Haemophilus somnus 2336 uid57979

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|170718354|ref|YP_001783378.1| rhodanese domain-containing protein [Haemophilus somnus 2336]
    MQEYLPLATEFAKNHSLMVIAWIAVFVMLIYTSVKSFTSKVTAVENAEATRLINNEEAIVIDLRTIDEFQRGHIINSINV
    LPTEIKNQNLGKIEQHKDTPVILV
    CATGMNAGASAELLVKQGFSRVYSLKDGISGWIAANLPLVKKHK

    >gi|170718387|ref|YP_001783381.1| rhodanese domain-containing protein [Haemophilus somnus 2336]
    MYFTVKSFLEKVSLPYKETVLYCEILLLLNYHKMTTFKEINSEQAWEILNNKNAVLVDIRDLSHFIYSRPKSAFHLTHQR
    FSEFQQKYEYDQPIIVS
    CYHGVSSRNVAQFLVEQGYDEVYSLIGGFAGWVQANLPVESGY

    >gi|170717818|ref|YP_001783509.1| iron-sulfur cluster assembly protein IscA [Haemophilus somnus 2336]
    MSITLTQAAANRVRTFLEKRGKGIGLRLGIKTSGCSGLAYVLEFVDVLNEDDEVFEQDGVKVIVDHKSLVYLDGTQLDFV
    KEGLNEGFKFSNPNVKDECGCGESFNV

    >gi|170718085|ref|YP_001783533.1| DSBA oxidoreductase [Haemophilus somnus 2336]
    MKKFLWALASFFFLNSTQALALQEGKQYIELEQPRSVQPEVIEFFSFGCIHCFNFEKTYQIPQQIKADLPKDVTFKQYHV
    DWMGEDIVRAWSLAILLGIEEKVKMPLFELIIEKRKAPTLDNIREVFLANGITAAQFDGGINSFAVTAQTNKQIALAKKL
    GVRATPEFYINGKYKVNAEGLSRTTDGFIKDYVETVKGLLQK

    >gi|170718407|ref|YP_001783629.1| thioredoxin [Haemophilus somnus 2336]
    MSEVLHTTDATFDTDVLKSDIPVLLDFWAPWCGPCRMIGPILEELSAELGDKVKIVKINIDENQATPAQFGVRSIPTLIF
    FKEGKAVATQVGALPKNQLVNFINQNS

    >gi|170718621|ref|YP_001783821.1| methylated-DNA--protein-cysteine methyltransferase [Haemophilus somnus 2336]
    MQPTFYCYYHSPIGRLLMLSQNNQLTNLDFELEQIEPNSRWIFNQNLPLFLQVTSALDRYFKGEAEDFSDLSLHPQGTKF
    QQKIWQALRRIPYGQSASYSELAGFIDHPKAVRAVGGAVGRNPISIIIP
    CHRILGKQKQLTGFGGGLPAKRYLLQLEKID
    YIDRGIEYVKPKLLQKYHQS

    >gi|170718676|ref|YP_001783870.1| thiol:disulfide interchange protein [Haemophilus somnus 2336]
    MKKFLMVSLAMLMSTFVKADNNVTIRKNLQKLGMTDVEIMESPIKNIKSVLTREGTLYVSEDGKYVLHGALYEITDKGIV
    NLTTKSLLVKLNNLKNEMIVYPAKKEKYVITVFMDIT
    CHYCHLLHQKIKEYNELGITVRYLAFPRAGLNSNTAKQMEAIW
    ISRDPVFALDEAEKGNLPKELKIPNMIQKHYELGIQFGVSGTPSIITESGEVIGGYVEPKKLLQVLEDIRE

    >gi|170718890|ref|YP_001784062.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Haemophilus somnus 2336]
    MNKKLYIPLILFLGLAFAFFVQLQRNAQSDNPKALESALIGKSVPNKLLTDLLTDKQYDNRLFKQGKPLLVNVWATWCPT
    CYAEHQFLNELHKQGINIIGINYKDKTDKAIKWIKKLGNPYQVIVKDEKGSFGLDLGVYGTPETFIVDGNGIIHYRHTGD
    INERIWKEKIQPIYQQVSEKK

    >gi|170718946|ref|YP_001784113.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haemophilus somnus 2336]
    MVLVTRQAPDFTAAAVLGNGEIVEKFNLKQHIAGKAAVVFFYPMDFTFVCPSELIAFDHRYKEFQDRNVEIIGVSIDSEF
    THNAWRNTPVDNGGIGQVQYALVADIKHDIAKAYGIEHPEAGVALRASFLIDKEGVVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGEVCPAQWEKGKEGMTGSPEGVAKYLKQNADKL

    >gi|170719108|ref|YP_001784258.1| arsenate reductase and related [Haemophilus somnus 2336]
    MITVYGIKNCDTVKKALKWLADNNIEYQLHDFRVDGLQQYWLEQAEQQFGWENLVNKRSTTWRNLDEEIKQNLTKQTALK
    TLLAQPTLVKRPIILQDGKALIGFSVEDYERVLK

    >gi|170719130|ref|YP_001784278.1| GrxA family glutaredoxin [Haemophilus somnus 2336]
    MYVVIFGRSGCPYCVRAKNLAEKLKNTLEDFDYRYIDIVAEGISKADLSLSVGKPVETVPQIFIDEKPIGGCTDFEALMK
    AQFNVVA

    >gi|170719159|ref|YP_001784304.1| disulphide bond formation protein DsbB [Haemophilus somnus 2336]
    MLIFFKNLSMKRSTWILLFISALVLESTALYFQHGMGLNPCVMCIYERVAILGIMFSGLIGCIAPKWLVLRILALLIGLG
    SAVKGLLLAIKHLDYQLNVYPWNQ
    CAMVPDFPQTLPLDKWFPNIFMPSGSCSDITWSFLGFSMVQWIIVIFACYFLFFII
    LSISQFKKVRKNRMLFR

    >gi|170717225|ref|YP_001784344.1| dihydrolipoamide dehydrogenase [Haemophilus somnus 2336]
    MNKEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERFSTLGGVCLNVGCIPSKALLHVAKVIEEARSLSAHGIVFGEPT
    TDIDKIRGWKEKVINQLTSGLAGMAKQRKVQVVNGYGKFSGPNAIIVAGDEGETKITFDNAIIAAGSRPIQLPFIPHEDP
    RIWDSTDALKLKEVPENLLIMGGGIIGLEMGTVYHALGSKIDVVEMFDQVIPAADKDMVQIYTKRIEKKFNLLLETKVTA
    VEAKEDGIYVSMEGKAASETRRYDAVLVAIGRVPNGKLIDAGIAGVEVDDRGFIRTDKQMRTNVPHIFAIGDVVGQPMLA
    HKGVHEGHVAAEVIAGQKHYFDPKVIPSIAYTEPEVAWVGKTEKECKAEGINYEVAKFPWAASGRAIASDCADGMTKLIF
    DKDTHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDLALTIHAHPTLHESVGLAAEVFEGSITDLPNPKAKKKK

    >gi|170717237|ref|YP_001784355.1| alkylhydroperoxidase [Haemophilus somnus 2336]
    MTTFTDWKEHTAHVKKSFGELGKSHPKMLQAYINLDQAAAAEALDEKTRELIAIAVAITTRCESCISVHAEKAAKAGATE
    SEIAGALATAIALNAGAAYTYALRALEAVKEQS

    >gi|170717240|ref|YP_001784358.1| thioredoxin reductase [Haemophilus somnus 2336]
    MSDFKHSQLLILGSGPAGYTAAIYAARANLKPVLVTGLQQGGQLTTTTEIENWPGDFGDTTGPELMQRMLQHAEKFDTEI
    VFDHINNVDLSERPFKLFGDAGAYSCDALIIATGASARYLGLPSEETYKGRGVSA
    CATCDGFFYRNKPVAVVGGGNTAVE
    EALYLANIASEVHLIHRRDTFRAEKILIDRLNKKVEEGKIILHTNRTLAEVLGDNMGVTGIRLKNTQTENVEDLKLEGVF
    IAIGHAPNTELFANQLELNNGYIVVKSGLEGNATATSVQGVFAAGDVMDHNYRQAITSAGTGCMAALDAERFLDTQK

    >gi|170717288|ref|YP_001784403.1| glutathione-disulfide reductase [Haemophilus somnus 2336]
    MTKHYDYIAIGGGSGGIASINRAASYGKKCAIIEAKYLGGTCVNVGCVPKKVMFYGAQVAEAIAKYAPDYGFDVTLNHFD
    FAKLVESRQAYIDRIHTSYNNVLAKNNVDVLNGFAKFFDAKTIEVSYANGEKELVTADHILIATGGRPSRPTIPGAEYGI
    DSDGFFALTELPKRIAVVGAGYIAVELAGVVNSLGAETHLFVRRQTPIRSFDPLIIETLVEVMKQDGIQLHTQAIPQEII
    KNADNSLTIKLEDGRTQDVDCLIWAIGREPATDVINLASTGVETNERGFIKVDKYQNTNVEGIYAVGDIIEGGIELTPVA
    VAAGRRLSERLFNNKPDEHLDYHLVPTVVFSHPTIGTVGLTEPKAIEQYGAEAVKVYTSSFTPMYSAVTSHRQPCRMKLV
    CVGKEEKIVGLHAIGFGVDEMIQGFAVAIKMGATKADFDNTVAIHPTGSEEFVTMR

    >gi|170717344|ref|YP_001784453.1| protein-disulfide reductase [Haemophilus somnus 2336]
    MKKILTIFYIFFTALFFASQAQGNMFGKKTQFLKSHEAFQFSSQQEGKKLDLHWAIAENYYLYKKEISIELVNDDNKNQR
    VSIENLHFPTAELHQDEFFGETEIYRHQLDLSINIPTDSSINKALITYQGCTKGLCYPPETQEISINKDLLSVAGKTAMQ
    HPEQNQLAANLLNNKYAPLGFFLLGLGLAFTPCVLPMLPLLSAIIIGANQRPNSLRALGLSFAYVQGMALTYTSLGLIVA
    AIGLPFQIALQSPYVLVSLSVIFILLALSMFGVFTLQLPSSLQTKLTLLSQQQKSGAFGGVFVMGMIAGLVASPCTSAPL
    SGALLYVAQTGDLTTGAFTLYLLALGMGIPLMLITLFGNKILPKSGVWMEKVKAAFGFVMLLLPIFLLSRVLPEYSDYLW
    ASWLFAFIVWFFIQLRKNWLGWIIAFVFTALFLLNSNWNHEQNAVQQQPSHSQFQLIQNYAELQQVLANNPKSVAMLDLY
    ADW
    CIACKEFEKYTFSASNVQPLFEHILLLQVNMTKNSPDNTELMKQLTVLGLPTIIFFDQSGKEIEQARITGFMNNNEF
    EQWLKSNVLP

    >gi|170717527|ref|YP_001784618.1| iron-sulfur cluster assembly accessory protein [Haemophilus somnus 2336]
    MADIAVPLTFTDAAANKVKTLISEEENTELKLRVYITGGGCSGFQYGFTFDEKTNDGDLIVENSGVKLVVDPMSLQYLVG
    GTVDYTEGLEGSRFIVNNPNASTTCGCGSSFSI

    >gi|170717615|ref|YP_001784697.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Haemophilus somnus 2336]
    MYISKRRFLKNLSVLTIGQAFIPFSQANTSFQPERKEGNEAHRYAMLVDLRRCIGCQSCTVSCSVENQTPLGEFRTTVRQ
    YEVTNEQNITNNVLLPRLCNHCDNPPCVQVCPVQATYQRKDGIVVIDNKRCIGCAYCVQACPYDARFINSETKTADKCTF
    CTHRLEAGLLPACVESCVGGARIIGDLRDPTSTISKMVDEFKDDLKVLKPDHGTIPHVFYLGLDDAFVNEVNGQPMLWQD
    KEKAE

    >gi|170717630|ref|YP_001784710.1| molybdopterin synthase sulfurylase MoeB [Haemophilus somnus 2336]
    MQIELSTIEELRYNRQIIMKQIDFDGQEKLKGTKMLIVGLGGLGCAAAQYLACTGVGHLTLLDFDTVSLSNLQRQVLHND
    ERLNMLKVQSAKIALQQLNPHIEIQCIAEKLNEEKLAEIVPHFDAVLDCTDNVEIRNQLDRCCLATKTPLVSGAAIRMEG
    QVSVFTYEENTPTYQHLSRLFGENTLS
    CVEAGVLSPIVGIVGAIQALEAIKVRLNIGKILSGRLLMIDGLNMKIREINIP
    SE

    >gi|170717730|ref|YP_001784800.1| arsenate reductase [Haemophilus somnus 2336]
    MTVKIYHNPRCSKSRETLALLEQQSILFDVELYLQQTYSVEELQTLAQKLGITSVREMMRTKDDLYLQLGLNSQELTEQQ
    LLIALSQNSALLERPIVVNGDKAKIGRPPESVLTIL

    >gi|170717766|ref|YP_001784832.1| glutaredoxin-like protein [Haemophilus somnus 2336]
    METLDKIKKQISENPILIYMKGSPKFPSCGFSARAVEVLINCNVPFGYVDILQHPDIRAALPNYANWPTFPQLWVEGELI
    GGCDIMLEMFQQGELQPLLSEVAARYPQ

    >gi|170717800|ref|YP_001784863.1| electron transport complex, RnfABCDGE type, A subunit [Haemophilus somnus 2336]
    MIDYILLIISTALINNFVLVKFLGLCPFMGVSKKIETAIGMGLATMFVLTVASLCAYLVERYLLTPLHANFLRTLIFILV
    IAVVVQFTEMVIHKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNINLAHNLTQSVIYGFSASLGFSLVLVLFAALRERLTA
    ADIPLPFRGASIALITAGLMSLAFMGFSGLVRV

    >gi|170717801|ref|YP_001784864.1| electron transport complex, RnfABCDGE type, B subunit [Haemophilus somnus 2336]
    MATLHYVLLIIVLLAALFGAILGFASIKLKVEGDPIVEKIDALLPQSQCAQCGYPGCKPYAQAIANGDEITKCVPGGQPL
    VIKIADLLGIEAPSGNFEQDPIPKVAFINEEMCIGCTKCIQACPVDAIIGTNKAMHTIIADLCTGCELCVAPCPTDCISM
    INVKQHIDNWDWKFDPKLVIPIVDTTSAQKKIVVGE

    >gi|170717805|ref|YP_001784868.1| electron transport complex, RnfABCDGE type, E subunit [Haemophilus somnus 2336]
    MSTKNLPETHRTLDEFEPSHLTVNKVKTESVWANLFKQGFWHNNPALVQLLGLCPLLAVSNSATNALGLGIATIIVLICS
    NTVVSLFRKQIPQEIRIPIYVMIIATTVTIVQLIMNAYTYTLYQALGIFIPLIVTN
    CIVIGRAEAFASKNTVLHSIFDGF
    AMGLGMTFSLFILGALREIFGTGKLFFGIENLFGDWAKCLQLNLFQLDNSFLLAILPPGAFIGLGIMLAIKNVIDHRK

    >gi|170718060|ref|YP_001785098.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Haemophilus somnus 2336]
    MKTLKAGDFAPHFSLLNQDSKPISLEDFHGKKVLVYFYPKALTPGCTKQACGLRDSKAELENKGVVILGISPDSPKKLAN
    FIEKKALNFDLLSDEQHIVAEQFGVWGEKKFMGRIFDGIHRISFLIDEQGKIEQVFDKFKTTDHHQIVLDYLNSLEQR

    >gi|170718081|ref|YP_001785117.1| DsrE family protein [Haemophilus somnus 2336]
    MRYVLAVKQPVYGTQGAYLAYQFAQTLLAKGHQIEQIFFFQQGVTLGNAFVNPANDEFHLQKAWQQLSQTYSVPLHLCIS
    AAQRRGIVEPLSSNNQQQNNLAEGFILAGLGEFNKAVLQADRLITI

    >gi|170718129|ref|YP_001785159.1| peptide methionine sulfoxide reductase [Haemophilus somnus 2336]
    MSNKAIYLAGGCFWGVECYFHRIDGVLDAISGYANGKTENPSYQDVLYNNTGHAETVKVIYEQNKLSLEDILQYYFRVID
    PTSLNQQGNDKGTQYRTGIYYTDPQDREIILTALTQEQKKYSKPIVVEVLPLQRFDPAEEYHQDYLLKNPNGYCHIDIKK
    ADEPLVKTYK

    >gi|170718131|ref|YP_001785161.1| NADH:ubiquinone oxidoreductase, subunit E [Haemophilus somnus 2336]
    MEHYISLFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVTVVLGISVPVNQLVYSLILKDGALIDGVDLSFLNF
    ITFIGVIAALVQILEMILDKYFPALYNALGIFLPLITVN
    CAIFGGVSFMVQRDYNFAESIVYGIGAGTGWMLAIVALAGI
    TEKMKYADVPAGLRGLGITFITVGLMALGFMSFSGVQL

    >gi|170718132|ref|YP_001785162.1| NADH:ubiquinone oxidoreductase, subunit D [Haemophilus somnus 2336]
    MANANIKKLLLSPITDNNPIALQILGICSALAVTTKLETAVVMAIAVSLVTAFSSFFISLIRNYIPNSIRIIVQMAIIAS
    LVILVDQILRAYAYGLSKQLSVFVGLIITN
    CIVMGRAEAFAMKSAPIESFVDGIGNGLGYGAILVTVAFIRELIGSGKLF
    GMTIFQTIQDGGWYQTNGLFLLAPSAFFIIGFIIWGLRTWKPEQVEK

    >gi|170718219|ref|YP_001785242.1| glutaredoxin family protein [Haemophilus somnus 2336]
    MTMEGKKVPQVTFRTRQGDQWVDVTTADLFDNKTVVLFSLPGAFTPTCSATHLPRYNELACEFKALGVDDIICVSVNDTF
    VMNAWKADQESENVTVIPDGNGEFTSGMGMLVDKTELGFGKRSWRYSMLVKNGVVEKMFIEPQEPGDPFKVSDADTMIKY
    LNPNWTEKPSVSIITKPG
    CPFCAKAKTLLKEKGYTFEEIILGRDASTISVRAITGKTSVPQVFIGGQYIGGSDDLAQYFA