Haemophilus somnus 129PT uid57929

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|113460184|ref|YP_718241.1| peroxiredoxin [Haemophilus somnus 129PT]
    MEGKKVPQVTFRTRQGDQWVDVTTADLFDNKTVVLFSLPGAFTPTCSATHLPRYNELACEFKALGVDDIICVSVNDTFVM
    NAWKADQESENVTVIPDGNGEFTSGMGMLVDKTELGFGKRSWRYSMLVKNGVVEKMFIEPQEPGDPFKVSDADTMIKYLN
    PNWTEKPSVSIITKPG
    CPFCAKAKTLLKEKGYTFEEIILGRDASTISVRAITGKTSVPQVFIGGQYIGGSDDLAQYFA

    >gi|113460303|ref|YP_718363.1| hypothetical protein HS_0157 [Haemophilus somnus 129PT]
    MQEYLPLATEFAKNHSLMVIAWIAVFVMLIYTSVKSFTSKVTAVENAEATRLINNEEAIVIDLRTIDEFQRGHIINSINV
    LPTEIKNQNLGKIEQHKDTPVILV
    CATGMNAGASAELLVKQGFSRVYSLKDGISGWIAANLPLVKKHK

    >gi|113460306|ref|YP_718366.1| thiosulfate sulfurtransferase [Haemophilus somnus 129PT]
    MQILSFDWLNLVILNKSAVYFTVKSFLEKVSLPYKETVLYCEILLLLNYHKMTTFKEINSEQAWEILNNKNAVLVDIRDL
    SHFIYSRPKSAFHLTHQRFSEFQQKYEYDQPIIVS
    CYHGVSSRNVAQFLVEQGYDEVYSLIGGFAGWVQANLPVESGY

    >gi|113460429|ref|YP_718491.1| HesB-family protein [Haemophilus somnus 129PT]
    MSITLTQAAANRVRTFLEKRGKGIGLRLGIKTSGCSGLAYVLEFVDILNEDDEVFEQDGVKVIVDRKSLVYLDGTQLDFV
    KEGLNEGFKFSNPNVKDECGCGESFNV

    >gi|113460454|ref|YP_718516.1| protein disulfide-isomerase (thiol:disulfide interchange protein) [Haemophilus somnus 129PT]
    MKKFLWALASFFFLNSTQALALQEGKQYIELEQPRSVQPEVIEFFSFGCIHCFNFEKTYQIPQQIKADLPKDVTFKQYHV
    DWMGEDIVRAWSLAILLGIEEKVKMPLFELIIEKRKAPTLDNIREVFLANGITAAQFDGGINSFAVTAQTNKQIALAKKL
    GVRATPEFYVNSKYKVNAEGLSRTTDGFIKDYVETVKGLLQK

    >gi|113460545|ref|YP_718609.1| cytochrome c-type biogenesis protein G [Haemophilus somnus 129PT]
    MNKKLYIPLILFLGLAFAFFVQLQRNAQSDDPKALESALIGKSVPNKLLTDLLTDKQYDNRLFKQGKPLLVNVWATWCPT
    CYAEHQFLNELHKQGINIIGINYKDKTDKAIKWIKKLGNPYQVIVKDEKGSFGLDLGVYGTPETFIVDGNGIIHYRHTGD
    INERIWKEKIQPIYQQVSEKK

    >gi|113460621|ref|YP_718687.1| AhpC/TSA family protein [Haemophilus somnus 129PT]
    MVLVTRQAPDFTAAAVLGNGEIVEKFNLKQHIAGKAAVVFFYPMDFTFVCPSELIAFDHRYKEFQDRNVEIIGVSIDSEF
    THNAWRNTPVDNGGIGQVQYALVADIKHEIAKAYGIEHPEAGVALRASFLIDKEGVVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGEVCPAQWEKGKEGMTGSPEGVAKYLKQNADKL

    >gi|113460638|ref|YP_718704.1| thioredoxin-dependent thiol peroxidase [Haemophilus somnus 129PT]
    MKTLKAGDFAPHFSLLNQNNEQVSLENFHGKKVLVYFYPKALTPGCTTQACGLRDSKAELENKGVVILGISPDSPKKLAN
    FIEKKALNFDLLSDEQHIVAEQFGVWGEKKFMGRTFDGIHRISFLIDEQGKIEQVFDKFKTTDHHQIVLDYLNSLEQR

    >gi|113460722|ref|YP_718789.1| arsenate reductase [Haemophilus somnus 129PT]
    MITVYGIKNCDTVKKALKWLADNNIEYQLHDFRVDGLQQYWLEQAEQQFGWENLVNKRSTTWRNLDEEIKQNLTKQTALK
    TLLAQPTLVKRPIILQDGKALIGFSVEDYERVLK

    >gi|113460742|ref|YP_718809.1| glutaredoxin 1 [Haemophilus somnus 129PT]
    MYVVIFGRSGCPYCVRAKNLAEKLKNTLEDFDYRYIDIVAEGISKADLSLSVGKPVETVPQIFIDEKPIGGCTDFEALMK
    AQFNVVA

    >gi|113460769|ref|YP_718836.1| disulfide bond formation protein B [Haemophilus somnus 129PT]
    MFYSILLVRLYFCVLSFYEINLMTLRIIGMLIFFKNLSMKRSTWILLFISALVLESTALYFQHGMGLNPCVMCIYERVAI
    LGILFSGLIGCIAPKWLVLRILALLIGLGSAVKGLLLAIKHLDYQINVYPWNQ
    CAMVPDFPQTLPLDKWFPNIFMPSGSC
    SDITWSFLGFSMVQWIIVIFACYFLFFIILSISQFKKVRKNRMLFR

    >gi|113460857|ref|YP_718924.1| thiol:disulfide interchange protein precursor [Haemophilus somnus 129PT]
    MKKILTIFYIFFTALFFASQAQGNIFGKKTQFLKSHEAFQFSNQQEGKKLDLHWAIAENYYLYKKEISIELVNDDNKNQR
    VSIENLHFPTAELHQDEFFGETEIYRHQLDLSINLPTDSSINKALITYQGCTKGLCYPPETQEISINKDLLSVAGKTAMQ
    HPEQNQLATNLLNNKYAPLGFFLLGLGLAFTPCVLPMLPLLSAIIIGANQRPNSLRALGLSFAYVQGMALTYTLLGLIVA
    AIGLPFQIALQSPYVLVSLSVIFILLALSMFGVFTLQLPSSLQTKLTLLSQQQKSGAFGGVFVMGMIAGLVASPCTSAPL
    SGALLYVAQTGDLTTGAFTLYLLALGMGIPLMLITLFGNKILPKSGVWMEKVKAAFGFVMLLLPIFLLSRVLPEYSDYLW
    ASWLFAFIVWFFIQLRKNWLGWIIAFVFTALFLLNSNWNHEQNAVQQQPSHSQFQRIQNYAELQQVLANNPKSVAMLDLY
    ADW
    CVACKEFEKYTFSASNVQPLFEHILLLQVDMTKNSPDNTELMKQLTVLGLPTIIFFDQSGKEIEQARITGFMNNNEF
    EQWLKSNVLP

    >gi|113460970|ref|YP_719037.1| HesB family protein [Haemophilus somnus 129PT]
    MADLAVPLTFTDAAANKVKTLISEEENTELKLRVYITGGGCSGFQYGFTFDEKTNDGDLIVENSGVKLVVDPMSLQYLVG
    GTVDYTEGLEGSRFIVNNPNASTTCGCGSSFSI

    >gi|113461045|ref|YP_719112.1| thiamine biosynthesis protein ThiI [Haemophilus somnus 129PT]
    MKFIIKLFPEIMIKSESVRKRFVKILTGNIRNVLNKYDDTVAVVKHWDYIEVRSKNIENRILLVELLGRIPGIHHFLEVE
    EKPFVTLHDIFEQTLSDVATQIENKTFCVRVKRKGKHDFSSLDAERYIGGGLNQAVASAKVQLSKPDVTVRIDIENDKMM
    LIKARHQGIGGYPIGTQEDVLSLISGGFDSGVSSYMLIRRGSRVHYCFFNLGGATHEIGVKQMAYHIWKRFSGSHKVRFV
    AINFEQVVAEILEKVDNGQMGVVLKRMMVRAASKVAQRFGIQAIVTGEALGQVSSQTLTNLRLIDEAAESLVLRPLITHD
    KEQIIAKAKEIGTEDIAKSMPEFCGVISKSPTVKAVKEKIEQEESYFDFSVLESAVQNAQYLDIRQIAEQTKKEVFEVDE
    ITVLSANDVILDIRSPEEVDDKPLEISGQNIILMPFYKLSSHFAELDQSKNYVLY
    CERGVMSKLQALYLREKGFDNVKVL
    NKIS

    >gi|113461055|ref|YP_719122.1| molybdopterin biosynthesis protein MoeB [Haemophilus somnus 129PT]
    MQIELSTIEELRYNRQIIMKQIDFDGQEKLKGTKMLIVGLGGLGCAAAQYLACTGVGHLTLLDFDTVSLSNLQRQVLHND
    ERLNMLKVQSAKIALQQLNPHIEIQCIAEKLNEEKLAEIVPHFDAVLDCTDNVEIRNQLDRCCLATKTPLVSGAAIRMEG
    QVSVFTYEENTPTYQHLSRLFGENTLS
    CVEAGVLSPIVGIVGAIQALEAIKVRLNIGKILSGRLLMIDGLNMKIREINIP
    SE

    >gi|113461145|ref|YP_719213.1| arsenate reductase [Haemophilus somnus 129PT]
    MTVKIYHNPRCSKSRETLALLEQQSILFDVELYLQQTYSVEELQTLAQKLGITSVREMMRTKDDLYLQLGLNSQELTEQQ
    LLIALSQNSALLERPIVVNGDKAKIGRPPESVLAIL

    >gi|113461177|ref|YP_719246.1| glutaredoxin-like protein [Haemophilus somnus 129PT]
    METLDKIKKQISENPILIYMKGSPKFPSCGFSARAVEVLINCNVPFGYVDILQHPDIRAALPNYANWPTFPQLWVEGELI
    GGCDIMLEMFQQGELQSLLSEVAARYPQ

    >gi|113461202|ref|YP_719271.1| Na(+)-translocating NADH-quinone reductase subunit E [Haemophilus somnus 129PT]
    MIDYILLIISTALINNFVLVKFLGLCPFMGVSKKIETAIGMGLATMFVLTVASLCAYLVEHYLLTPLHANFLRTLIFILV
    IAVVVQFTEMVIHKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNINLAHNLTQSVIYGFSASLGFSLVLVLFAALRERLTA
    ADIPLPFRGASIALITAGLMSLAFMGFSGLVRV

    >gi|113461203|ref|YP_719272.1| electron transport complex protein RnfB [Haemophilus somnus 129PT]
    MATLHYVLLVVVLLAVLFGVILGFASIKLKVEGDPIVEKIDALLPQSQCAQCGYPGCKPYAQAIANGDEITKCVPGGQPL
    VIKIADLLGIEAPAGNFEKDPLPKVAFIDEDMCIGCTKCIQACPVDAIIGTNKAMHTIIADLCTGCELCVAPCPTDCISM
    INVKQHIDNWDWKFDPKLVIPIIDTTSAQKKIVVGE

    >gi|113461207|ref|YP_719276.1| SoxR-reducing system protein RsxE [Haemophilus somnus 129PT]
    MTVNKVKTESVWANLFKQGFWHNNPALVQLLGLCPLLAVSNSATNALGLGIATIIVLICSNTVVSLFRKQIPQEIRIPIY
    VMIIATTVTIVQLIMNAYTYTLYQALGIFIPLIVTN
    CIVIGRAEAFASKNTVLHSIFDGFAMGLGMTFSLFILGALREIF
    GTGKLFFGIENLFGDWAKCLQLNLFQLDNSFLLAILPPGAFIGLGIMLAIKNVIDHRK

    >gi|113461236|ref|YP_719305.1| dihydrolipoamide dehydrogenase [Haemophilus somnus 129PT]
    MNKEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERFSTLGGVCLNVGCIPSKALLHVAKVIEEAKSLSAHGIVFGEPT
    TDIDKIRGWKEKVINQLTSGLAGMAKQRKVQVVNGYGKFSGPNAIIVAGDEGETKITFDNAIIAAGSRPIQLPFIPHEDP
    RIWDSTDALKLKEVPENLLIMGGGIIGLEMGTVYHALGSKIDVVEMFDQVIPAADKDMVQIYTKRIEKKFNLLLETKVTA
    VEAKEDGIYVSMEGKAASETRRYDAVLVAIGRVPNGKLIDAGIAGVEVDDRGFIRTDKQMRTNVPHIFAIGDVVGQPMLA
    HKGVHEGHVAAEVIAGQKHYFDPKVIPSIAYTEPEVAWVGKTEKECKAEGINYEVAKFPWAASGRAIASDCADGMTKLIF
    DKDTHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDLALTIHAHPTLHESVGLAAEVFEGSITDLPNPKAKKKK

    >gi|113461249|ref|YP_719318.1| glutathione reductase [Haemophilus somnus 129PT]
    MTKHYDYIAIGGGSGGIASINRAASYGKKCAIIEAKYLGGTCVNVGCVPKKVMFYGAQVAEAITKYAPDYGFDVTLNHFD
    FAKLVESRQAYIDRIHTSYNNVLAKNNVDVLNGFAKFFDAKTIEVSYANGEKELVTADHILIATGGRPSRPTIPGAEYGI
    DSDVFFALTELPKRIAVVGAGYIAVELAGVVNSLGAETHLFVRRQTPIRSFDPLIIETLVEVMKQDGIQLHTQAIPQEII
    KNADNSLTIKLEDGRTQDVDCLIWAIGREPATDVINLASTGVETNERGFIKVDKYQNTNVEGIYAVGDIIEGGIELTPVA
    VAAGRRLSERLFNNKPDEHLDYHLVPTVVFSHPTIGTVGLTEPKAIEQYGAEAVKVYTSSFTPMYSAVTSHRQPCRMKLV
    CVGKEEKIVGLHAIGFGVDEMIQGFAVAIKMGATKADFDNTVAIHPTGSEEFVTMR

    >gi|113461291|ref|YP_719360.1| thioredoxin reductase [Haemophilus somnus 129PT]
    MSDFKHSQLLILGSGPAGYTAAIYAARANLKPVLVTGLQQGGQLTTTTEIENWPGDFGDTTGPELMQRMLQHAEKFDTEI
    VFDHINNVDLSERPFKLFGDAGAYSCDALIIATGASARYLGLPSEETYKGRGVSA
    CATCDGFFYRNKPVAVVGGGNTAVE
    EALYLANIASEVHLIHRRDTFRAEKILIDRLNKKVEEGKIILHTNRTLAEVLGDNMGVTGIRLKNTQTENVEDLKLEGVF
    IAIGHAPNTELFANQLELNNGYIVVKSGLEGNATATSVQGVFAAGDVMDHNYRQAITSAGTGCMAALDAERFLDTQK

    >gi|113461294|ref|YP_719363.1| hypothetical protein HS_1151 [Haemophilus somnus 129PT]
    MTTFTDWKEHTAHVKKSFGELGKSHPKMLQAYINLDQAAAAEALDEKTRELIAIAVAITTRCESCISVHAEKAAKAGATE
    SEIAGALATAIALNAGAAYTYALRALEAVKEQS

    >gi|113461487|ref|YP_719556.1| thioredoxin [Haemophilus somnus 129PT]
    MSEVLHTTDATFDTDVLKSDIPVLLDFWAPWCGPCRMIGPILEELSAELGDKVKIVKINIDENQATPAQFGVRSIPTLIF
    FKEGKAVATQVGALPKNQLVNFINQNS

    >gi|113461616|ref|YP_719685.1| thiol:disulfide interchange protein [Haemophilus somnus 129PT]
    MKKFLMVSLAMLMSTFVKADDNNVTIRKNLQKLGMTDVEIMESPIKNIKSVLTREGTLYVSEDGKYVLHGALYEITDKGI
    VNLTTKSLLVKLNNLKNEMIVYPSKKEKYVITVFMDIT
    CHYCHLLHQKIKEYNELGITVRYLAFPRAGLNSNTAKQMEAI
    WTSRDPVFALDEAEKGNLPKELKIPNMIQKHYELGIQFGVSGTPSIITESGEVIGGYVEPKKLLQVLEDIRE

    >gi|113461685|ref|YP_719754.1| methylated-DNA-protein-cysteine methyltransferase [Haemophilus somnus 129PT]
    MQPIFYCYYHSPMGRLLMLSQHNQLTNLDVELEQIEPNPHWIFNQNLPLFLQVKSALDRYFTGEAEDFSDLPLHPQGTKF
    QQKIWQALRRIPYGQSASYSELARFIDHPKAVRAVGGAVGRNPISIIIP
    CHRILGKQKQLTGFGGGLPAKRYLLQLEKID
    YIDRGIEYVKPKLLQKYHQS

    >gi|113461771|ref|YP_719840.1| hypothetical protein HS_1635 [Haemophilus somnus 129PT]
    MRYVLAVKQPVYGTQGAYLAYQFAQTLLAKGHQIEQIFFFQQGVTLGNAFVNPANDEFHLQKAWQQLSQTYSVPLHLCIS
    AAQRRGIVEPLSSNNQQQNNLAEGFILAGLGEFNKAVLQADRLITI

    >gi|113461823|ref|YP_719892.1| peptide methionine sulfoxide reductase msrA/msrB [Haemophilus somnus 129PT]
    MSNKAIYLAGGCFWGVEGYFHRIDGVLDAISGYANGKTENPSYQDVLYNNTGHAETVKVIYEQNKLSLEDILQYYFRVID
    PTSLNQQGNDKGTQYRTGIYYTDPQDREIILTALTQEQKKYSKPIVVEVLPLQRFDPAEEYHQDYLLKNPNGYCHIDIKK
    ADEPLVKTYK

    >gi|113461825|ref|YP_719894.1| Na(+)-translocating NADH-quinone reductase subunit E [Haemophilus somnus 129PT]
    MEHYISLFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVTVVLGISVPVNQLVYSLILKDGALIDGVDLSFLNF
    ITFIGVIAALVQILEMILDKYFPALYNALGIFLPLITVN
    CAIFGGVSFMVQRDYNFAESVVYGIGAGTGWMLAIVALAGI
    TEKMKYADVPAGLRGLGITFITVGLMALGFMSFSGVQL

    >gi|113461826|ref|YP_719895.1| Na(+)-translocating NADH-quinone reductase subunit D [Haemophilus somnus 129PT]
    MANANIKKLLLSPITDNNPIALQILGICSALAVTTKLETAVVMAIAVSLVTAFSSFFISLIRNYIPNSIRIIVQMAIIAS
    LVILVDQILRAYAYGLSKQLSVFVGLIITN
    CIVMGRAEAFAMKSAPIESFVDGIGNGLGYGAILVTVAFIRELIGSGKLF
    GMTIFQTIQDGGWYQTNGLFLLAPSAFFIIGFIIWGLRTWKPEQVEK