Hahella chejuensis KCTC 2396 uid58483

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|83642983|ref|YP_431418.1| hydrogenase expression/formation protein HypE [Hahella chejuensis KCTC 2396]
    MSLDPDFRHGCVELIHGGGGRAMRRLIDALFLQAFDNPLLRAGDDQACFQVAPGRMVMTTDSHVISPLFFPGGDIGALAV
    HGTVNDVCMAGAVPLYLSAAFILEEGFPLSDLRRIVLSMAEAAREAGVAIVTGDTKVVERGKGDGVFITTTGVGRLPENV
    SCSVARVAIGDRILVSGCLGDHGVAILSQRENLEFEADLRSDSQSLHDLVATMIAVDPGLHCMRDPTRGGLAATLNEIAQ
    QAQVGMRLRENAIPVRQEVRAACEFLGLDPLYIANEGKLIAFCAPEQADALLQAMRSHPKGRDAAIIGEVIEDPRCFVRL
    RTGFGGERVVDWRSGDPLPRIC

    >gi|83643011|ref|YP_431446.1| sulfurtransferase [Hahella chejuensis KCTC 2396]
    MFTCSPRNLAYIVFLLFTLSAYAEEDEFPGRRQYPAVDFIELQEFYQQLAAGEIVAVDVRTDYEYNTLHIKGAFNVSYTS
    HNFAEEMQALQKQHPGKKLALYCNGKT
    CLKSYKAASKCRKYGIENVIVYDAGVFDYAKAYPQDTNLFGEVLGDPGRLIGK
    DKLKAHTITVAEFEDKIIKTDGIVLDVRDKQQREGIAIFFMREKRAPLDRPDLIDRYINQAKKRNVPLLIYDQAGKQIRW
    LQYYLEKQNVSSYYFMAGGIDEYYKTL

    >gi|83643021|ref|YP_431456.1| glutathione peroxidase [Hahella chejuensis KCTC 2396]
    MPKILKPTLLSLLLCQSASTLAGCPALLDGEVKKLHTSQTINLCERFVGKPLVIVNTASYCGFTPQFKGLEAMYKRYQEK
    GLEVIGMPSDDFNQEDDDAEKTAEVCFVNYGVTFTMTDAHPVKGPNAHPLFRNLAEQTGQPPQWNFHKYVVDKEGRVVAA
    FPSRTTPEDADFIAAVESVL

    >gi|83643061|ref|YP_431496.1| dihydrolipoamide dehydrogenase [Hahella chejuensis KCTC 2396]
    MQTRKVDVAIIGAGTAGLGAYRAAREHTQNVLLIESGPYGTTCARVGCMPSKLLIAAAEAAYHHRHSDLFGVASNNPHID
    GRKVMERVRNERDRFAGFVVDSVEGFPAEHKVRGKAKFISPHRLQVDDDLIVEAQRIVIATGSRPNTPPFLKNAGDRLII
    NDDLFEWRDLPSSVAVFGPGVIGLELGQALSRLGVRVRMFGVGGAIGPIQDPDIRAYAERIFNREFPLDPDAKVSSVKRT
    EQGVAITFQDKEQGEITETFEYVLAATGRRPNVDNLNIEKAELQMDARGMPVFDRYTMQCGDSHIFIAGDANNDLPLLHE
    AADEGRIAGDNAGRYPDIRAGKRRTPIGVVFSDPQIAFLGLNINQVKERCRSCYAEGVVSFEDQGRSRVMGKNLGLLKVY
    GEQGTGLFLGAEMFGPAAEHIAHLLSWCVQQRLTVSQILEMPFYHPVIEEGVRTALRDLNSKLHLGPDVIERCLDCGPGA


    >gi|83643062|ref|YP_431497.1| peroxiredoxin [Hahella chejuensis KCTC 2396]
    MLQSREGQTVPSVTFNLREGEKWVQVTTDDLFKGKNVIVFALPGAFTPTCSSTHLPRYNELAPVFKQNGIDAIICLSVND
    TFVMNSWKADQKAENIYFLADGNGEFSAGMGMLVEKSELGFGKRSWRYSMLVRDGVIEKMFIEPELPGDPFKVSDADTML
    NYINKEAVLPNRVTVFSKPG
    CPHCARAHKLLNDRGISFENIVLGANGLSYSTLQAVTGQGTTPQIYIDGQRIGGADDLEA
    HFGV

    >gi|83643144|ref|YP_431579.1| selenide, water dikinase [Hahella chejuensis KCTC 2396]
    MQDASIKLTEFSHGAGCGCKIAPAILDRILLSHLPSINDPRLLVGNASKDDAAAYDLGDGRIILSTTDFFMPIVDDPFDF
    GRIAAANAISDIYAMGGEPLMAVAILGWPVNTLSAEVAQRVVEGGRHACHEAGIMLAGGHSIDAPEPIFGLAVTGSTAHT
    HLKRNDTAVDGCLLYLTKPLGVGVLTTAQKQKKLQPEHAHLALEQMCALNKVGAKAAGLAEVCAMTDVTGFGLMGHLLEM
    CEGAGLQAQIRYEAIPRLEPVLDYIRLGCVPGGARRNFDSYGERLGAMTEEQRLLLCDPQTSGGLLIAVAPEGRNALERI
    LKDAGIAPALIGTLQAYRDGPRIEVM

    >gi|83643187|ref|YP_431622.1| thioredoxin [Hahella chejuensis KCTC 2396]
    MSSRIVNVTDDSFESEVLKADGPVLVDYWAEWCGPCKMIAPVLEEIAEEYGDRLKICKLNIDENEKTPPKFSIRGIPTLM
    LFKNGAVDATKVGALSKSQLTAFLDSNL

    >gi|83643217|ref|YP_431652.1| thiol-disulfide isomerase-like protein [Hahella chejuensis KCTC 2396]
    MALTSSTMLALGSRAPNFNLSDTQGRHWSLADFSDDPALLVMFICNHCPYVIHLKTALADFARDYAAKGLGVIAVNANDA
    SAYPADSPENMALEVARYKYVFPYVYDETQEIAKAYHAACTPDFFLFDAQRRLVYRGQFDDSRPGADKPVTGKDLRQAVD
    ALLNGGEIASDQRPSMGCNIKWRDA

    >gi|83643388|ref|YP_431823.1| glutathione peroxidase [Hahella chejuensis KCTC 2396]
    MTTLYDFTLKDIHGADLPLEQFKGRTLLLVNVASECGLTPQYEELQSLYEERKDDGLVVLGLPCNQFGGQEPGDEAAIHE
    FCSTRFQVSFPMTSKTEVNGPGRSPLYQWLIGDGEDIRWNFEKFLVDGEGRCVARFDPRTPPSDEELLDKIDEQLHLSKI
    LLGK

    >gi|83643417|ref|YP_431852.1| sulfurtransferase [Hahella chejuensis KCTC 2396]
    MSQYVICALYKFVALDNFEALRAPLLEVMEKNEVKGTLLLAREGVNGTVSGTREGMDALLAWLKSDPRLADLSYKESYDE
    NIPFYRTKVKLKKEIVTMGVEGIDPKRVVGTYVKPQDWNALITDPEVLLIDTRNDYEVQIGKFKNAINPNTETFREFPDY
    VKSNLDPAKHKKVAMY
    CTGGIRCEKSTAYLKELGFEDVYHLEGGILKYLEDVPQEESTWEGECFVFDNRVAVDHSLNKGS
    YDQCHACRMPISAEDMQSEHYKKGVSCPHCYDKVSEDQLRRFAAREQQIELAKSRGEEHIGSEAAKAIKKRQAEKKLKRK
    NYHQHLTQGAE

    >gi|83643516|ref|YP_431951.1| hypothetical protein HCH_00624 [Hahella chejuensis KCTC 2396]
    MKPKISIRYCPLCGWLLRSAWMAQELLTTFTDELQEVALVPAGKGEFKILCDDEIIWDRSANEGFPDVATLKQTVRDAAC
    PDKSLGHIDKSRNKG

    >gi|83643755|ref|YP_432190.1| dihydrolipoamide dehydrogenase [Hahella chejuensis KCTC 2396]
    MAGQTTHSQVVVLGSGPGGYSAAFRAADMGLEVTLIERYSSLGGVCLNVGCIPSKALLHVAYVMEEAHSASAVGVTYAKP
    EVDLDKVRAFKDNTVKKLTQGIQGMAKGRKVKVVYGYGEFAGPNQITVDNDGVKTEITFDHCIIAAGSQSVKLPFIPHDD
    PRVLDSTSALELKEIPKRLLIVGGGIIGLEMGTVYEALGSEVSIVEFADQLVPAADKDLIAVYSKFVKDQFNVMLSTKVT
    AVEAKKDGLYVSFEGKNAPEGQQSYDAILVAVGRSPNGKKIGAEKAGIQVDERGFINTDNQQRTNVPHIYAIGDIAGNPM
    LAHKATHQGHVAAEVIAGHKCVFDPKVIPSIAYTNPEIAWTGLTEKEAKAAGIPYKTAVFPWVASGRALGAARSEGKTKL
    IYKEDGTLIGGGIVGINAGELLGELSLAIEFGADVEDLALTIHAHPTLHETVGLAGELAAGTITDLPNPMAKIKKS

    >gi|83643873|ref|YP_432308.1| protein-disulfide isomerase [Hahella chejuensis KCTC 2396]
    MATQKKPVPALYIGVIMFALGLLIATLLHSARFTQGALSAPAAGDSLFTLQGQEYNPEQLQYAEAAALFELEQQVFERKS
    QILENAALQVHFQNLAKARNVSKEQIRDELIEVKPVTDDEVSQFFEANKQQIQRPFYEIKDAIKDALQKDRIQRAEHGLI
    ENLKKQGQLSINLKEPHAPVADLQLEGYPVRGNAQAAVSIVEFADFR
    CSHCKHASHTLRKIVAAQSDNVRWTMVDFPVTG
    KTSVYLAQAAYCAGKQNKYWEFHDALFDYDGKLSEASIAGVAESLGLDAAKIEECASSPEAVQFVEKEQSQAIELGLRGT
    PAIFINGLPFHGDNLEAVLEEAVNAAVARSRAG

    >gi|83643878|ref|YP_432313.1| mercuric reductase [Hahella chejuensis KCTC 2396]
    MKAKRLGLLLLLALLIGAFFLFDFNRYFSLEYFAEQREAISAYTTANPLTAAAIYFIVYVVVTGLSLPAATVLTLVGGAV
    FGLFEGTLLVSFASVIGSTIAFLVSRLSLRDWVQDKFGDSLQAINAGVEREGAMYLFGLRLVPLFPFFVINLVMGLTPVK
    ARTFFWVSQLGMLPGTIVYVNAGTQLGQVQSASGILTPGLIASFVLLGIFPFIARRILDALKSRKALAGVDKPAHFDRNL
    VVIGAGAAGLVTSYIAAAVKAKVTLIEKHKVGGD
    CLNTGCVPSKALIRSAKIANYVERASEFGVQVSSPEINFAAVMERV
    QSVIKQVEPHDSVQRYTSLGVECLEGEATILDPYRVKVNGQVLTTRNIVIATGARPFVPPIPGLDLVEYYTSDTIWSLRD
    KPERLLVIGGGPIGCELSQAFHRLGVKVTQLDMSPRLMPREDTDVSAAVEARFRNEGIDLRLGYSAKAFKRNASGASLLI
    CEKDGEEVELTFDKVLLAVGRRANTSNLGLDKLGIGVNKDGTLQVNEFLQTEIPTVFAAGDVAGPYQFTHTAAHQAWYAA
    VNSLFGVLRKFRADYRVIPWATFTDPEVARVGLNEQDAIARNIPYEVTRYGIDDLDRAIADSEAHGFIKVLTVPGKDKIL
    GATIVGHHAGELITEYITAMKHGIGLNKILGVIHIYPTLSETNKYAAGEWKRAHAPQKTLQWLEKWHRWRRKSETDMNSA
    LGRSNNEV

    >gi|83643891|ref|YP_432326.1| thiol-disulfide isomerase-like protein [Hahella chejuensis KCTC 2396]
    MTLGLVALAARAETYVEGQHYKTLPAPIPVRDASKIEVVELFWYGCPHCYKFDPLVNVWKKSLPEDVSFFRSPAVFNKVW
    KAHAQAFYAAEALDVSEKMHQPLFDALARDHQSLNSEDDLAKFFAQYDVEEAQFKKAYNSFSVKSKVEQAASRALSARAT
    GVPALVVNGKYRIDAIRGGTYEDMLKVADFLIEKERQAKGS

    >gi|83644117|ref|YP_432552.1| thioredoxin domain-containing protein [Hahella chejuensis KCTC 2396]
    MAESPYIIEATLENFQTEVLEKSMQVPVLVDFWADWCAPCKQLMPILEKLATEYQGAFILAKVNADQQQELASHLGVRSL
    PTVKLVHQGKLAGEFSGAQPESKVRELLGRYIQSPGAELREQARALVEQGQAAQALAMLTEANQADPNNMEILVDIAAVK
    VALGEKDEASTILSSLPADIQGRPDVKQLLARIRFVEKAGAIAPLADIQQRLQANAADAEARFQLALHAIMNNKFEDAVE
    ALLNLMQTDRSYGDDAARKTLIELFDMLGAAHPLVRTYRRKLYALLH

    >gi|83644170|ref|YP_432605.1| thioredoxin [Hahella chejuensis KCTC 2396]
    MSAFVKHISDADFKDVVINSDKPVLVDFWAEWCGPCRAIAPVLDELAEEMADDIQVVKVNVDDNQAVAGAMRIRSIPTLI
    VFKNGKAVANHSGAVGMAQLKNFVAQAI

    >gi|83644209|ref|YP_432644.1| GrxC family glutaredoxin [Hahella chejuensis KCTC 2396]
    MAQFKPVTIYTTEFCPYCIRAKRLLEAKGASFEEIKVDFNAALRQEMMQKSGRRTVPQIWVGEEHVGGCDELYGLERAGT
    LDALLQSGASDESVSPS

    >gi|83644212|ref|YP_432647.1| redox protein, regulator of disulfide bond formation [Hahella chejuensis KCTC 2396]
    MNVLYKAAVTSTGGRDGHAKSSDGVLGVRLTTPKELGGAGGAATNPEQLFAAGYSACFIGALKFVASQQKSALPADVNVR
    AEVGIGQIPGGFGLDIDLFIELPGLDLEAARALVDQAHQV
    CPYSNATRGNVDVRLHVAN

    >gi|83644263|ref|YP_432698.1| hypothetical protein HCH_01411 [Hahella chejuensis KCTC 2396]
    MSAQTFTPEVGLRITDAAAEHIRKQLRQHPDAQGFRLGLKASGCSGFKYIVDLVKTPSDDDRKFVLADDIPVYVDAKSLP
    YINGAEIDFVKEGLNYAFKFNNPNVDSSCGCGESFSIKEDA

    >gi|83644451|ref|YP_432886.1| peroxiredoxin [Hahella chejuensis KCTC 2396]
    MASITLKGNPVETKGDLPAVGSSAPDFTLVKPDLSEATLKDYAGKRLVLNIFPSVDTPTCATSVRMFNEKASKKDNTAVL
    CVSADLPFAMARFCGAEGLQNVDNGSVFRNAEFGDRYGVTVMTGPLKGLLSRAVVVIDESGKVLHTEQVAEIADEPNYEA
    ALAAL

    >gi|83644571|ref|YP_433006.1| molybdopterin biosynthesis protein MoeB [Hahella chejuensis KCTC 2396]
    MRDEMNDTLLMRYNRQIMMPDFDIAGQEALRNSSALVIGLGGLGCPAAMYLGAAGCGRMVLADFDAVDLSNLQRQIAHRE
    QDVGVNKAESVRRALADINPDVRVETITQPLQDELLAAAVSDVDVVLDCTDNFATRSAVNEACVQYGKPLVSGAAIRSEG
    QLAVFDPRRDDAPCYHCLYGMLSEQQLT
    CSEAGVMAPLVGVIGSLQALEAVKILSGYGDVCAGRLLLFDGKTMQWREFKV
    RKDPSCAVCG

    >gi|83644599|ref|YP_433034.1| glutaredoxin-like protein [Hahella chejuensis KCTC 2396]
    MDVIEVIKEQLTSNPIILFMKGTPNAPQCGFSARTVQALMACGEKFAYVNILEHPEIREALKTYSNWPTYPQLYIKGELV
    GGCDIVAELYESGELQGMVKGAAVAE

    >gi|83644611|ref|YP_433046.1| protein-disulfide isomerase [Hahella chejuensis KCTC 2396]
    MHVMRPFVLVLMALSVAFGARADEQQEQAVKVIKQRLAEAVPGLKILKVSPSPIPGVYEVESNNPQLLYTSADGQYFVAG
    DIYQVSEGRITNLAERRREETRAELVNSIDESKMIVFKPEVVKTSITIFTDVD
    CGYCRKLHKEVPRLNELGVQVNYLAYP
    RAGVGSGSYQKMVSVWCADDQQAAMTEAKLGKTPSSKDCKNPVADQYNLGNQIGISGTPAIVLHDGRLIPGYVPADSLAK
    GLGLEVK

    >gi|83644685|ref|YP_433120.1| arsenate reductase [Hahella chejuensis KCTC 2396]
    MSTNTLTIWHNPRCSKSRQTLQIIEDSGAEPAIVKYLETPPNAAELKAALSKLGISARDLLRKGEEEYKTLNLANADLSE
    DALIDAMVAHPKLIERPVVIKGDRAVLGRPPENVNELL

    >gi|83644687|ref|YP_433122.1| thiol-disulfide isomerase-like protein [Hahella chejuensis KCTC 2396]
    MIARQISSRLFQEVSNYPSSLRCVFFKALAAGLILILVTGCSEDKSDAPLENVVALADGGEINLEHLGGQWIILNFWAEW
    CGPCKVEIPELNEINRHPGVIVLGVDYDGHKGEALTKTIDKMGINFPVLQGDPTRHWKVEIPKVLPTTLLIHDGKVQREM
    IGAQTKSAILSVIPQ

    >gi|83644715|ref|YP_433150.1| electron transport complex RsxE subunit [Hahella chejuensis KCTC 2396]
    MAKSYQEIVRDGLWKNNPALVQLLGLCPLLAVTGTVVNAIGLGLATTLVLTGSNAAVSMIRNYVPESVRLPAFVMIIASF
    VTCAELLMQAFAYELYEILGIFIPLIVTN
    CAILGRADAFASKNPILPSMLDGFMMGLGFSLVLIVLGGMREIIGQGSLFS
    GMDLLFGESARSWKLELFADYSDFLFAVLPPGAFVGMGLLIALKNVIDKRMKEAAAAKLEKPVSGGKRVRVTGKIS

    >gi|83644720|ref|YP_433155.1| Na(+)-translocating NADH-quinone reductase subunit E [Hahella chejuensis KCTC 2396]
    MTEYLLILVSTILVNNFVLVQFLGLCPFMGVSNKLETAMGMSLATTFVLTLSSLCSYLAYEYLLAPLGMEFLKTITFILV
    IAVVVQFTEMVIKKTSPLLYRVLGIFLPLITTN
    CAVLGVALLNIKKQNDFMESILYGFGAAVGFSLVLTLFSAMRERIAA
    ADVPEPFKGGAIGMITAGLMSLAFLGFTGLVNI

    >gi|83644872|ref|YP_433307.1| soluble pyridine nucleotide transhydrogenase [Hahella chejuensis KCTC 2396]
    MSDFDIVVIGSGPAGQKAAVQAAKAGKQVALIERDALLGGACVHRGTIPSKTLRENALRVNNMRKNATLFQFKLSEDLEM
    ATLIDRLDDVMKSHDEYMRRQIDRNAIKRIHGRARFLSPNEVEVTSVRGKKQVLNTDYVVIATGSFPRKPEQVPIDHENI
    FDSDSVLSMLYLPKSLAVLGGGVIASEYASIFQALGVRVIMIDRYPRPLGFLDKDLTDNFVNAFQDMGGVWMGNSVVKKV
    CFDGVNDVITELEDGRTIITQKLLCAAGREANVKDLDIDNAGLALDERGVIPVDGQLRTRVPNIFAAGDVIGPPSLASAS
    MEQGRRAACNVIGLEVGSMPEMIPVGIYGVPELSSVGMTEQEARKAHGQIIVGRAPFSEIARGHISGNQDGMLKLVCDAE
    GRRLLGVQIVGEEATELIHIGQMALLSKSDVDIFVESIFNFPTLAEAYRVAALAVIGQRARRNSVY

    >gi|83645059|ref|YP_433494.1| peptide methionine sulfoxide reductase [Hahella chejuensis KCTC 2396]
    MFGSHSQDKASMPAREQALPGRAEPMEIEGEHFVFGVDMRGPFPAQMQTAVFGLGCFWGAERLFWKQEGVYSTCVGYAGG
    YTPNPTYKEVCTGQTGHAEVVQVVFDPAVISYKKLLKLFWENHDPTQGMRQGNDVGSQYRSAIYYANDEQKQLAEASKAE
    FQQSLHDVNRGAITTEITPAPEFYFAETYHQQYLAKNPGGYCGLGGTGACLASAD

    >gi|83645085|ref|YP_433520.1| copper-translocating P-type ATPase [Hahella chejuensis KCTC 2396]
    MSEAEKCYHCSNPVPASLNLNINVGGEEYAVCCRGCQAVANLIHNDGLQQFYRFRDNRLEAPEPISSLDRSKYALYDRDD
    VLSSVATQPTSDGKRSLSLSLEGIT
    CAACVWLVEQFVRKLPGVDEFWVNLSNHRAALTWKQDATPLSEVLLQLQSIGFRG
    YPFSATEEEKRLADEQKTMLVRLGVAGIGMMQNMMLAVPMYFGLLQDTPEYVDLFRFISLIVAMPVILYSARPFFKAALR
    DIRLRHLTMDVPVSLAIGGAFAASAWITFRGGPEVYFDSVCMFTFFLLLGRYLESRARMSAAQSNARLKQKAPQFVDLLP
    SQGAQGSQIDLTRAQLTPLRDIRVGDLILFKAGDLIPVDGEIVQGESSVNEAALTGEFMPRPRCTGDAVLSGSVNIDNSL
    VVRVTALDQDSHLSTINRLVERALQERPQLSAMADKVASYFVAGVLLTAAIVGFIWWRIDPAHAFAITLSVLVVTCPCAL
    SLATPTALTTATTALRQSGLIITRGHALETLARASRIVFDKTGTLTQGELNLVKIDNRSSYSDAELLALAGSLEWDNPHP
    IAKAFQGYAQEPAQQIRNHTGQGVEGEHNGSRFRLGSLKFAIEKLPQSQNVAPENYQTVALADEKQLLALFYLTDSLRPS
    AKEALRQLQQEQGLRTAILSGDSSAAVETIASALAVTDTEKSCSPEGKLERVKQWQQEGDTVVMVGDGVNDVPVMAGAHL
    AVAMNNATDLTQVRADAVILNGDLRTFAFGVKKARDAYRIIRQNLSWAVSYNLLALPLAAAGYVPPYAAAIGMSVSSLIV
    VLNALRLSGVQKP

    >gi|83645097|ref|YP_433532.1| thiol:disulfide interchange protein [Hahella chejuensis KCTC 2396]
    MPQLLRALFILTLFCCATVRAESNLFGDNNGFLAEPEFLPVEEAYRFTSSVEGDELVLHWAIADGYYLYKDRTSVTTDAE
    GVAQGRWTYSSPGEEKEDPYFGMVYVYHDELTIRVPVAAEEGAEVEFKVRYQGCAEAGLCYPPQTETALFTGTDSDSISP
    AATTNDSTQSPSPSTGQSGSSTSSSVPGPSKAADVDFTSSTSITDYLVAQGLLFSFFILMAVGIGLAFTPCVFPMVPILS
    SIIVGQKEVTMLHSFVLSLSYIMGMAAVYTALGAVAGHFGELGQDANIQAQVQKPWILITFSGLFVLLALSMFGFYELQM
    PSFLRDKLSGMNTKQQGGEIFSVFIMGLLSALVVSPCVSAPLIAALGYAAYLGSAFKGGVALFGLSLGIGLPLLILGTGG
    AKLLPRAGAWMEHVKHVFGVALLGVAIWMLERILPPEATLTLWAVLIGVSAVYMGAFTNVESGWSGWQKLNKGLGLVFFV
    YAVTLMLGAAAGANDPLRPLAPYAIKSAVAANGGPAAQALTFVKVTSPEQLDREVAQAAATGKPVMVDFYADW
    CISCKIM
    ERETFVLPEVQSGLSRFHLVKADVTDNDQGNQALLKRYGIFGPPAFVFFNAQGKELESKRFLGEISKNALLNHVKDI

    >gi|83645115|ref|YP_433550.1| peptide methionine sulfoxide reductase domain-containing protein [Hahella chejuensis KCTC 2396]
    MDKVKKSDQEWRQQLTDEQYRVTRGKGTERPFTGEYYDTKEAGVYVCVCCGEPLFTSENKYDSGCGWPSFWAPMDKEKIT
    EEIDMSHMMVRTEILCSKCDAHLGHVFDDGPQPTGQRY
    CVNSASLRFHSADGDAKQEDE

    >gi|83645117|ref|YP_433552.1| glutathione peroxidase [Hahella chejuensis KCTC 2396]
    MSVYDYQVEDIKGAKRDMSEFKGKVLLIVNTASKCGFTPQFSGLESLYEKYKEQGLEVLGFPCNQFMQQDPGENAEIAEF
    CQLNYGVSFPMFAKIDVNGDSAHPLYKFLKSQSKGLLGTEAIKWNFTKFLVDKNGKVLERFPPTATPEKLEKPIKELLA

    >gi|83645157|ref|YP_433592.1| thioredoxin-disulfide reductase [Hahella chejuensis KCTC 2396]
    MSKETRHIKLLILGSGPAGYTAAVYAARANLNPVIITGMQMGGQLTTTTDVDNWPGDDAGVQGPELMQRMQKHAERFDTE
    IIFDHINETDLSQRPFRLKGDNGEYTCDALIIATGASAQYLGLDSEEAFKGKGVSA
    CATCDGFFYRKQKVAVIGGGNTAV
    EEALYLSNIAAEVTLVHRRDKLRAEKILQDKLFEKEQNGNIKIIWDHTLDEVLGDDSGVTGLRLRSTKDDSTQELEVTGV
    FIAIGHKPNTDIFAGQLDMKDGYIKIRSGSEGAATQTSVPGVFAAGDVADHIYRQAVTSAGFGCMAALDAEKFLDQ

    >gi|83645379|ref|YP_433814.1| thiol-disulfide isomerase-like protein [Hahella chejuensis KCTC 2396]
    MKTKFFKSVAALCFVLSASVLSLGAGAAEIKGPAADFTLKSSLGKNLRLQEYRGQVVLINFWASWCGPCRQEMPILEDIY
    KKYEKFGFTIFAVNVDEDSSLANEFLKDTKVTFPILYDNQNKVSRLYDVKAMPTTVIVDRNGNMRYLHKGYQPGTEDHYV
    KEVKALIRE

    >gi|83645466|ref|YP_433901.1| Na(+)-translocating NADH-quinone reductase subunit D [Hahella chejuensis KCTC 2396]
    MSDATPKKVLLEPIFSNNPIALQILGICSALAVTTSLQLSLVMAIAVSLVTAFSSFFIAMIRSHIPSNIRIIVQMTIIAS
    LVIVVDQVLKAYAYEISKQLSVFVGLIITN
    CIVMGRAEAFAMQNGPVLSFLDGIGNGAGYGAILLIVATVRELFGAGKLF
    GAEILPTVANGGWYQPNGLLLLPPSAFFIIGLIIWGLRSWKKEQVEAPEYKLSAHKVKEAF

    >gi|83645467|ref|YP_433902.1| Na(+)-translocating NADH-quinone reductase subunit E [Hahella chejuensis KCTC 2396]
    MFEHYLSLLIKAVFVENMALAFFLGMCTFLALSKKMEAAIGLGIAVVVVLSVTVPVNNAIYNGLLREGALSWAGLPNVDL
    SFLGLLTYIGVIAAIVQILEMVLDKFFPALYNALGVFLPLITVN
    CAIMGASLFMVERDYTFGESLVYGFGAGLGWALAII
    ALAGIREKLKYSDVPEGLRGLGITFITVGLMSLGFMSFSGISL

    >gi|83645472|ref|YP_433907.1| soluble pyridine nucleotide transhydrogenase [Hahella chejuensis KCTC 2396]
    MAEYRYDVVVIGAGPAGEGAAMNAAKHGKRVAVIEDKSQVGGNCTHMGTIPSKALRHAVKQIIQFNTNTMFRDIGEPRWF
    SFPRVLQNAERVIGKQVKIRTQFYARNRVDLYRGRASFIDENRIEVRGGLNGKEVLYGKQIVIATGSRPYLPEDVDFTHR
    RIYNSDSILKLSHTPRTLIIYGAGVIG
    CEYASIFVGLGVKVDLINPGERLLSFLDGEISDALSYHLRDNGVLVRHNEQYD
    SVVGDDHGVVLTMKSGKRIRADAFLWCNGRTGNTDNLGLENIGLEPNARGQLAVDNHYRTKIPHVFAAGDVIGWPSLASA
    AYDQGRSASSEIVKDDFFRFITDVPTGIYTIPEISSVGRTEAELTEAKVPYEVGQAFFKDLARAQITGDTVGMLKLLFHR
    ETMELLGIHCFGDQASEIVHIGQAIMNQPGELNTIEYFVNTTFNYPTMAEAYRVAALNGLNRIF

    >gi|83645618|ref|YP_434053.1| molybdopterin/thiamine biosynthesis family protein [Hahella chejuensis KCTC 2396]
    MKLPPLVEPAAELSAAEIARYSRHLLLPDVGLEGQKRLKNAKVLAVGAGGLGSPVLLYLAAAGVGTLGVVEFDVVDASNL
    QRQIIHGVSDVGRPKGESARDAIREINPHVEVRLHSERLDADNALSLFAQYDLIVDGTDNFATRYLVNDACVLAGKPYVW
    GSIYRFEGQASVFWENAPGDAGLNYRDLYPEPPPPHLAPS
    CSEGGVLGILCASIGSIMATEAVKLITGLGESLLGRLAVY
    DALEMNYRFITLRRDPQRTPITELADYEFFCGLTATTQDSAPSVPSIDAHELKQWRDNAKDFQLIDVRETTEWDIVRIAG
    ARHIPQSRLLDEEILVTLNRDAPIVLH
    CKSGARSQRALQSLRERGFDNVHNLDGGILAWIRDVDSSLPSY

    >gi|83645747|ref|YP_434182.1| 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benz oquinol methylase [Hahella chejuensis KCTC 2396]
    MHELVKDYYGKQLQSSSDLKTSACCDVSRVPAWLKPLLARIHPEVSARYYGCGLVCPPLLEGCRVLDLGCGSGRDVYALA
    QLVGEHGEVVGVDMTDEQLQVARSHQAWHAEQFGFDNVRFLQGYIEKLDELNLEPGSFDVIVSNCVINLSPDKASVLRGL
    HRLLKPGGEFYFSDVYADRRVPADLHDDPTLYGE
    CLGGALYWNDFLRLAHQNGFADPRLVEDRPLAITDNSLADRIGSIN
    FYSATYRLFKIDELETACEDYGQAVIYQGTVPDHPHRFILDKHHAIETGRGFPV
    CGNTWRMLQDTRFAGHFQFIGDFSRH
    YGIFEGCGTATPFDGASSSVSADAPCC

    >gi|83646078|ref|YP_434513.1| thiol-disulfide isomerase-like protein [Hahella chejuensis KCTC 2396]
    MPTQFKGLMKIPLVAFLSLSAFSQSGYAEEVDYSAEGERRAKIAGESLIGAPAPKIRIKDIDGETIDLAQVYGEKPVYLK
    FWATW
    CAPCREQMQGFEEIFQKYGDKIQVVAINTGISDNQQSVTAFREKAGLTMPITIDDGELARAFQLRVTPQHVLIDK
    KGEFAYFGHKDDQELHQALDRVVAEKSAEKPLNNPVLTAKDNGYQVGDIVPNVSFSPIDAQPLSFKFNTPDSKKVAVVFF
    APW
    CEWYLEKTEPKTSKACTQVRELLESQSKQSDVQWVTVSTNLWSSPADLKDYRANYGASMPIVFDEDGKLFKQFGVNQ
    VPTIAVIEPDGIVSLKSSIQDDDFDAALKTIANFK

    >gi|83646079|ref|YP_434514.1| thiol:disulfide interchange protein [Hahella chejuensis KCTC 2396]
    MQFLMKMMVWLVALIGSLQVLASEQTDDQRLLSISILLESENPAAGGEYELALTMTPKQGWHGYWLNPGDAGFPTRLSWR
    LPQGVKIGEAQYPAPSQLLTTDIMNYVYPGEYTLLTLIKIDKGIAAGSSLPIKLDASYLVCNSTACLPEQQTIETSIIVG
    DGKASDSRIDTFSQWRQKLPRPLAAKGRFSVDNGKFVLALPLPDSIRSDNAHIYPIMNNTIVNSARQSFTHDGDTLRMQT
    NAGDELGELFQGVLVLDNGVALSFEADKADPAALISDRANSNGSASKNTWVIGFAAFFGAILGGLLLNIMPCVFPILSLK
    ILSLTQQGSKEEARTGSVAYTSGAILVCVLLGGVILGLRAVGHQIGWAFQLQSPAVIAALIVLMSAIGFNLAGLFEIGTL
    TSGSRLQDKKGPMGDFWTGVLAAFVATPCTGPFMATALGAALVLPTGIAFMIFAGLGFGMALPILLVGFIPALRAHFPKP
    GAWMTTARRVLSLPMFITVIGLVWVLMRQANNDYVLSVLAATMLSTVGLWVTGLWQQSQRRGEWWPAIALTLLPFWAVIS
    WIPPAHAAAQIEQKHVSEAVVFSQDKLEAALAENDVFLYFTADW
    CLTCKVNEKTSIDQKQVKDAFEQNSVVTMVGDWTNG
    DSEITEFLSRHGRSGVPLYLWYRQGVSKPTVLPQILTPSILVHQAGK

    >gi|83646279|ref|YP_434714.1| thiol:disulfide interchange protein [Hahella chejuensis KCTC 2396]
    MVVLTVVPRQWHFILRVCGALLLWVMAGFASAADSATGEHIRVQLVSEWDGVAPGRTHWVGVILEPDPHWHTYWRNPGDS
    GEPPTLTWRLPPTIQAGDIQWPLPDEIPVAHLTNYGYSGAHLLMVPLQVGELSQSNADISVDISWLVCREDCIPGWATLS
    MNLPVEAEPSPSEHHPLFEQTRLNLPAQEIISARYEVTDSHLVLAFTAPKAGPWRALPLEGNVVVHGASQQLIRDGDVTR
    LLTPRSEYLSAKGQPIAFLLTNGEQGYYLHSEYNAGASVKETSQGGIESLSLWLLMLMAFAGGLILNLMPCVLPVLSIKA
    LGLRQGHHTLMHKLAYAFGVWGSFMAFAAIIVALKSAGSEVGWGFHMQNPIVIGLLSFLFLFIALNLMDLAPVGGRLAGM
    GQSLTQGDSAQSQFFTGVLAVLVASPCTAPFMAAAIGVALVSDALMVFIIFTALALGFALPLSLIYFIPALQRRLPRPGP
    WMNTFRQFLAFPMLATVLWLAWIYQQQTSAYAHLWLMIALLGLGFWAWSRQHLARLPSWLVAVATLAVMSQPLRLAQTSQ
    DASPPQAAQAFSEHKLATLRARGAVVVVNMTADW
    CITCKVNEQVAFSSGQVQTLLESENVHYLVGDWTNRNDEIFGYLQR
    YGRAGVPLYVVYAGMADGQVLPQLLTPELLIRGIEQAKEEIRYESQAVVTGTLGVNAGGQCMDAGGAENRRSGARFQRY

    >gi|83646280|ref|YP_434715.1| thiol-disulfide isomerase-like protein [Hahella chejuensis KCTC 2396]
    MKVRLLLQALSALTLAASVWTQAAPKIDVQAPGFSAIDSNGEVVNLSDYKGKYVVLEWTNHECPYVGKHYGSGNMQGLQS
    KYRAEDVVWLTIISSAPGTQGYVKADEANALTASRNAKPTHVVLDPDGAVGKMYDAKTTPHMYIIDPEGVLRYAGAIDSI
    RSANKADIAKAVNYLDKGMQSLFEGMPVDPKATPPYGCTVKYES

    >gi|83646303|ref|YP_434738.1| thiol-disulfide isomerase-like protein [Hahella chejuensis KCTC 2396]
    MRRVLLMLAAWMIASAASAEVKPFTADSVKAIQQQWDGEPYLMVLWSIDCPPCHKELEMLGSLLKDDPDLAVTLVSTDQD
    MPEAQVRETLAQYKIESADNWRFADPVPARLRQAIDPSWYGELPRSYFVSSNGERKGRSGLLSEDAIRNWLQ

    >gi|83646517|ref|YP_434952.1| glutathione S-transferase [Hahella chejuensis KCTC 2396]
    MNIGTIELVSFKLCPYVQRSVITLLEKGVVFKRTDIDLANKPGWFLALSPTGKVPLLLIDNKDAIFESAVICEYLDEVTE
    GSLFPADPKLRALHRSWIEFGSQTLAAIGGYYSAKDEESFRHAEAQLRGRFEKLEDVIAGPYFSGADFMIVDAVYAPVFR
    YFDVFSTLVESDLFKGLAKVEAWRRRLAARQSVIDAVDVDFAQALIAFVIRKQSYLSHLLQSSVPA

    >gi|83646636|ref|YP_435071.1| glutathione-disulfide reductase [Hahella chejuensis KCTC 2396]
    MYDLVVIGAGSGGVRAARVAAQLGAKVAIIEERFYGGTCVNVGCVPKKLFVYASHYGEDFHDAQGFGWEAGTPIFNWRRL
    VENKDNEINRLNGVYENLLKNAGVEIIDGRGTVKGPGQVEVNGDVLQTRHILVATGSKSFTPEFPGCEHSLDSDAMFYLE
    RLPGKAIVVGGGYIAVEFAGILAGLGVETHLVYRGPRLLKKFDGDIRDFLHDEIVKKGIHLHLEEDVVAIDKTDDEAAPY
    LVKLKSGATLQVGLTLHATGRTPNTAGLGLEESGVKLGSKGEVLVDGDYQTNVPGIFAVGDVIDRYQLTPVALSEGMYVA
    NYLFGENPVAVDYERIPTAVFSQPSVATIGPTEEEARANHSNIKIFRSSFRALKNTLSGNQERTMMKLIVDGDTDVVLGA
    HMVGPEAAEIVQGLAVAIRAGATKAIFDTTIGIHPSSAEEFVTMRQPV

    >gi|83646725|ref|YP_435160.1| hypothetical protein HCH_04019 [Hahella chejuensis KCTC 2396]
    MTAIRLVFIAIVMTLTSACSQEPLEWSGTDISGMLPELKFSLQSENAASVSEKDFEGKYNILFFGYTYCPDICPTTLARL
    KSALSKLEASEQQRINILFVSVDPKRDAPEQLKAYTDAFGPEFVGLTGDMDALQSITKRYRVAFGYGNPDEAGNYDVSHS
    SAAFVFDANGKARLLLRDDLSADMIAKDLDQLLKS

    >gi|83646759|ref|YP_435194.1| rhodanese-related sulfurtransferase [Hahella chejuensis KCTC 2396]
    MSSVVSRIPAADSQTALAHFQALLQFETDCWDVHHAISNKRQDFVLLDVRGDEAYRKGHIAGSISLPYTRLNEQNLAAYP
    ADTLFVVY
    CAGPHCNATEKAAIKLASLQRPVKKMIGGVTGWIDEGFTLETDADA

    >gi|83646799|ref|YP_435234.1| molybdopterin/thiamine biosynthesis family protein [Hahella chejuensis KCTC 2396]
    MLTTAELSRYSRHLSLPEFGRAGQEQLRASRVLIVGAGGLGSPLGLYLAAAGVGILGIVDGDVVEESNLQRQVLYTVDDI
    GQPKAERAAARLNALNPHVDIRPYTMTLSSENALGLIKDYDLVIDGTDNFPTRYLTNDACVLAGKPNVYGSIFQFEGQAS
    VFHHEGGPCYRCLFPEPPPPGMVPS
    CAEGGVLGVLPAMIAGIQATEAIKILTGMGDTLSGRLLQYNALSMTFDELRLRRD
    PECPVCGDHPSITALIDYDAFCGVPKALAQECDINPEALNARLQKGEQMTLIDVREPYEREICAIDGSLHIPLQSLPARI
    HEFSKEQTLVFY
    CKSGGRSAGARQLFSDADFHRVYNLSGGILAWADKIDPDMPRY

    >gi|83646917|ref|YP_435352.1| glutaredoxin-like protein [Hahella chejuensis KCTC 2396]
    MKKLFVLAVIAGLIYQFKPEWIPFTQPEGAYHADGSPRTLLFTFSDCKQPCAKVKNELERRGAAFEEVVVDANAENRQLW
    DSFSPYNSFPLLIVGKERAYGDMSIEVATTLALNYGDGLLTSEERGLTSSHFNPDGSPRVVMYSADW
    CPYCKKLRGAFRD
    DGMAFQEIDVEKARNKEQLIRTLGISGYPVTYVGYRRVVGDDIKAIKKALASY

    >gi|83647007|ref|YP_435442.1| glutaredoxin 1 [Hahella chejuensis KCTC 2396]
    MYTVIFGRSGCPYCVRAKQIAEQLKDQRQDFDFRYIDIHEEGISKADLEKTVGKPVLTVPQIFIDKEHIGGCNEFENYVR
    QNLTH

    >gi|83647059|ref|YP_435494.1| cytochrome c-type biogenesis protein CcmG [Hahella chejuensis KCTC 2396]
    MKRFFLFIPLLAFVAVVILFNQNIDNDPSKLELARKDQPVPAFKLGELYNPDREMTPADLKGEPMLLNVWATWCPSCRVE
    HPYLLKLAKEYNVPVIGLNYKDDREAAKKWLEALEDPYRFVIFDPEGRLGLDLGVYGAPETYVIDAAGVIRYRHVGVVNE
    KVWRETLAPMLRNLKMANANGIEEPGT

    >gi|83647199|ref|YP_435634.1| rhodanese-related sulfurtransferase [Hahella chejuensis KCTC 2396]
    MLISPASLHSHLGDAKYRIIDCRFALNDPEYGRLAYLQGHIPGAVYADLNKDLSAPVIPGKTGRHPLPEVHKFLGWLQQA
    GITSEDTVVAYDDGPGAYASRLWWLLKWLGHDDVRILDGGLKAWRAAGYDLSTEPAAPKQVDAYEATPDDRLLVTAEELH
    SKLNDASVNILDARAAPRFAGEMEPIDPVAGHIPNAICAPFEENLTPEGVFKPEEELRRRFANYYAHGKAWEVI
    CYCGSG
    VTACHNIFSAHLAGYPMPKLYPGSWSEWITDPNRPIAVGNE

    >gi|83647338|ref|YP_435773.1| methylated DNA-protein cysteine methyltransferase [Hahella chejuensis KCTC 2396]
    MIEYFDIDSPLGRIRLAAQNGELTGCYFEDQKYYPELTTLWRHNPDCTVLQEAARQLELYFAGQLQRFDLPLAPKGTAFQ
    QEVWSALSDIESGRLSTYQQIANFLGRPRATRAVGAAVGRNPISVIIP
    CHRVIGGNGSLTGYAGGLNRKQALLELENALL


    >gi|83647430|ref|YP_435865.1| dihydrolipoamide dehydrogenase [Hahella chejuensis KCTC 2396]
    MADKFDVIVIGAGPGGYVAAIRAAQLGLKTACVEKWSNEAGKPVFGGTCLNVGCIPSKALLESSHKFEEAKHDFETHGIM
    AQDVTVDVAKMQGRKNNIVKNLTQGIASLFKANGVTSIHGAGKLLANKQVEVTDNAGNVTVYDAENVIIATGSRPVEIPP
    TPLNEHVVDSTGALEFSEVPKRLGVIGAGVIGLELGSVWARLGSEVVVLEAQDTFLGAVDQQLAKDALKQFTKQGLDIRL
    RARVTGSEVKRGVVKVSYSDTKGDHELKVDKLIVAVGRAPNTDNLLAPDSGVNLDERGFIFVDDQCKTNMPGVWAIGDVV
    RGPMLAHKASEEGIVVAERIAGHKGHVNYDCIPWVIYTHPEIAWVGKTEEQLKAEGEEYKVGTFPFAASGRAMAANATMG
    MVKILAHKDTDRILGMHIVGPQASEMIAQGVIAMEFGSSSEDLAMTVFAHPTLSEAVHEAALAVEGKAIHIAQRKKR

    >gi|83647525|ref|YP_435960.1| Fe-S oxidoreductase [Hahella chejuensis KCTC 2396]
    MLDVRPMLMVSNFPAISRGTLETLQVNLGYKCNLSCTHCHVAAGPTRTEMMTEAVIAEVLEFIKVKNIKVLDLTGGAPEM
    NPHFRSLVAEARALGVSVMDRCNLTILLEEGQEYLADFLAQQGVEIVASLPCYAEQNVDKQRGKGVYQESIAALKKLNAL
    GYGREGSGLTLNLVYNPGGPFLPPGQEKLEADYKRELFERHGVEFNQLFVLTNMPISRFGSVLLSKGQFNDYMQLLHASY
    SEPNLHSVMCRTLISVDWQGYVYDCDFNQMLDIPLIASDKPKVRLRDLMAENLEGASIATADHCYGCTAGQGSS
    CGGALD


    >gi|83647589|ref|YP_436024.1| peroxiredoxin [Hahella chejuensis KCTC 2396]
    MAQPGQTVPDFEAQATPDQTVRLSDLKGKNIVIYFYPKDHTPGCTTEGQDFRDNYAEFEKLNTLVFGVSKDSLKTHQNFK
    AKHSFPFELITDPDEVVCRVFDVIKLKKLYGKEYVGIERSTFLIDAEGVLRKEWRKVKVKGHVAEVLEATKAL

    >gi|83647673|ref|YP_436108.1| peroxiredoxin [Hahella chejuensis KCTC 2396]
    MGVLVGKPAPDFTVPAVLADGQIVDEYKLSEAIKGKYALIFFYPLDFTFVCPSELIALDHRVEQFKERGVEVIGVSIDSH
    FTHNAWRNTPVDKGGIGPVKYTLAADLNHEICKAFDVESAGGVAFRGAFLIDKDGVVRSQIVNDLPLGRNVDELIRLVDA
    LQFHEEHGEVCPAGWKKGDKGMQASPEGVANYLSQNSDKL

    >gi|83647922|ref|YP_436357.1| arsenate reductase [Hahella chejuensis KCTC 2396]
    MYGISNCDTVKKARKWLEANNIEYTFHDFKKSGVPQSNLEAWLNALGVETLVNKRGTTWRKLSDSDKADIESGAKTQELL
    SEHSSVIKRPVIETPSGEVITGFTPSQLEKYA

    >gi|83648055|ref|YP_436490.1| rhodanese-related sulfurtransferase [Hahella chejuensis KCTC 2396]
    MANNLDSLPLILEPEQLEPLLGSPGLILVDLCRTENYQAAHLPGAIHIPPGATQYGRPPAPGLLPEESQLQAIVQHIGLR
    TDSHVVVYDDEGGGWAGRMIWLLDSIGFQRYSYLNGGLVAWHDEGRPLTREEPTVTAGNYDIRLRSESTVTLDQLQTELG
    DPALGIWDARSPQEYQGLRQAAMRNGHIPGAVNYEWTRAMDPSAGLRLRDLTVIKAELEALGLNAEKRIVTH
    CQSHHRSG
    LTYLLGKALGFNMRAYAGSWGEWGNHPDTPIDQP

    >gi|83648228|ref|YP_436663.1| adenosine deaminase [Hahella chejuensis KCTC 2396]
    MNASSKPTQTDATMNDPRWRALQERDTRADGSFYYSVKTTGVYCRPSCAARTPRPENVRFYDSIEDAEQAGFRPCRRCRP
    DAPSLAARQAEKIATACRLIAGSETFPSLDELAQCAGMSKFHFHRVFKQITGLTPRSYAAAQRKQRLDGALQRSDTVTDA
    IYDAGYNSNGHFYGESNQILGMTPGDYRRGGANAEIRFAVGECALGSILVAQSARGVCAILLGDDPEALVQDLQDRFANA
    ELIGDDADFERVIAKVVGFVEAPQVGIDLPLDIRGTAFQQRVWRALQEIPSGATASYADIAQRIGSPKSVRAVAQACAAN
    LLAVAIP
    CHRVVRSDGALSGYRWGVERKQALLEREAQE

    >gi|83648368|ref|YP_436803.1| hypothetical protein HCH_05725 [Hahella chejuensis KCTC 2396]
    MSSSANSLNALSFDNSYARLPTHFYQKVAQTPLEDAHLISFNGDVAEALGLNRSQLDPEELARYCGGGGALETGESIAMK
    YAGHQFGHYNPDLGDGRGLLLGEVVTADNRRLDLHLKGAGRTAYSRFGDGRAVLRSSIREYLVSAAMNSLGVSSTSALCL
    VGSEEYTMRNGMEPCAMVLRVTPCHIRFGHFEHFYYLGQHDDLKLLADYCIERYFPQLQEADNPYLAMFNEVRNRTADLV
    AQWQSYGFVHGVMNTDNMSIIGETFDYGPFTFLDSYDPNFISNKNDTAGRYAFKQQPGIALWNLSALAQALLPLIPLDDL
    KRSLDDFADLYSAAFYGKMSQRLGLTQQGADGSLRQLIDDLLTLFAANNTDMNRFMRALSRYDGNESSLSFMSDLSCDSR
    GFSEWKARFCKHVDSSDVTLADRTQAMLQVNPEYILRNYMLEEAIREAHQGDYLPVQNLLKIVKNPFNAQPGAERYAEAP
    PDWAGAICLT
    CSS

    >gi|83648605|ref|YP_437040.1| glutamate synthase subunit beta [Hahella chejuensis KCTC 2396]
    MAERLSNNFQFLDVGRQDPEKVPVGRRKKQFREIYKPFKEEEVKNQAHRCLECGNPYCEWKCPVHNYIPNWLKLASEGNI
    MAAVELSHQTNTLPEVCGRVCPQDRLCEGACTLNDGFGAVTIGSTEKYITDTALALGWKPDMSKVAMTDKRVAIIGAGPA
    GLGCADVLIRNGVKPVVFDRYPEIGGLLTFGIPEFKLEKEVMVRRRKLFEEMGIEFRLNTDVGKDVAFADLLNEFDAVFL
    GMGTYNYMKGGFPGEELPGVYDALPYLISNVNR
    CLGYEKAPEDFVDMQGKRVVVLGGGDTAMDCNRTAIRQKAKSVTCAY
    RRDEANMPGSRKEVANAKEEGVKFLFNRQPVAIIGDERVEGVKVVQTRLGEPDENGRRRPEVVAGSEEILPADAVLIAFG
    FRPSPSPWFQEFGIDVDNGGRVIAPEQQQYKFQTTNPKVFSGGDMVRGSDLVVTAIWEGRQAGEGILDYLEV

    >gi|83648772|ref|YP_437207.1| redox protein, regulator of disulfide bond formation [Hahella chejuensis KCTC 2396]
    MKATITWGGDAKFIGKSGSGHDVVMDGPPDHGGQNQGPRPMEMLLLGLGGCTSFDVMSILTKARADVTDCVAEITAERAD
    AVPAVFTKIHIHFIVTGRDLRDPVVKRAVDLSAEKYCSASIMLEKGGVEITHDFEIRAPEDAQ

    >gi|83648879|ref|YP_437314.1| hypothetical protein HCH_06242 [Hahella chejuensis KCTC 2396]
    MNVAETYEPTPIIFTDNAAAKVKSLIEDEGNDELSLRVFVTGGGCSGFQYGFSFDEAVNEDDTIVEKDGVRLVVDSLSYQ
    YLVGAEVDFREGLEGAQFVIKNPNASTTCGCGSSFSI

    >gi|83649053|ref|YP_437488.1| disulfide bond formation protein DsbB [Hahella chejuensis KCTC 2396]
    MPAWLTNRTIYFLCFLAIAGLMGFAFYLQYVKDLEPCPLCMAQRIAFVLAGLVFLAAALHNPKNTGTTVYAFLGWVTTLG
    GAALATRQLWLQSLPADQVPA
    CGPGLEYMLEAFPFSEVLTMMLTGTGECAEVQWTFLGLSIPGWTLVAFIGFTAVWAFAW
    VRRPR

    >gi|83649182|ref|YP_437617.1| thioredoxin-disulfide reductase [Hahella chejuensis KCTC 2396]
    MSDTLQVVCPHCDTTNRVPAAKLTAGGKCGRCKHPLFAGHPVALGQNNFGKHLQASDLPLLVDFWAPWCGPCKMFAPIFE
    QAAAQLEPAVRCVKVDTESNPQLAQQFQIRSIPTLAIFKKGVEVARISGALQGPQLVQWVRENL

    >gi|83649209|ref|YP_437644.1| hypothetical protein HCH_06582 [Hahella chejuensis KCTC 2396]
    MSASDPLQLARAGKQGSYPVRTRYRRQDGSPVFTNHLILESSPYLLQHAHNPVNWRAWNDDTFALAKAENKPIFLSIGYS
    T
    CHWCHVMEEESFDNEEVAQTLNGYFIPIKVDREQRPDLDEIYMTAVQIITGHGGWPMSSFLTPEGNPFFGATYFPRPRF
    INLLRKVHELWEEQQENLLEQGRRLSEAVSVYLRPKPISETLAENLIETAMEKLIGYSDREWGGFGSEPKFPQEPNLLFL
    LDIIERDSRPLDRQPAWTVVKTALDALLAGGVYDQAGGGFHRYAVDQRWLVPHFEKMLYNQAQLARCFIRAYKLSQDPEY
    LRICRETLDYVLREMRSPEGVFYSATDADSEGEEGKYFVWAYQELSQLLDTPGLALAEQVYGVTRKGNFEGANILYLPRP
    LQKSAATLGLTYEELLQQLADLKAILLQTRSQRVPPLRDDKVITEWNGMMIAALAETAAITGISAYGDAAVIAANQLWRS
    QRGEDGLFHRISLDNLPSDDALLEDYVHYMEGLLQLYDYTHDHLWLERLEALTTTLEEQFLDAEQGGFFITPQSAQGPLL
    VRSKHCSDNATISGNSQLASVLAALRLRTGDLNVQRMAENQIAAFTGQINRHPLSAPVFLKGLNEWLSPNPVNLQYAASG
    QMWATATVKEYKEDYLLEVQLDIHMSEGWRIQSHNCPAPDGRRTQVELLSHTDHDLLDIRYPPGSVWTDANASNALEVYD
    DHCCIELTLRRATRSPVRLALHFQTCNEQVCHCPHTLNFSLW

    >gi|83649351|ref|YP_437786.1| copper-translocating P-type ATPase [Hahella chejuensis KCTC 2396]
    MNQALSEQGALIAIQGAGCQSCVKKIKHALAPLTDADKVTVDLQAQTIAIDAAVDIPAALEAIRQLGYPAELKEDEQNQE
    TAADAHCATRAAEPESTPAQADASSHPMRQADIIQLNITGAK
    CAACVSKIEQALQSVPGVASATMNFADRTAAVEGDADT
    NALIQAVEQAGYGAALATNDAADQETKEKAEQAYYKQLLRNMWLALGLGVPLMAWGLLGGEMMVRPGLSQFAWLAVGLIT
    LGVMAKSGGHFYTGAWKAFKNHSANMDTLIATGTGAAWLYSIAVAALPQVVPEMARHVYFEASAMIIGLINLGLALEVRA
    RGKTSQAIKRLLNLQPKTARIIRDGDEKDIPIENVRKGDLLRVRPGEKIAVDGEVRDGKSLVDESMLTGEPIPVEKKQGD
    KVAAGALNKTGSMTYIAVKVGKDTALAHIIAMVKKAQNAKPPLGRLADKISAVFVPVVLIIAVIAALAWYNFGPDPRIAH
    MLVAATTVLIIACPCALGLATPMSVMVGVGKAAEAGVLIRNGGALQQAGELATLVLDKTGTITEGKPSVLEIRAIDGRDQ
    KELLRLAASLEKASEHPLGIAIVESAREQSLALSDPADFRSESGQGVTGVIDGVTVLLGNRRWMETHHIDAGPLTEVADK
    LAQQAATPLFMATDGALAGVIAVADKIKPDSRDAIARLRDRGLRIIMLTGDVKHSAEAIARQVGVDEVIAEVLPEDKARV
    IRDLRQKAGQGELVGMVGDGVNDAPALAEADVGFAIGTGTDVAIESADITLMRGSLHGLADAIEVSRATVRNIKQNLFGA
    FVYNALGIPIAAGLLYPLFGVLMSPVLAGAAMSLSSVTVVSNANRLRLFKSSAADAQRQQEEKAA