Halanaerobium sapolanicus uid60191

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|312142575|ref|YP_003994021.1| dihydrolipoamide dehydrogenase [Halanaerobium sp. 'sapolanicus']
    MEKYDIGILGGGPGGYVAAIRAAQLGLKTAVIEKDVVGGTCLNRGCIPTKAYLKHTELIHELKRMDEFGIMVDGYSLDWK
    KMRERKNKVVSKLTGGIRGLFKKNGVDLIKGMGEVINEHEIKITGEKDSKIWVENIIIATGSAPIMPGLKGIDLPDVISS
    KEALDLDELPERIVIIGGGVIGVEMASIYSSLEVDVTIVEILDDILINFDKEMVKILKKSLKKHGVKLMTSSKVTEIAEQ
    DDELIVKIESEKADQIATDKVLAAVGRKPVFSGIENLNLERENGFIKVDAHMETSTAGIYAVGDVTGGMLLAHEASAEGI
    VAVKNIVGEQELRDNLIPNCVYSLPEIASVGMTEAEAKKEGYEIKVGRFPFMASGKAIAIGSEEGFVKIIADKKWDQILG
    AQIIGPHATDLIAEAAIAIKLESTAEILANTIHAHPTLSESVMEAAEDVNDLAVHF

    >gi|312142723|ref|YP_003994169.1| thioredoxin reductase [Halanaerobium sp. 'sapolanicus']
    MSEEKRKKEKLIIIGGGPAGITASIYGARAGLNPLVLVGPEPGGQITTTSELENYPGFPEPIGGFELTQKMTAQAENFDV
    RLEYESVEDLKPEGDNYIVKTDMEEYETETVIITTGAEPKTLGLEKEDKLRGNGVSY
    CATCDAAFFKEKDVAIVGGGDTA
    LWEATFLSKFASKVYIIHRRDKFRGAKRLGDRVKNLDNIEIVWDTEVKDLHGEDKLEGIRVFNNKTGEESDLDVDGFFVA
    IGHQPRTKCLNGFVELDDYGYIITDDKQRTNLEGVFAAGDVQDPDYRQVVIAAGSGAKAAIEAAEYLEEKHDKKAK

    >gi|312142739|ref|YP_003994185.1| OsmC family protein [Halanaerobium sp. 'sapolanicus']
    MPAVNFSVSANSENPTKVVVETPGGFKMTVDEPENLGGTNEGPNPVEYVLAALAGCLNVVGHMVAKEMGIEMRDLSFELN
    GDLDPAKFTGQSEEGRAGYQAINVEITADCDADEETLAEWIEVVEER
    CPVSDNLANKTPINISVK

    >gi|312142759|ref|YP_003994205.1| glutaredoxin-like domain protein [Halanaerobium sp. 'sapolanicus']
    MAKIDQEEKGKIKDLFSANLKDDVNLLFFAKENDCEYCEDTEEILSEVTALDERVNFEKHFLDSKKAAEFKVDKAPAIIF
    LDENDKDLGVHFYGIPSGYEFTSLIEDILDASDKSRIDFSKKIKEAVQAINFDVSLQVFVTPT
    CPYCPRAVRVAHQMAML
    NPKIKAAMIEAVEFEELSASYGVSGVPKTVINDGAAEQVGAVPAKTILKKLQSLAEDAAVAAE

    >gi|312142760|ref|YP_003994206.1| thioredoxin [Halanaerobium sp. 'sapolanicus']
    MTKAIEVTDVTFKDEVIGADKPVVVDFWAEWCGPCKMVAPVVEEIAQEYDDTIKVAKLNVDENQAVASQYGIMSIPTMLV
    FENGEVKDKLVGYMPKDKLVNKLGLK

    >gi|312142880|ref|YP_003994326.1| glutaredoxin 3 [Halanaerobium sp. 'sapolanicus']
    MNKSDIEIYTKQWCPYCRRAKAMLRSLELEYIDYDITDDKELYEEMVERSGHKTIPQIFIDGENIGGYDALIEKISSGEL
    DYLIDFEIPECEGNVWDLTVIGAGPAGMTAAIYAVRKGLKVLLVARDIGGQVLETDIIDNYPPEYNVSGPDLMQDFLDHL
    RNYKIDTLFGEEVIEIKVKEAGHQIIVKSGKKINTDAVIISAGTKKRHLGIPGESQLKDKGVSY
    CATCDGFLYEGQPVAV
    VGGGNSGLEAALDMARIAEKVYLLVRSERLSGDQTLQDKVMNSDKIEI
    CWSYQAIKINGDTKVESLLIKNLNTGKQRKLN
    VDAVFIEIGLLPNSGFICEDLKINDYNEVMIDQNNQTSVEGIYAAGDITDIKDKQIIVAAAEGAKAALRVNEYLS

    >gi|312143008|ref|YP_003994454.1| Methyltransferase type 11 [Halanaerobium sp. 'sapolanicus']
    MENKKEKIKQKVKQNYGEIINADQLGCCSGSSCCGEETGIGRTKIAQKIGYEKEALNSEFAEANFGLGCGNPRAIAALKE
    GETVLDLGSGAGFDAFLASREVGEKGKVIGIDMTEEMVEKARENAQKNGVKNVEFILGEIEDLPLADESIDVIISNCVIN
    LSTDKKQVFTEAKRVLKKGGRLAISDVLRAADFPEEIKADLDNYSS
    CVTGSIEEKELRTILTELNFKKINIERKSNSDQI
    VADWSSKLQLSNYIYSAYIGAEK

    >gi|312143029|ref|YP_003994475.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Halanaerobium sp. 'sapolanicus']
    MKKEVVIVGGSDVGISAALRIRELDQSLRPLIIADNKFPNFSICGIPFFLGGEVEKWQDLAHRKESDIKAAGIDLLLETR
    VEKIIPEENKLLAVNENGTQEIFYEQLVLGTGGINIEPPIKGLELDEVFFMRWMDDAISFDNFTKAEKPKKAVVVGGGYV
    GLEMAEALINRGLEVTLVEFLDSVLTTVNENFREKVKAKLEEKGVKIIVNTAVEKIEKTESGLKVLGSDGFKTEGDTVVV
    SVGTKPNTKLAEGTELKTNDTNGAFKVNKKLQTNIENIYAGGDCAETLNTITQEYAYYALGTVAHKHGRIIGSNICGKKV
    EFEGVIGTQSIKLFDLVVARTGLDEREAKKAGFEVQSTQIEAWDHKIYYPPAYRTYLKVIADEKTRKILGAQILGNIEAE
    ISKRIDIFATAIYNEMTIEEFSQLDLSYTPPLSSPWDPVQSVVQKLELKLEE

    >gi|312143143|ref|YP_003994589.1| dihydrolipoamide dehydrogenase [Halanaerobium sp. 'sapolanicus']
    MAEKYDIAIVGSGPGGYVAAIRAGQMGAKTVLIEKEVLGGTCLNWGCIPTKAFVRSAELFADIKEAESFGIKVEGAEVDF
    PAVVKRKDKIVKRLVAGIDHLLKKNGVERIEGKASFIDKNYLKVVGKKTTAIEAENIIIATGSVPSKLPIAGADLAGILS
    SRDVLDLKELPESMIIVGGGIIGMEFAFIFQNFGVDVTVVEYLDQLVTGVDTEIAKELNRSAKRRKISVKTGAEVKEIKE
    TAAGYEVIFEQKGKAKSIEGEKVLMAVGRRPYHEGLKTANAGVEISEKRGAIVVNNKLETNVEGIYAVGDVTDKVLLAHV
    ASHQGVIAVENIMGHDKEIDYTAVPGAIFTSPEIGTVGLTEEEAREKGIDYKVGAFPFAASGKVLAMGEREGKVKIIAEK
    ETGKIIGGAIIGIEASDLIAELTLAVNLGLKAEDLIETIHAHPTTAEVIHEAALGLKDGPIHFMS

    >gi|312143165|ref|YP_003994611.1| hydroxyacylglutathione hydrolase [Halanaerobium sp. 'sapolanicus']
    MFYKKISSKGLAHFSYLIGDENEAAVIDPRRDIDVYLKEAEKEGTEIKYIFETHRNEDYIIGSRALASVTGAEIFHADGQ
    LAYQYENTVEAGKKYKLGRLNLEAMHTPGHTKGSHSYILNDYDDQPWMIFTGDILFANDVGRIDFYGEENIPEIAALLYD
    SLYNKIMPLGDGVIICPAHGAGSVCGSQIADREITTIGIEKKSNPYLQYKSKEEFVSEVGEMEEKPQYFKAMEAANLEAP
    ARTELPFVKPLKPGEFEEKAAQKDYVVIDIRSESDFASAHVPSALYLRDNILASFIGWFMPTDKKILLVNDGSYPEETIR
    TLYRMGYEKIEGYLYRGMLSWNMAGKDSNSISAVNISEFCDFVKDKNKDEYLLLDIRKEEEKEEEGYLESAKEIPLNDLQ
    ADLNNYLAELENKKDIYVF
    CGSGIRSMTAASLINAHLEADVKVVLGGLTAWSASKCLLKIKK

    >gi|312143243|ref|YP_003994689.1| Peroxiredoxin [Halanaerobium sp. 'sapolanicus']
    MEEKKSMPLIGDQFPEFEVTTTKGKINLPEDYKGQWFILFSHPADFTPVCTTEFVAFQRRYDEFQELNTELIGLSIDQVF
    SHLKWEEWIENNMGDKIEYPIIADGTGRVAREIGLLHTASETATVRAVFIVDPESKIRAILYYPSELGRNMDEIVRMVKG
    LQKADKENVAIPANWPNNEVVGSNVIVPPANSAKEIELRKKQVESGELESFDWWLCHKKS

    >gi|312143373|ref|YP_003994819.1| Uroporphyrinogen decarboxylase (URO-D) [Halanaerobium sp. 'sapolanicus']
    MNGKELIFQVFESGKGDRLPWVPFAGVHAGKLKNYTAREVLEDEEKLFESLLEVNKIYQPDGQPILFDLQVEAEALGCEL
    MWEEDSPPTVKNHPLKDTDEIPTKIPQKDEARIPMAMEVTRKMKEAVGDHTALYGLICGPFTLASHLRGTNLFMDMITNP
    GYVKDLLGYTNKIAKKMASYYIKNGVDIVAAVDPMVSQISPAHFNQFLKEPYTELFAEIKDQDIFASFFVCGDATANIEP
    MCQTEPDNISIDENIPLEKAKEITDKYDIVLGGNIPLTTVMLLGNQQDNMKWVIDTLDKVSKENLILSPGCDMPYDVPIE
    NSIAVEQAVHEPEQVREMVKNYQAEEINTDAVELPDYENLDRPLIEVFTLDSAT
    CAACTYMKEAAMDVKEEYIKDIDVVE
    YKYNSKENIARITKVGVKQLPSIYINGQLEFSSIVPNKEELVEAIKKCQ

    >gi|312143405|ref|YP_003994851.1| protein of unknown function DUF395 YeeE/YedE [Halanaerobium sp. 'sapolanicus']
    MTQLIFAGRWSPYLVGTFIGVLSWLSFIISKKPLGTSTSYARVSSRLGALFLGDKVYDWKYYKQYKPVLEWQIMLVIGIV
    IGSFISAVLSGQFSLTFIPLTDFESILNQNILGRIFSAFSGGILLGFGARWAGG
    CTSGHGISGALQLSIASWISLISFFV
    GGVVTALLIL

    >gi|312143429|ref|YP_003994875.1| glutaredoxin [Halanaerobium sp. 'sapolanicus']
    MQELKLYYYPACPYCRKVTRFINKHDLKVNLKNINKDKEAARKLVEVGGKRQVPCLFIDGQALYESDDIIKWLKKNKLND


    >gi|312143431|ref|YP_003994877.1| heavy metal translocating P-type ATPase [Halanaerobium sp. 'sapolanicus']
    MDKEKQEEYQIDGLSCANCALKIEKEAQKIEGLDNVELNFAASTINVSGDSKRVSNLEQELQKISDRIESGIKIKKQDNN
    KEKKELNVFSLKEYLWIKKDLIIGAIIFFVALSISYTDYFRADFWPNLSLPLYLSAYLLIGWPVLRAALRNIGRGQLFDE
    NFLMTIATLGAFAINEYPEAVAVMLFYMIGELFQERAVNDSRRSIKDLMDIKAEYANLIKGDEIIQVDPEKIEVGAQIVV
    KAGEKIPLDGKIISGSSALETSALTGESLPREVESGDEVLSGMVNLNQLLTIEVTKEYNQSTVKKILDLVENASSKKAKT
    EKFITKFSRYYTPFVVGIAFLVAVLPPLLTGAAFNTWFYRALIFLVVSCPCALVISIPLGFFGGIGLASKNGILVKGGNY
    LEALNSVDKIVFDKTGTLTKGSFEVAEVKSHSSYSADELLNLAAEIEQFSNHPIALSIIDAAGSFENHSSNSQYEEISGA
    GIKAKLNGKTYLAGNKRLMENNNIKLEDHEKNATVVYLAEEGNYLGHILISDQIKEDSYEAIKKLKAMNITNITMLTGDN
    DSTAQDVAFKLGINHYYAELLPDQKIEKIESLLDKKGKLAFVGDGINDAPVLARSDLGIAMGALGSDAAIEAADIVLMTD
    EPSKIATALEIAKKTKRVVWQNIVMALSIKAIVMILSVFGLASMWAAVFADVGVALMALFNVMRILKS

    >gi|312143458|ref|YP_003994904.1| electron transport complex, RnfABCDGE type, E subunit [Halanaerobium sp. 'sapolanicus']
    MMAEKAKSLFHIFKNGLWKENPVMVLVIGMCPTLAVTNTGANGFAMGIATAFVLISSEIVISIIKNLIPSNVRIPSFILI
    IATFVTFTDYFVKAFFPTIAASLSIFIPLIVVN
    CLILGRQEAFASKNPTHKAIADSIGMSIGFTWVLTLLGIIREFFGMG
    SIFGLQLLGEWYRPMVIMLLPGGAFLTLGLMVGIYNHVSREG

    >gi|312143459|ref|YP_003994905.1| electron transport complex, RnfABCDGE type, A subunit [Halanaerobium sp. 'sapolanicus']
    MEEFSQILLLFISTILVNNFILVRFLGICPFLGVSKQIETAFSMGLATTFVMTLTAGATWLINTYILEAFNLPFLQYVSF
    IIVIASLVQFVEMFIKKTSPVLYKALGIFLPLITTN
    CAIMGLALLIPLNNYSFIASIVFGFGAGVGFTLAIVLMAGLREN
    LEFGDVPEALQGVPITLMIAGILALSFMGFAGMIAM

    >gi|312143460|ref|YP_003994906.1| electron transport complex, RnfABCDGE type, B subunit [Halanaerobium sp. 'sapolanicus']
    MNSIYFYSMISMGGIAALLAGGLGFAANHFHVEKDPRVAKIEDTLPGANCGACGYAGCESFAEAVAKGNAPVGGCPVGGD
    SVSSEIADIMGSENESSEKVVAELLCGGGLKETKKSGSYDGIKTCKAANQVNGGVKVCQYSCMGFGDCKVICPFDAIIMN
    DNGLPEIDPDVCTGCGKCIEECPRNILLLAPYKSKNHIRCSSHNIGKIVRKTCEVGCIACSL
    CVKACPVDAIEMKDNLAV
    IDYEKCVDCGICAEKCPTGTIEFQGERIKNVEINDNCVGCTLCAKACPVDAVEGEIKKLHKIDQNLCIQCGLCYEACNVD
    AVDLFYESDLD

    >gi|312143496|ref|YP_003994942.1| methionine-R-sulfoxide reductase [Halanaerobium sp. 'sapolanicus']
    MSNIIILLLTFLLVLSTINTVQAESQISFDQKMRNIETETATFALGCFWGPDASFGALEGVVRTRVGYAGGTTENPSYKA
    IGDHTETIEIDYDPEVISYRELLEIFFKSHNPFQRSYSKQYASLILFHNEVQKNMALEVKAELNAERSAEIKTNIKKLDE
    FYLAEDYHQKFRLQQSSKFKNHYLTKMSMEEFINSPAVTKANGYISGNGLKDNIIKNIGELGLSEQLQEELLELNDIDPA
    ECTSFCATQAADSVEINEAESDAELRERLTDLQYKVTQLDATEPAFNNKYWDNKEPGIYVDIVSGEPLFSSKDKFESGSG
    WPSFTKPLVDENIVEKEDNSFWMKRIEVRSKNADSHLGHVFNDGPQPTGLRY
    CINSAALRFIPVENLTEEGYSEFKELFE


    >gi|312143534|ref|YP_003994980.1| Rhodanese domain protein [Halanaerobium sp. 'sapolanicus']
    MIKDLIAGVFGKGVEKIDAEEVVEKDLKIVDLRNKKDYEEGHIPDSINIPYGEFKTDHPKLSEFDKDEEFCVACIAGISS
    QKITRLLNEAGYKNAKSLKGGIKSWSHDWVE

    >gi|312143535|ref|YP_003994981.1| putative glutamate--cysteine ligase/putative amino acid ligase [Halanaerobium sp. 'sapolanicus']
    MTSYNKLKDENSPYLKQHADNPVNWYPWGEEAFKLAKDKNLPIFLSIGYSTCHWCHVMEKESFEDEEVAQMLNQFFISIK
    VDREERPEIDSLYMDVCQTMTGSGGWPLSIFMTADKKPFYAATYIPKENKYGRKGLLTILPEIHYLWTEERKKLLQASEN
    IVSHLSKINQNQKAELASNIFEKTVEAIESNYDHQYGGFGSSPKFPMYQYLLFLLHYWKKTGEDKYLSILETTLQQMRAG
    GIYDQLAFGFHRYSTDREWKMPHFEKMLYDQALMIYIYTAAYQATAKEIYADVVKEIVSFLESEMLAKEGAFFTAIDADS
    GGEEGKYYLWEKSELKSILNEAQFNRLNKIFDIQANKNINLSLKNVQDYNQLAELKDKLLKHRKERIHPSKDKKILTDWN
    GLLIAALAKAGFVLKEDRYLKLADDVEKFIHNNMKTNKGRLAHSYYEGEKSKIDNLNDYSFLLWGLIELYQATLKDEYLI
    KAEKTAKIMKEYFWDQKEEAFYFSAKDNEDLFIKQINANDHSLPSANSIAAFNFLKLAHLKDNLAYQKDAQKIIAAFSDQ
    INKAPSNYIFLVLSNYYFNNPFIEIKIHGDKKYPLAQELIENIRDRYLPDYLIKQQKGDKNNKLSLCKDFVCGIPTDKLN
    DILKELN

    >gi|312143588|ref|YP_003995034.1| Thioredoxin domain-containing protein [Halanaerobium sp. 'sapolanicus']
    MKENLKKEVKSISNGKDFKKLLKKEEKLLVLFSNDSCGYCQMAENNIKKILDSFQGLTLYKLKLSDAPEIFEEYNIKSVP
    VTKVFIKQKAAYTAFGIRPPSDIYYQLKSFFKSSDSYFKELSKNN

    >gi|312143622|ref|YP_003995068.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Halanaerobium sp. 'sapolanicus']
    MEKHDLIVIGMGPAGMAVTAMAANMNLDVLAIEKHKVGGECLNYGCIPSKALLKAGEANEVTRNLKQYGIKLDAKTEIDD
    PLEVVRKKVNQISGAKTMKAFERANLIVDQGAAKFVDKKVIEVDGQKYTADKIFIAAGTRPMIPPIPGLKDVSRLTNLNI
    FEQKEIPEKLTIIGGGAIGSEMAQAFSRLGSEVNIFQIDNHLVPSGDEEAGRVLEEKFKKEEIGVFNSTGIDKVEEKNGK
    IITHTEKGIFESDEILVAAGREIYLEPLELGKAGIEYDQNGIEVNSRLETNVKGVYAIGDCNGISMFSHAAMHQGMLALM
    NAINPTPIKQFKYEDFVVPWSVFTKPEIAQAGMTEKEAEEKGLDFQVIKSKYGDYGRTIADGKPEGFVKVICSSKGKVFG
    ATIVGEAASELIQEWVLAIQHNLSMFDIMMTQHSFPTISLLNKRVAEKWMMGKTDSGIVTKLAKKFI

    >gi|312143639|ref|YP_003995085.1| glutaredoxin 3 [Halanaerobium sp. 'sapolanicus']
    MKKELKIEVYSKDWCPYCKKAKAFLKSKGLEFEEININEADNYEIMKKRTSNKTVPQIIINDKSLGGYDDIIELEKNGEF
    NQLIGRENIDYSEEEWELIILGAGPAALNASLYAARKGIKVLLLTKDIGGQVINTDEIDNYLGKAGTTGADLVYDFWSHI
    SKYDIKTVIGEKATAVNSKNGQKIIKTDNDKEYLTKTVIIATGAKKRRLGMKQEYVLSGKGVHY
    CTNCDGFLYAEQAVAV
    VGGGNSGLEGALDLAKIGCEVDLIEIEPSLMGDEYLQEKIYNSDKIEVHTSAKVSEINGEEKLQSIVVESLNDSSQKELD
    VDALFIEIGLIANSDFVSDMVKLNQQKEIIINEKNETSEKGIWAAGDVSNIMDKQIIISAAEGAKAALRVNQHLA

    >gi|312143647|ref|YP_003995093.1| methylated-DNA/protein-cysteine methyltransferase [Halanaerobium sp. 'sapolanicus']
    MEKKNYLTYYPSPIGILKIKFNNSALLRIDFEDKIREIKNNCRENFYQDKKVLKIYNMIFDQLNQYFMGERREFDLPLSL
    NGSEFQLKVWNCLQKIPYAKTMSYLELAKAIDKPAAARAVGQANNNNPISIIIP
    CHRVIASDGSLHGYADGIWRKKWLLE
    HEKRKTQKLRKEDYFCLRN

    >gi|312143951|ref|YP_003995397.1| alkylhydroperoxidase like protein, AhpD family [Halanaerobium sp. 'sapolanicus']
    MKEQEEFNQFREKMDKIILEEGDLNTRRFFNLDNSVYQTGELSSKYKELLGLTASLVLRCDDCIRYHLINAAEAGWTKKE
    IYEALNVGLIVGGSIVIPHLRRAAEILEKFDFNSEFKTETKNSNNKLTEVKKYQLYTDGACSGNPGPGGYAALILENDNQ
    ELEEISGSEEDTTNNRMELKAVIEGLKRVPKGSSVELFSDSTYVLKGLSKWIKTWKSNGWKTASKKNVANKDLWQHLDKL
    ISDYKLEFQKVKGHSGDEYNEKVDSLAKKEIKKD

    >gi|312143957|ref|YP_003995403.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Halanaerobium sp. 'sapolanicus']
    MHKINKELVVIGGGPAGLAAAKEAFDKGIKDIMVIERDMELGGILPQCIHNGFGVHHFKEELTGPEYAQRFIDDVAERNI
    EVKLNTMVLDVCKDKKVYAVNKDEGFSEIQAEAVILAMGCRERTAGAIGIPGTRPAGVITAGTAQRYTNIEGYVPGDEVV
    VLGSGDIGLIMARRMRLEGADVKAVCELLPYTGGLTRNVVQCLEDYDIPLMLNHTVTEIIGNGKLEAVEISEVDENLNPI
    PETAKIIKADTLLLSVGLIPENELSKKADVVLDDRTSGPIVNEGRETNIEGIFACGNVLHVHDLVDWVTQESEIAGDWAA
    KYIKGDYKRTDAEVDVKAGENVSYVIPQKIELESEDRKRIPLYMRVSTPLTAVDINLYADGKKLYSFSEPFAKPGEMISV
    PLAQKTLDGLDDLSEIRVDIIEKEGN

    >gi|312144029|ref|YP_003995475.1| heavy metal translocating P-type ATPase [Halanaerobium sp. 'sapolanicus']
    MSDKKITFAVTGMSCAACAQSVEKSLKNTEGITEANVNINTEKATVKFNEDKISIFELEKIVVNSGYGVKKQKLDLSIKG
    MS
    CTACAQAIEKSIKKIDGVIEVNINFATEKGHVEYFGDLTEKKDIIKAVKEAGYDVESDDISDAEDKVEHENQEMKMAQ
    KKLIYAFALTIPVFILMFGSLLGFSLPVPPFFQALIEAALAFPVVFILGYKTHKGAFNSIKHGGANMDVLITLGTLSAYA
    YGVSSFFFDLDRFFGLAAGIMAFHLLGKYLESKAKGRASQAIKKLMELGADTARVITGDQEKMIPVEEVGIGDIMLVKPG
    EKIPTDGEVIGGKSSVDESMATGESMPVKKLEGDEVIGSTINKQGVLKVKATKIGEDTFLSQVIKMVEEAQGSKVPIQAF
    ADKVTSYFVPTVIILSILTFLAWIIIGGTQEITTAVFASIAVLVIACPCALGLATPTALMVGTGKGAENGVLIRDGEAVQ
    TMKDITAVVLDKTGTITKGEAEVTDIITVGDFDEKEVLKLAGSAEKSSEHPLADAIVKKAKEKKIQLNETEEFNAVVGRG
    IKAVLNDKVILVGNQKLMELNEIDIKKLKDQIIELEEEAKTAMIVAYDGKAVGIIAVADTIKSDSVKAIKAFKDMGLKTI
    MITGDNARTARAIADQVGIEIIISEVLPEQKSNEVKKLQSQGEIVAMVGDGINDAPALKQANVGIAIGTGTDIAIESSDL
    TLVSGELSSVVSGLKLSRYTFSTIKQNLFWAFIYNTIAIPIAALGLLNPIIAAAAMTVSSISVILNSSRLKNKDISLS

    >gi|312144155|ref|YP_003995601.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Halanaerobium sp. 'sapolanicus']
    MGKKVIIVGGVAGGASTAARLRRMSEDTEIIMLEKGEYISFANCGLPYHIGEVIEKREELLVQTPEAMKARFNIDVRIMH
    EALDIDRKEKNLKIKNLETGNIYTESYDKLVLSPGADPIKPPLPGLDIEEVYTLRNIRDMDLIKEYIDNNEIKHAVVVGG
    GFIGLEMLENLHQRGLKVSLLELTDQVMRTLDKEMVSMVHNHMRTKGVDLNLSDGIAAVEKENGKKFALLQSGKRIETDL
    IILSIGVKPKTELAEKAGLDIGVSGGIKVNQYLQTSDPNIYAIGDAIEVKDFVINEPSRIPLAGPANKQGRIAANNITGR
    KEKYNGTQGTSIAKIFDIIPASTGAAEKKLKENDFNYQVVHITSNNHASYYPGALPMMLKLIYQKKDGRILGAQIVGFAG
    VDKRIDVLSTAIRHQMNIFDLQELELAYSPPFGSAKDPVNMLGFAAGNIYNGLVKPAFWQELDELDNEEIILLDIRENIE
    LELGQIPNSIHIPLNSLRDRLDELDKDKEYITY
    CAVGLRGYIAARILMQNGFNKVRNLSGGYKLYKAVMDDKNEVIEKEE
    EAELNSLLTPEDAEMIADLIIKNIRNK

    >gi|312144172|ref|YP_003995618.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Halanaerobium sp. 'sapolanicus']
    MKYKVGEKIPDFNLSDHTGETLSLEKFAGKNILLSFHPLAWTRVCRMQMESLEDNYQVFKENNTVPLGVSVDPVPAKKAW
    AEELGFENLKLLSDFWPHGTFASELGIFIEKKGISGRVNILVNDQGEILWSKVYDIHDLPDIDEVLKEVKANS

    >gi|312144364|ref|YP_003995810.1| redox-active disulfide protein 2 [Halanaerobium sp. 'sapolanicus']
    MEIRIYGPGCRNCVNLTKNAKKALEETGVEAEIIKVEDMQKIIEAGIMTTPAIGINGEVKIKGKVASVEEIVDLINATV

    >gi|312144382|ref|YP_003995828.1| Rhodanese domain protein [Halanaerobium sp. 'sapolanicus']
    MKLRKSLVVSTILLLLLLLASPFLAAEDRGYTHPEYLISVEELSENMDDENLVIIDVRNTAKYFLGHLPGSVQMWGDDFT
    DPDGWVPGLAATPEQFTATAQAKGINNDSKIVVYDDNNGLWASRLWFVFRYYGHDDVRLLEGGYDAWTDAGHNIRRLPTS
    VDTGNFTISDVKNDWIVDTDTVAENIDNQDFVVLDTRSESEYLGEDTNPGADRMGRVPGSVHIEWTQHLNEDNTFKTAAE
    IRELYEEHGITDDLDVIASL
    CHTAVRAAHSYLALEMIGYENVKVYDESWVGWANREDLPIETN

    >gi|312144420|ref|YP_003995866.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Halanaerobium sp. 'sapolanicus']
    MQKKSIIILIVVIAAAGAFIYFQNMGTGNELPERGTEVDKLAPDFQIEDLDGNEVKLSDYQGEKVFLNFWASWCPPCREE
    MPAMQELHEKRNEDITILAVNVGEDKAVIQSYLLENPYSFKILLDENRQVAQDYLVRGIPTSYFLDEDGVIINKITGAIS
    YQQMLELAEID

    >gi|312144441|ref|YP_003995887.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Halanaerobium sp. 'sapolanicus']
    MKIAVIGGVAAGTSAAAKARRTDPDAEIVIFEKGTEISYGGCGLPYYISGLIPDRDQLIAFTGEEFEDKYGVEVRLKHEV
    REIDSHEKMIYYKNLATGQDGAYQYDKLIIATGASPIKPPFEGFEKENIFVLRSVKDGDRIKAAANRDTTKKAVIIGAGL
    IGLEMAEAFTEMGLKTTVIELQPQVLPPFSQEMAKLVEKELQEKDVDLVLNDGVAAFKGGDKLEKVVTESGKEIEADLAL
    LSIGVKANSELAKKAGIEIGETGAIKINEKMETNLKDIYAAGDCAESKDLITGKAAWIPLGSTANKQGRTAGENAAGGSY
    SHSGIIKTGITKIFDLTAARTGLSKEEAEKNGFEVTEVKIKARNHAGYYPGADIINIKGVFANNDGRLLGAEVIGGDGSD
    KRIDVLVTAIQAEMTAADLFQLDLAYAPPYSSAKDAVAILGMVAEKKL

    >gi|312144625|ref|YP_003996071.1| protein of unknown function DUF395 YeeE/YedE [Halanaerobium sp. 'sapolanicus']
    MNGKSLLQRLTEKRAEAWDIAFKKPWPYWFGGILLAVVNIIYFAVSGEIWSITSGFARLGAWIISLFGVGVENWEAWQYY
    EYTLPWLDKYSWSNFGIIIGALIAILLAGQFKLKKIKNKKQFVTVLIGGWLMGYGARIAIG
    CNIGGLYTAFASLALNAWL
    YLPFIILGIYSGSKLLIKLIDY

    >gi|312144627|ref|YP_003996073.1| protein of unknown function DUF395 YeeE/YedE [Halanaerobium sp. 'sapolanicus']
    MKQQEYEQQNNWQLKLAVIIIIFSIYIYLYLSNSLEITLAKSWVFGLIVGFILQRSRICFTAALRDPFLFGLTKLSRALI
    LSTIIVSIGFAYIQYQQQLNGLPVQGKFVPLGWHIPIGAFVFGLGAAVSGG
    CASGTLTRLGEGYKLQWVVIVGFIAGSVH
    GSYDASFWYQLIRSQKTTHLPQLVGWGNALVLQIIFLLFLYLLSYWWEKHKF

    >gi|312144629|ref|YP_003996075.1| Rhodanese domain protein [Halanaerobium sp. 'sapolanicus']
    MEKKTIIVLLVAVLIIGGGLFYESTLYTDLEIDMENYVPIEERGYENTDSLISAMELNEIKGNDDVAIIDFRRADAYSMG
    HIPGAIQVWRSDVTDPDHEYAGMRISHEGLAEWLGENGISHDDTVVVYTSGGGHDATRMWWMMTMLGHEDVRILDGQLDF
    WRALDYDIALSSPGRDAVEYEMGEVDESMLVDADDILAAIDDDDKNIVDTRAEDEFTGAEKLNPAERAGRIPTPIWIEWT
    ENLNDDNLIKTADELREIYEEQGVTPDKAAYNY
    CQSGVRSSHTTFVLSQLLGYEDVANYDGSWIEWSSREDLPIETDQ