Haemophilus parasuis SH0165 uid59273

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|219870314|ref|YP_002474689.1| methylated DNA-protein cysteine methyltransferase [Haemophilus parasuis SH0165]
    MKFQIFYQFYHSPVGRLLLIANKTGLLGIEFEQEQQTLNLQQWKSSEQASGEIQQLFCKTVQVLDRYFSGEKVAFCQLDF
    LNPQGTAFQQAVWKILLEIPYGKTVSYGDIAKQLNNPNAVRAVGGAVGRNPISILIP
    CHRVLGKTQALTGFGGGLPAKRY
    LLELEGISYQNKGTEFVNPKHKKWTSI

    >gi|219870333|ref|YP_002474708.1| iron-binding protein, HesB family iron-sulfur (Fe-S) cluster formation protein [Haemophilus parasuis SH0165]
    MSITLTETAADRVRTFLENRGKGIGLRLGVKTSGCSGLAYVLEFVDVLNEDDHVFEQHGVKIIVDEKSLVYLSGTELDFV
    KEGLNEGFKYNNPNVKNECGCGESFNV

    >gi|219870342|ref|YP_002474717.1| glutaredoxin 1 [Haemophilus parasuis SH0165]
    MFVEIYGRLSCPYCVRAKQLAEKMKAELPDFDFKFVDMIAEGIEKQDLEPRVGKPVATVPQIFLDEVHVGGYSDFAPLIE
    EKFGIKL

    >gi|219870372|ref|YP_002474747.1| disulfide bond formation protein B (Disulfide oxidoreductase) [Haemophilus parasuis SH0165]
    MLTYFKELSISRSAWLLLTASCTALEATALYFQHGMGLNPCVMCIYERLALLAILIAGIIGFLAPRKTLVRWLALLLGLF
    GSIKGLSLAIKHTDYQLNPAPWNQ
    CSPFVDFPETLPLNKWFPDLFEATGKGDCGKVVWQFLDLSMPQWLIAIFSAYLAVF
    IVIILSQFKRSHSSRNLFR

    >gi|219870452|ref|YP_002474827.1| thiol:disulfide interchange protein DsbC precursor [Haemophilus parasuis SH0165]
    MKKSLLTLISLAILGTVQANDKNLQQQLEKIGATNVKLSESALPGFKTAISDQGVVQISNDGRYVIHGQIFELKDGKVTD
    ITNRALLAELNSLAKEMIVYPAKNEKHVVTVFMDIT
    CHYCHLLHSKIKEYNDLGITIRYLAFPRGGMNTETAKQMEAIWT
    EKDPAFALNEAEKGNLPKQVKTPNIVKKHYELGIKFGVTGTPNIVTKEGELIAGYVEPKELLKMLSH

    >gi|219870519|ref|YP_002474894.1| putative macrophage infectivity potentiator-related protein, peroxidase/antioxidase [Haemophilus parasuis SH0165]
    MSKFQIHTIDTAPEAAKEALQAVKNNNGFIPNLIGVLANAPTALETYRTVGAINQRTSLTPTEREVVQITAAVANGCGFC
    VAGHTAISIKQIKMPDELLQALRKATPIQDNKLDTLARFTLAVINTKGKVGETLLNEFFAVGYTQQNALDVVLGVSLASL
    CNYANNLADTPINPELQPYA

    >gi|219870616|ref|YP_002474991.1| thioredoxin-dependent thiol peroxidase [Haemophilus parasuis SH0165]
    MDTLKVGDTVPSFSLLDQNFNWVTLDQFPNKKFLIYFYPKALTPGCTSQACGLRDSKEELDSLNVMVLGISPDSPEKLAK
    FLEKNSLNFILLSDVDHKVAEAFGVWGKKKFLGKSYDGVHRISFLVDEYGKIMSVFNKFKTKEHHQLVINFLKGNSDGE

    >gi|219870695|ref|YP_002475070.1| molybdopterin biosynthesis protein MoeB [Haemophilus parasuis SH0165]
    MLNSEILRYNRQIILKSIDFDGQEKLKASRALIVGLGGLGCAASQYLASSGIGYLTLVDFDTVSLSNLQRQVLHSDATIG
    MPKVESAKKRLHELNPHIQIETINAYLEEDEWAKLIPQFDVVLDCTDNVTIRNTLNKICFNVKKPLVSGSALRFEGQVSV
    FLYQKQDPCYHCLSQLFGENTLS
    CVEAGVIAPIVGIIGSLQALETIKVLLNIGQILSGRLLVIDGLNFSIREMKLLKQSN
    CSICSKE

    >gi|219870728|ref|YP_002475103.1| dihydrolipoamide dehydrogenase [Haemophilus parasuis SH0165]
    MSQEIKTQVVVLGAGPAGYSAAFRCADLGLETVLVERYSTLGGVCLNVGCIPSKALLHVAKIIEEAKRAEHNGITFGEPT
    IDLDKVRAGKEAVVAKLTGGLAGMAKARKVTVVEGQATFADPHTLVARDRDGHPTTIKFDNAIIAAGSRPIQLPFIPHHD
    PRIWDSTDALKLKEIPKKLLIMGGGIIGLEMGTVYQALGSEVEVVEMFDQVIPAADKDVVAIFTKRIEKKFKLMLETKVT
    AVEAKDDGIYVSMEGKACNDTKRYDAVLVAIGRVPNGKLLDAGKAGVNVDDRGFIAVDKQMRTNVPHIFAIGDIVGQPML
    AHKGVHEGHVAAEVIAGQKHYFDPKVIPSIAYTEPEVAWVGKTEKECKQEGLNYEVAKFPWAASGRAIASECADGMTKLI
    FDKDTHRLLGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNPKAKKR

    >gi|219870760|ref|YP_002475135.1| phosphoribosylformylglycinamidine synthase [Haemophilus parasuis SH0165]
    MKKIMGLLLMLFSFNAFAEENKNLADIQFKDLDNNIVSLEKYKGKNVYVKMWASWCPICLAGLAEIDDLSADQNKNFEVI
    TIVSPDKKGEKSTEKFIEWYKGLDYKNVVVLLDEQGEVLKRAKVRGYPSNVFLDSELNVKKVVPGHLSTTQITESINSK

    >gi|219870762|ref|YP_002475137.1| bifunctional methionine sulfoxide reductase msrA/msrB [Haemophilus parasuis SH0165]
    MKSHKTVLFTLIMSAISNNSLAINHTNNSSKEMSKMTQTQNENIREIYLAGGCFWGIEAYMERIYGVKNATSGYANGKTD
    KTHYHIIGKTDHAETVHITYDANKISLEKLLKYYFQVIDPTSLNKQGNDRGRQYRTGIYYQNEQDKAIILKEIEALQTKY
    KDKIQVEVEPLKHYILAEEYHQDYLKKNPNGYCHIDLEQANNIIIDPKDYPKPSDEELKAKLTPLQYSVTQKKNTERSFS
    NEYWDNKKDGLYVDITTGEPLFSSRDKYDSGCGWPSFTKPIDKNVVTYQKDTSFNMIRTEVLSRSGKAHLGHVFDDGPKD
    KGGLRY
    CINSAAIKFIPLEQMEKENYGYLINLIKGK

    >gi|219870885|ref|YP_002475260.1| selenophosphate synthase [Haemophilus parasuis SH0165]
    MQNEPIRLTQYSHGAGCGCKISPKVLEQILHTEQAKFIDPNLLVGNETKDDAAVYDIGNGVGIVSTTDFFMPIVDDPFDF
    GRIAATNAISDIFAMGGKPIMAIAILGFPINKLPAEVAQKIVDGGRFACQQAGIALAGGHSIDSPEPIFGLAVTGIISTE
    QVKKNASAQADCDLYLTKPLGIGVLTTAEKQGKLKPEHKNLARNVMCQMNLIGAEFAKVDEITAMTDVTGFGLLGHLTEI
    CQGSNLRAEVYFDQIQTLDGVREYIAQGAVPGGTTRNFDSYGHLISPLSDEQKAILCDPQTSGGLLIAVKPQAVESVKQI
    AKNANVALYPVGRLLKAESGKVLIEVK

    >gi|219871147|ref|YP_002475522.1| arsenate reductase [Haemophilus parasuis SH0165]
    MTKIYGIKNCDTVKKAIKWLADNDLNPQLHDYRVDGLDPVWLAEMAEKFGWENLVNKRSTTWRGLDDEIKNNLTKELALK
    VLNEQPTLIKRPIVIADDAALIGFDEKEYQKVFMK

    >gi|219871181|ref|YP_002475556.1| thioredoxin reductase [Haemophilus parasuis SH0165]
    MATKHAKLLILGSGPAGYTAAVYAARANLNPVLVTGMQQGGQLTTTTEIENWPGEFGDITGSELMNKMQKHAEKFNTEII
    FDHINSVDLSQRPFTLKGDFNTFTCDALIIATGASAKYLGLPSEEAYKGRGVSA
    CATCDGFFYRNKPVAVIGGGNTAVEE
    ALYLSNVASVVHLVHRRDTFRSEKILIDRLMKKVEEGKVILHTHSVLDEVLGDNMGVTGVRLKCTQTGNEEQITLDGVFV
    AIGHSPNTEIFKDQLELNNGYIVVKSGLDGNATATSVAGVFAAGDVMDHNYRQAITSAGTGCMAALDAEHFLEYCS

    >gi|219871273|ref|YP_002475648.1| Na(+)-translocating NADH-quinone reductase subunit D [Haemophilus parasuis SH0165]
    MASNKLKDLLLSPVVNNNPIALQILGICSALAVTTKLETAVVMGIAVSFVTGFSSMFIAMIRNYIPNSIRIIVQMAIIAS
    LVILVDQLLRAYAYDLSKQLSVFVGLIITN
    CIVMGRAEAFAMKSGPVESFVDGIGNGLGYGAILVIVAFIRELIGSGKLF
    GMTVFQTVQDGGWYQANGLFLLAPSAFFIIGFLIWGLRTWKPEQVEK

    >gi|219871274|ref|YP_002475649.1| Na(+)-translocating NADH-quinone reductase subunit E [Haemophilus parasuis SH0165]
    MEHYLSLFVKSIFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVIVVLGIAVPANQIVYENILKDGALVEGVDLTFLNF
    ITFIGVIAALVQILEMILDKFFPALYSALGIFLPLITVN
    CAIFGAVSFMVQREYNFAESVVYGIGAGTGWMLAIVALAGI
    TEKMKYSDVPAGLKGLGITFISAGLMALGFMSFSGIKL

    >gi|219871310|ref|YP_002475685.1| thiol:disulfide interchange protein DsbE [Haemophilus parasuis SH0165]
    MKKGLLFLPLVILFAVVLFLVMQLKEKDNVSLSEDWQGKPLPEFSLKHLLDNQAVISKASLPNEPFILNVWASWCTWCIK
    EFPILLEMKQQGVKIVGLTYADRPENARQALAQWGNPFELVIDDWDKGFLTETLRISSAPSSYLIDKNGIVRYQQKGYNP
    NFAQDFMPRLQALKEQNK

    >gi|219871384|ref|YP_002475759.1| thiol-disulfide interchange protein [Haemophilus parasuis SH0165]
    MKAKLLIPLIVFLGLIIAFTIQLQRNANGEDPKALESALVGKTIPEFKLESLHEATQMLDSSVVKTGTPRLLNVWATWCP
    T
    CFAEHQFLTVLAKQGVEIVGIDYKDERAKALKFLKDYGDPYKTIVYDPKGSLGLDLGVYGAPETFIIDGNGKIHYRHTG
    DVNEKVWNEVLKPMYEKLK

    >gi|219871520|ref|YP_002475895.1| rhodanese-related sulfur transferase [Haemophilus parasuis SH0165]
    MEETFTEITPQQAWEMMQNEDAVLVDIRDMVRFSHSRPQGAFHLTNHSYGKFLDEYDYDEPVIVSCYHGVSSRNTAQYLV
    EQGFERVYSVKGGFEGWVRSELPIELGY

    >gi|219871536|ref|YP_002475911.1| glutathione reductase [Haemophilus parasuis SH0165]
    MTKHYDYIAIGGGSGGIASINRAASYGKKCAIIEAKHLGGTCVNVGCVPKKVMFYGAQIAEAINRYASDYGFDVTVNRFD
    YRKLVENRQAYIGRIHTSYNNVLARNNVDVIRGFAKFVNKNTVEVALADGGVEQITADHILIATGGRPSRPAIKGAEYGI
    DSDGVFALNDVPKRVAVVGAGYIAVELAGVLNSLGAETHLFVRQHAPLRTFDPLIVETLLEVMHQDGIQLHTHAIPQEVV
    KNADGSLTLKLENAEEQSVDCLVWAIGREPATDVINLEAAGVATNERGFVKVDKFQNTNVEGIYAVGDIIEGGIELTPVA
    VAAGRRLSERLFNNRPNEHLDYNLVPTVVFSHPPIGTIGLTEPKAVEQYGAENVKVYKSSFTPMYSAVTQHRQPCRMKLV
    CVGKEEKIVGLHGIGFGVDEMMQGFAVAIKMGATKADFDNTVAIHPTGSEEFVTMR

    >gi|219871608|ref|YP_002475983.1| putative metal-activated pyridoxal enzyme [Haemophilus parasuis SH0165]
    MKNILTRPVVAGAALGIVGLLAGVFAGIFFFKRGFSHGKSGEQSTASSIVPIFIVIALFIALITQFRFGENLPIFFSEKA
    PAAQHANLWLSLGAGVLVGIVMQRSRFCSIGAFRNFILSKDSYLLNGIVALVVCTSITNLMLGQFKLGFEQQPIAHNDVV
    WNFLSMTLCGLCFSFAGG
    CPGKQLVHLGEGNNDAALFLVGMLLGAAAAHNFSLAASGTGISTFTPYGVGLGLLFCLYIGF
    TNKSTH

    >gi|219871674|ref|YP_002476049.1| sulfurtransferase TusD-like protein involved in intracellular sulfur reduction [Haemophilus parasuis SH0165]
    MRYVLAVKHGVYGSQGAYLAYQVAQALLDQGHRIEQIFFFQDGVSNANQLIDPASDELNLVEAWKTLAQSHRLSLHLCIA
    AAQRRGIVEQNLAEGFTLAGLGEFSQAVFTADRLLTI

    >gi|219871678|ref|YP_002476053.1| thiol disulfide oxidoreductase [Haemophilus parasuis SH0165]
    MKFRNCIYFISLWLFISSLFAEEPTKTPLFQDGKGYYSYKKPLDILLPKDNRVLITYFYQYGCEVCLNGDDYLKQYASRH
    SDKVVLERVAAFSENKYGITVSLNALFSELGKPELSEKYLFDSSYQNDRLITNGEAITKWLNKHQISLDTVEQVRKQENY
    PKRISQNYELIKRYSPPVIPMAVLNGKYILTKSTLYNDDYTYAVLDFLVDKLQKEQQGVTK

    >gi|219871785|ref|YP_002476160.1| electron transport complex protein RnfE/SoxR-reducing system protein RsxE [Haemophilus parasuis SH0165]
    MQETQIPITQIDETPKAVEPSVWKNLFTQGVWTNNSTLVQLLGLCPLLAVSNNVTNALGLGLATLLVLTITNTIISLFRK
    VIPHDIRIPIYVMIIATAVTTIQLLMNAFAFPVYQSLGIFVPLIVTN
    CIVIGRAEAFASKNSVAHSAFDGFAMGLGMTLS
    LVVLGAIREIIGNGTLFDGLDLLLGSWAKALRMDLLHLDSGLLLAILPPGAFIGLGLILAVKNIIDRKK

    >gi|219871792|ref|YP_002476167.1| electron transport complex, RnfABCDGE type, A subunit/NADH:ubiquinone oxidoreductase, subunit RnfA [Haemophilus parasuis SH0165]
    MVEYILLIISTALINNFVLVKFLGLCPFMGVSKKVETAIGMGMATTFVLTVASLSAYLVETYLLIPLEAEFLRTLVFILV
    IAVIVQLTEMIVHKTSSALYRLLGIYLPLITTN
    CAVLGVALLNVNLSNNLVQSVLYGFGAAAGFSLVLVLFSALRERLVA
    ADVPRAFQGASIALITAGLMSLAFMGFTGLVKI

    >gi|219871855|ref|YP_002476230.1| thiol:disulfide interchange protein DsbD precursor [Haemophilus parasuis SH0165]
    MFKIIFTLFSLSTFYLPATASLFSSQPKFLPGDQAFVFSSQQQADQLQLAWQIADGYYLYKKEIAISSNNAKLGEPQFPT
    AERYQDEFFGEVEIYRNQLTIPVALEANATGQVVVRYQGCTKGFCYPPEEVTLDLQAATSADNVAKNTADVTAPPVAQPK
    AEQNQLAETLAENRLSIFWFFVLGLGLAFTPCVLPMLPLLSAIVIGSKQRPNSVRAFLLSLSYVQGMAVTYTLLGLLVAA
    IGLPFQVALQSPLVLIGLSLLFILLAMSMFGLFTLQLPHRWQQKLNQLSQQQQGGSFFSVFVMGMIAGLVASPCTSAPLS
    GALLYVAQSGDLLTGGLALYLLALGMGIPLMLVTLFGNRILPKSGDWLLKVKTLFGFVMLALPVFLLSRVLPTVIEPLLW
    SALAIAFLLWLNEQCDGLQGWKKVFRLLVLATLVVASKPWLDLAWQPTPVNQTQSNHFKRIHSLAELEQQLTANKGKKVM
    LDLYADW
    CVACKEFEKYTFVDPKVQAKLAEMAVLQIDMTKNSGENDELMKHFQVLGLPTILFFDEQGRELSQSRVTGFMQ
    AGDFVQWLNGLTQ

    >gi|219871889|ref|YP_002476264.1| thioredoxin-like protein [Haemophilus parasuis SH0165]
    MKKHGIINCSMKNILLFVSLFVLINTAADWFRRPNPSHQFAEQVLYDLEKNPQIIAQLSHQKSLLLYFWGSWCKFCEYTS
    PSISQLVLDGANVLSIALKSGSDDEVKQYMKAHQYHFVTINDPIGTFSKSWDIQATPTLIIVKDGKMISHTTGFSTYWGI
    KIRLWLADWVR

    >gi|219871890|ref|YP_002476265.1| Thiol:disulfide interchange protein dsbA precursor [Haemophilus parasuis SH0165]
    MAQDPVANKEYLEVRQVPSAQKEVLEFFSFYCPHCYDFELNYKIPSKVKAGLPEGAVLKQYHVDFLGRQSTELTRAWALA
    MALGAEDKVKTPLFEAAQKDAIKSMDDIRAIFLANGITAEQFDGGINSFAVNGLVTKQTQAAEEFKVRGVPAFFVNEQYQ
    LNPEGFSDSGSTNEFVQRYIDAILFLVKK

    >gi|219871931|ref|YP_002476306.1| glutathione S-transferase [Haemophilus parasuis SH0165]
    MKLYYLPGACSFVPHTALEWIGKPYEAEAVNRDKIKSPEYLALNPQGAVPLLVDGDFALSQNIAILTYLDSLYPEAKLFG
    SDTAQDKAKAMRWLSFFNSDVHKAFTPFFRVPPYAQGNEALTVEIRQNAADNMLRMLEIANDHLEHHAFFGERLCVTDVY
    LYTMLGWAKRVGLDVSHLTHFKSFIERVEADKGVDAVRVQEGLK

    >gi|219872095|ref|YP_002476470.1| iron-sulfur cluster insertion protein ErpA [Haemophilus parasuis SH0165]
    MSDILVPLIFTDAAAKKVKFLIEGEENPELRLRVYITGGGCSGFQYGFTFDDKLNEGDLTIENLDVALVIDPMSLQYLIG
    ATIDYVEGLDGSRFVVQNPNASSTCGCGASFSI

    >gi|219872113|ref|YP_002476488.1| thiol peroxidase [Haemophilus parasuis SH0165]
    MTQITLAGNPIEVAGQFPQADSFVADFTLVSNGLENVSLSDFAGKRKVLNIFPSIDTGICATSVRVFNKEAAELANTVVL
    CISADLPFAQARFCGAEGIANAQTLSTFRNKAFHQAVGVDIATGPLAGLTARAVIVLDENNKVLHSELVPEIKQEPDYAA
    ALAVLK

    >gi|219872185|ref|YP_002476560.1| monothiol glutaredoxin-like protein [Haemophilus parasuis SH0165]
    METIEKIQKQISENPILLYMKGSPKFPSCGFSARASEAIVNCQVPFGYVDVLSNPDIRAELPKYANWPTFPQLWVDGELI
    GGCDIVLEMFQKGELQTLLKDTAKKYSL

    >gi|219872296|ref|YP_002476671.1| thioredoxin [Haemophilus parasuis SH0165]
    MSTVIHTTDASFEQDVLKSDVPVLLDFWAPWCGPCRAIGPVLDDLAINLGNKARIVKMNVDENQQIPAEFGVRSIPFLLI
    FKNGEVVAQQVGAQNLPAFLEHLS