRKLCLPPVLRAGPLALLIAAAAAACAPRSAAPADTAAASANAAAPANTPADAPAAALPTLEAARDLDGHAVGALTSEQH
    ATVVVVFASW
    CGPCRHELALLGELRADEPRVRIVGVNAFEDYDDRSDEQRLRDFLASSAPWLRVVRADEPLMAALGQPSK
    IPTMYVFDRAGALVHSFRRDRRPPPDRAELSAAVAEVLP

    >gi|262198401|ref|YP_003269610.1| methionine-R-sulfoxide reductase [Haliangium ochraceum DSM 14365]
    MSEKVIKSDEEWRSNLSDEQYRITREGGTERAFTGKYWDCKESGVYTCACCGAELFDSETKYESGSGWPSFTEPQDEHCV
    ATLRDTSHGMVRTEVQCSRCDAHLGHVFPDGPAPTGNRY
    CINSASLDLKDR

    >gi|262198405|ref|YP_003269614.1| DSBA oxidoreductase [Haliangium ochraceum DSM 14365]
    MKRIGFISMSVLLAVTGFGLVGCQQAQPQSSELAAKLDEIDKKLTRIEKQVENGAGAAAAARGRAPQRRPGPDPEKTYSV
    AVEGAPAVGPADAKVTVVKAFEFA
    CPFCERARGTMDQIREEYGDDVRIVYKHYIVHPGSATVPAQASCAAGMQGKWKAME
    DLIWDKAFKAGRDLSEGKMEELAKEAGLDMAKYKADMEGACKELVQKDHQQMAKVGVTGTPGFFINGRFLRGAQPFPAFK
    AVIDEEMKKADERIGKGTPKGKYYDEWVISKGEKSL

    >gi|262198416|ref|YP_003269625.1| OsmC family protein [Haliangium ochraceum DSM 14365]
    MADTDNDKLNGIDTATLREVMKAVSAEPSKGMVKFEVKSSWTGQCKMETEVASYTLGGQEIKRPHKIVIDEPHELLGTNQ
    APNPQEVLMAAFNS
    CIMVGYTMGAAMKGIKLEKLEVETEGELDLRGFLGLDASIKPGYETIRYKVHIKGDGSKEQFEEIH
    DTVCRTSPNRFNVAEQINLDAELIVEE

    >gi|262198438|ref|YP_003269647.1| Redoxin domain protein [Haliangium ochraceum DSM 14365]
    MNHRSSISTLLSASALSLALALSTAACGGASQDGAAQPASPNAAEGAPDTAHDPQLPEAAEAPERTGVVTIGGNPVTLLG
    QSVEVGQSMPGFTLTGNDMSDLSNDAYAGKVLVLSVVPSLDTGV
    CAMQTRTFNEKASALSEEVTILTVSMDLPFAQKRFC
    GAEGIERVVTASDYKYRAFGTDFGVLIKESGLLARAVFVVDRSGTVRHVEYVSEASQEPDYDAAMDAVQAVL

    >gi|262198473|ref|YP_003269682.1| glutaredoxin [Haliangium ochraceum DSM 14365]
    MPPTLSLYHKPTCSYCVQVRTAAERLGIDLELHDIGADPARRDELEAATGRPRVPVLRIDGPEGTRYLPESLEIIRYLRD
    IAGRPDRFPGWLDRAMPAAWFAGWGLVIAGLIFDGGVGMLLFGVGIAAVVGVAARRFTSAAIRPGDSG

    >gi|262198550|ref|YP_003269759.1| Peroxiredoxin [Haliangium ochraceum DSM 14365]
    MATTSESASSISAEAAASIFETPVNTLSGAPSSIGAHRGKALLVVNVASRCGLTPQYEALEKLQKEYGERGFSVLGFPCN
    QFGGQEPGSAEEIREFCSLTYGVTFPMFEKIEVNGPERHPIYTALTEVPDPDGHVGDIRWNFEKFVISADGRTITRFAPQ
    TKPYDAAVIAAIEAGLPAR

    >gi|262198670|ref|YP_003269879.1| Rhodanese domain protein [Haliangium ochraceum DSM 14365]
    MAIQRITPDEAASLLEQGYTYVDVRSEPEFAEGHPEGAYNVPFMHREARSMVPNADFARVMHANFAKDAKLVLGCRSGAR
    SLRAAETLSAQGYTEVIDMRGGFAGEANRTGEIVCEGWQSRGLPVSREAGEGRGYEALESATRSQE

    >gi|262198724|ref|YP_003269933.1| methylated-DNA/protein-cysteinemethyltransferase [Haliangium ochraceum DSM 14365]
    MWFASMDSPIGPLLLAADADGLRRIAFARDGVPAKPEPGWQHAPEQLAAARAQLDQYFAGTRQRFELPLAPQGTAFQRQV
    WQVLQGVGFGVTVSYGELARRLGRPTAVRAVGAANGRNPLPIVIP
    CHRVIGADGSLTGFAGGLAIKRALLRGEGVLC

    >gi|262198784|ref|YP_003269993.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haliangium ochraceum DSM 14365]
    MSKRKSSDTSSKRASAAAKGGAAKGSGDRSASAPADKRETRRIVAITVIGAASLFLVTQFAFLIQPAAAREIQAACNGLR
    PAATNPSLGPVPGQQAVDFTAQDHEGKMVKLSDYRGQVVFVNFWASW
    CNVCKAEKPSLDVMARELQDEYGDFQVLSLASD
    TEWGPIRESLPEGTAFDVLLDPPANEDENLGAIAKQFGLKAVPESFVVDRDGTLRYYFINKRDWDSDIAETCLRSLLEEG


    >gi|262198887|ref|YP_003270096.1| glutathione-disulfide reductase [Haliangium ochraceum DSM 14365]
    MSTYDYDLFVIGGGSGGVRAARIAAQHGARVAIAEEHRYGGTCVIRGCVPKKLFVYASEFGHAIEDSAAFGWQSSAPSFD
    WATLIANKDREIDRLNGIYERLLGNSKVTLHHGRATLVDAHTVEVEGQRHSTRVILVATGSRPRRMEMPGAEHVITSDEA
    FYLPELPQRVLVVGGGYIAIEFAHIFRGLGAEVSLIHRGDKLLGGFDDDIRTEVTTGAMARGIDLHLEDEVAAVEKRADG
    SLVATLRSGTVIDAGVVMAAIGRIPNTDKMGLEHAGVQLRENGAVHVDRYSHTGAESIYAVGDCTDRVNLTPVAIREGQA
    FADMVFGEHTVELDYEHIPTAVFSQPPVGTVGLSEAEARAQLASVDIYMSRFRPMKYTLPGRDEHVMMKLVVDGETQRVV
    GVHMVGIEAAELVQCLAISVRMGATKDDFDATLAVHPTTAEELVLMRNKVR

    >gi|262199026|ref|YP_003270235.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haliangium ochraceum DSM 14365]
    MRSRSVTCLLGLVALLAAWTNAASAQPAPPSEPWLGVIITPGIRGVHVREVIEDSPADRADLMIGDEILAIGGTAVATPA
    ELVTALSAWTVGSELTATLWRSGRAARVAVVLDAKPGEGEILHRRLVGKQARRFRAPAIGSRGLFDLAGTRGRLVLLAFA
    GTS
    CDGCTTLHRTLSRFVDRHASAELSVVAISGESLAVLERWWQNFQPSFVMLRDVDGSVARNYYVNSEPTAVLIARDGS
    ILYIGIGAENMDIALETAERLLSRAVL

    >gi|262199086|ref|YP_003270295.1| thioredoxin [Haliangium ochraceum DSM 14365]
    MADSNVIELNDGSFDAEVTNSDTPTLVDFWAVWCGPCRQVAPIVSELAKDYEGKLKVAKMDIDHNQITPQKFGIRSIPTL
    LLFKGGEVVETIIGAMPKSKIEAKLTPHLG

    >gi|262199258|ref|YP_003270467.1| protein of unknown function UPF0061 [Haliangium ochraceum DSM 14365]
    MEDATQRASTLPLVEGPTLAFDNSFVRELPGDRVAGNHVRTVSGACYSRIDPTPVRAPETVAYAPEVAALLGLPEAFCVS
    PAFAQVFSGSARLPGMAPWAACYGGHQFGHWAGQLGDGRAISLGELIADGQRWELQLKGAGLTPYSRTADGRAVLRSSIR
    EFLCSEAMHHLGVPTTRALSLVRTGEDVVRDMFYSGDPRPEPGAVVCRVAPSFLRFGNFEILAARRDAALLGRLLDYAIR
    THFPALGTPCKAVYVAWMTEVCRRTAVMVAHWMRVGFVHGVMNTDNMSILGQTIDYGPYGWIDNHDPNWTPNTTDAHRRR
    YRFGQQPQVALWNLVKLAQAIELVVDDTAALEGALDSYQHSFEDAMHDTLAGKLGLREFDPSSDVLLVDALTGMLTDLEF
    DMTIFYRRLAALPCADAAGPNGDSAGDSDSAALLAHFEDAQYRPLSEREQQRALAWLRDYRARVRADGTPDGERAAAMNR
    VNPKYVLRNYMAQQAIERAEAGDAALVRELLALLRRPYDEQPQHQTWAGKRPEWARDRPG
    CSMLSCSS

    >gi|262199404|ref|YP_003270613.1| methylated-DNA/protein-cysteinemethyltransferase [Haliangium ochraceum DSM 14365]
    MSPSTKPSAQSAATPVAASPATPAATPATTIDEQRWRAVQTRDAASAGNFVYAVVTTGIYCRPTCPSRRPKRANVRYFAA
    PAQAEAAGFRACKRCRPTAPVSNSAELVSNSVDEIRRAAVTAACRRIEDADPVPPLKQLATELDMSESTLYRAFLDVLGL
    SPNAYAAGCRERRLRAELGAAPSVTEAYYQAGYGSSGGFYEHAARALGMTPSQYRAGAPEHAIRFAVGECSLGSVLVAAS
    ARGVCAIELGDDPQALIDAVQQRFARAELVGADAAFETLVARVVALVEHPAAEHGLPLDIRGTAFQKRVWAALSAVPAGR
    TISYAELAASIGRPRGARAVASACAANALAVAIP
    CHRVVRRDGSLSGYRWGVERKRALLARERARSAG

    >gi|262199418|ref|YP_003270627.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haliangium ochraceum DSM 14365]
    MSARSTALAAALVTALAAAGCGDTGTGTPAPETLEDLEFRAFVDSDGDGLSGNDTPTTIRLSEYFAANRPGTKIIMLNAA
    AGW
    CAPCMREASALPAFAAEYEPRGVVVLTAVFQDQNTQPADEAFAKTWADTFMLPVPTLIDTEFQTSRYFDANAMPANL
    FVDAETLEILTTATGAETGDDPMKEYRELLDFYLQ

    >gi|262199419|ref|YP_003270628.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haliangium ochraceum DSM 14365]
    MRRGLRALLMIALLASLGACGGAQSGASSSGPPDFALRDLDGRTVRLSDYSGKVVLLNFWATWCVPCSAELPHLQRLYEA
    YAPDLVILAISMDGPETVAKVGPQARRYGLSFPVLLDEETRVAGMYNPKRAAPFTVVIAADGRIASKRQGYSAGDEIALE
    AELKSLLTARAAK

    >gi|262199422|ref|YP_003270631.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haliangium ochraceum DSM 14365]
    MFSYVPYTIRSLSRVALPATIGLFALASGCANDSASSRLCGAGTVEQNGICVPAEPMGCGEGTVAVNGVCVPSSLEPGHF
    QNPLVQMQVLHGVGSHTDEIRLRDDGLLLNCSYTFNVIDATDANDLDLLSPSEGLRHDVPGSERAPGCKHLAWDEDLVFT
    THLGTIRNPAFLSGWDISDPEQPVQLALMQEPGISYEGVDVANHHIFVGLHENGLGVYTYDADEGFARVGGLGGFTNAWG
    VAARGDHVFVADGVGGLVTVDASDPGQPVELGRVVTGGQARYVVVDGDIAYVAAGSAGVAVVDISDLTKPTIITHIEMPG
    TALRLDVSENRVFVAAWNDVRVYDLSEPASPRFIAAVRIPRPFEYDDADRELPTMRIFGVAARGRDVFIGTWENPYSYRL
    EPERLAPNIRLPETSARVDFGPVAVGDKKTLAFEVTNQGTAPLTLVDTWIAGASFAVSPRRARIQPGESLQLTLSYTAST
    TDEELGYLNIVSDDPAAPVRVAYLVGNASGLSVGAPLPETAGTMLDGTSWSSSESEGYVLLLSYFATF
    CPVCANHLPDVQ
    ERIWQPYRDQGLHVVALNPRETTEQIDQVQVYADNIRVGFPLGIEDATSTYQAVTSNFPGPNPFPVDVIVDKSGIVRYVS
    HEYDPEAMLTMIEQLLAE

    >gi|262199668|ref|YP_003270877.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Haliangium ochraceum DSM 14365]
    MVVVPDDEHNRRLVDAVHPAEWRSPSADERPELYDLVVIGAGTAGLVSAGGAAGVGARVALIERHLMGGDCLNVGCVPSK
    ALLRCARAAAEARRASAYGVRTGEITVDFPAIMERMRALRADIAPVDGAARFRNRGVDIYLGDARFVSPREVYVSGAGEG
    HRLRFARAIIATGGRTAVPAIPGLEAAGYLTAETVFSLTELPARLLVVGGGPVGCELAQCFARFGAAVTLVQKADALLAK
    EEPDAAAIVAEQLISDGVTVHTGAELMRVDLDGDRDSDGSDGSASLTRLARLRTRAGEESVAVDAILVATGRRANVDGLG
    LDLAEVGFDTSGVHVDDRLCTRNRRIFAVGDVASAHKFTHAADAGARLALRNALFFGRQRMSALVIPRVTYTDPEIAACG
    LTAAEAEAAGVAIATYELTLGEVDRAIVDGETDGLVRVHVRRGSDTIVGATIVAPHAGELIGELSLAMSRGIGLGALGAV
    IHPYPTVALALRQVADQYMHTRFTPLVARILGWVLALRRR

    >gi|262199728|ref|YP_003270937.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haliangium ochraceum DSM 14365]
    MMGRTAKNNRLAASAAARWGTVGRGVLLALLTLFFASPALAEVGVGDRAPELVKAKDGRGKRVRLKAYKGKVVVLTFGAS
    W
    CKPCKRELPAWEKLARTYKGKDVVFVAVNIDKDTGKGKAFMKDAKLKAVRAAYEPSGGTVETYEPPTMPTTYVIDGRGL
    VRYRHTGYRAGDEKELAGKIDRLLR

    >gi|262199729|ref|YP_003270938.1| DSBA oxidoreductase [Haliangium ochraceum DSM 14365]
    MFFAISGLALGGASCDKQTTDPNAADDVVRAADRAEGKDAPAEDQKAAAAAAAHGHDHGDGHDHGHSHGGADEPMEIPDD
    LDTTPIAGVDLAKLDEEKTKRFYAHAATLPSPCGKAHSLRTSLTEDQSCKRAPFAARYVIELINDEASDTEVKNLYDAHY
    KDVEVKQVAVDSSDPHSGPTDAPVQIVEFYDYG
    CPACKVYKTIIEEAVKPFPNEVVVYYKQYPLPGHVHSKSAAQAALAA
    HEQGKFKEMHNVLFQKAPAHREAEVRSYAQALGLDMPRFEANYAAARAKVEADLADGNKVDVGGTPTIFINGRVYKGAGH
    PKYLGMWISEELAVNR

    >gi|262199746|ref|YP_003270955.1| selenide, water dikinase [Haliangium ochraceum DSM 14365]
    MARSPDDPPGRDEDAPAAASAAPSRQETAHRLTQYATGGGCAAKLRLGDLVQVLDGVAPAHAGRDADILIGSDHGDDAAV
    VRLPGDAASGRALVLTTDVIAPLVDDAESFGAIAATNAVSDVYAMGGRPLYALNLAFFPDQSLPLEVLRAILRGGARACE
    RMGVAIVGGHTVRDSALKYGLAVTGEVDSERAWRHEGGRAGQELVLTKALGTGVLGTAIKRGEASAADSAAAIASMSTAN
    RAAAEIGQRFAVSACTDVTGFGLLGHLRNIVRASAVDAELELDALPLLPGALEHARAGRVPGGSKANLAFLAPMLAGADE
    VDPALLALAADAQTSGGLLLCVAPEHSAAMLEALRASGLPAARVGRLQPQSDPQQARIALR

    >gi|262199773|ref|YP_003270982.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haliangium ochraceum DSM 14365]
    MLKEGNKAPAFRLPASTGETVKLSDYAGKIVVLYFYPRDNTPGCTTEAKDFQAAYGDLRELGAEVLGVSKDSIESHCKFA
    GKYDLEFPLLSDADGKVLEKYEAWGEKNMYGRKSMGIIRTTVVIGADGKVAKIFPKVRVKGHVDKVVELVRELAEA

    >gi|262199785|ref|YP_003270994.1| OsmC family protein [Haliangium ochraceum DSM 14365]
    MFERIEFTGAAGQPLEGRIYRPAARPVAWALFAHCFACAEDDHGAVRIAEALARHGFGVLGLDFTGQRVGEDAGAAARAL
    DIDDLLAAAAYLETQFHAPRLLVGHSLGGIAALAAAFALPTCAAVATVNAPAALTHLSDQSETNSDDPSNDAPSAGAEIQ
    IAGRRIQLGGSLTSALARHPVLERLRRLERALLICHTPSDRQVDIDDARQLYEAAKHPKSFVSLAGADHLLRDPADAAYA
    GDVIASWAARYAGVSELPEAEVEAGLVHLRGESSGLAQNIVAGRHRLRADEPLSIPGGEDTGPTPYDLLLSALGA
    CTAMT
    IRMYAKHKGWPLEDVEVELRHKKIHAEDCADCETKTGKIDRIERALSLRGPLDEAQRARLLEIADRCPVHKTLHGELRVI
    TWLDEGAPAAR

    >gi|262199801|ref|YP_003271010.1| Redoxin domain protein [Haliangium ochraceum DSM 14365]
    MTGKCLLGKHTYMDRNTVPNVTFKTRVRDESVGGENPFRWQDVTSDDLFKGKRIAFFALPGAFTPTCSSTHLPGYEQHYD
    EFRELGIDEVICLSVNDAFTMFQWAKHLGVKKVFMLPDGNGDFTRRMGMLVRKTNLGFGDRSWRYSMVVDDGKIEKMFIE
    EGGMDDCPTDPFAVSDADTMLKYLKENKK

    >gi|262200009|ref|YP_003271218.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haliangium ochraceum DSM 14365]
    MKNVALFGAVGLSAVALFVILSSSVSSDGGKVKLGVPSAEACTSTEPTKCLPHIDYLDKAGTAWTHDALAGKVVMVNFWA
    TW
    CAPCKAEIPALTAAYEHHGDEGFVLLGVMMDSDTVDDEALAAFNKATGLDYPVVPIDADIWTAFDAPDALPTTFIYDR
    AGTLRLHHRGPLSEPDLEAVLAELMAESAPQ

    >gi|262193880|ref|YP_003265089.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Haliangium ochraceum DSM 14365]
    MSEYDVIIVGGGPAGLAAALTLGRACRRVLLCDAGSPRNAAATHIHNFVTRDGTPPAEFRLIGREQLAPYASVEIQNLRV
    TSIAGERGGFRVTSSAGSARARRIILCTGMVDEMLDIPGFRDGWGHSIFQ
    CPYCHGWEVRGRRWGYLALDTFGLEHGFPA
    LLKNWSDDVVVFTAMDTDVPAELLDGLRQRGIRFEASRVARLAVDDRSLTHVELEDGTRVPCEVLYAHPPQRHVEFVQRL
    GLTLDELGYVQVDPLTRQTSRPGVYAAGDLTTRAQSAIFAAAAGAQAAGMLNHELSMEVTH

    >gi|262197159|ref|YP_003268368.1| hypothetical protein Hoch_3976 [Haliangium ochraceum DSM 14365]
    MDTSIPRMFSPSRPRPRRRSSTGRERGALLASALLLAACSRSSEEAKPPAETPPVADQDQTQTGAAAAGDAAACAKAKRE
    GPLRWFRDDYAAALACARAQGKPLFIDDWAPW
    CHTCLSMKHTVFIDPALAPYAERFVWLAVDTDKPDNAEVVGKFPPQVW
    PTFFVIAPADESIQARYLGAASLAQFREFLDEGERAYRESQGDALPADSPLGKLRDGDRAVVAGDWSAAATAYADAVASA
    RADWPRRPAALVSLISAYYKAGDSERCAALAEVEHAATGNSVSAADFAYYAARCAERLAEQGADAARVRALREQLLAHLG
    QVADDAGAPLATDDRSEALRVMRELALALGDKTRADALAERQRALLDQAWQSAETPLEAMTFAWPAAEVYDYLGAGAELV
    PKLEKLEAELPSQYDPPYRLAWVQHRLGQHEQALAAAERARDKLYGPRKANALRLIADIHAARGEREAVVAARQAVVELY
    ESLPEGQARPSALEDARAALEQAQAAE