Haemophilus influenzae Rd KW20 uid57771

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|16272058|ref|NP_438257.1| thioredoxin [Haemophilus influenzae Rd KW20]
    MSEVLHINDADFESVVVNSDIPILLDFWAPWCGPCKMIAPVLDELAPEFAGKVKIVKMNVDDNQATPAQFGVRSIPTLLL
    IKNGQVVATQVGALPKTQLANFINQHI

    >gi|16272077|ref|NP_438277.1| hypothetical protein HI0103 [Haemophilus influenzae Rd KW20]
    MITVYGIKNCDTVKKALKWLADHNIEHKLHDYRVDGLDLNFLTQAETQFGWDVLVNKRSTTWRNLDEQVKNSLDKTTALS
    VLAENPTLIKRPIILQDGKALIGFNEKEYQAAFA

    >gi|16272085|ref|NP_438285.1| glutathione transferase [Haemophilus influenzae Rd KW20]
    MKLYGLIGACSFVPHVALEWVKIRENADYEFEPVTRELIKSPEFLSLNPRGAVPVLVDGDLVLSQNQAILHYLDELYPNS
    KLFGSKTVRDKAKAARWLAFFNSDVHKSFVPLFRLPNYAKDNETLAHTIRQQAVEQILDQLAVANEHLESHIYFGENISV
    ADAYLYIMLNWCKAVKIDFSHLTQLSAFMQRVETDQAVENVRKSEELKV

    >gi|16272128|ref|NP_438331.1| glutathione reductase [Haemophilus influenzae Rd KW20]
    MTKHYDYIAIGGGSGGIASLNRAASYGKKCAIIEAKHLGGTCVNVGCVPKKVMFYGAHIAEAINNYAPDYGFDVEVKKFD
    FSKLIESRQAYISRIHTSYNNVLAKNNIDVINGFGKFVDAHTIEVTLADGTKEQVTADHILIATGGRPYRPNIKGQEYGI
    DSDGFFALTELPKRAAVIGAGYIAVELSGVLNSLGVETHLLVRRHAPMRNQDPLIVETLVEVLAQDGIQLHTNSTPSEIV
    KNADGSLTVRCDGQSDVTVDCVIWAAGRVPTTDKIGLENAGVETNEHGYVKVDKYQNTNVKGIYAVGDIIENGIELTPVA
    VAAGRRLSERLFNNKPTEYLDYSLVPTVVFSHPPIGTVGLTEPQAIEQYGAENVKVYKSSFTAMYTAVTQHRQPCKMKLV
    CVGKDEKVVGLHGIGFGVDEMIQGFAVAIKMGATKADFDNTVAIHPTGSEEFVTMR

    >gi|16272134|ref|NP_438337.1| Na(+)-translocating NADH-quinone reductase subunit D [Haemophilus influenzae Rd KW20]
    MSGKTSYKDLLLAPIAKNNPIALQILGICSALAVTTKLETAFVMAIAVTLVTGLSNLFVSLIRNYIPNSIRIIVQLAIIA
    SLVIVVDQILKAYAYGLSKQLSVFVGLIITN
    CIVMGRAEAFAMKSPPVESFVDGIGNGLGYGSMLIIVAFFRELIGSGKL
    FGMTIFETIQNGGWYQANGLFLLAPSAFFIIGFVIWGLRTWKPEQQEK

    >gi|16272135|ref|NP_438338.1| Na(+)-translocating NADH-quinone reductase subunit E [Haemophilus influenzae Rd KW20]
    MEHYISLFVKAVFIENMALSFFLGMCTFLAVSKKVSPAFGLGIAVTFVLGIAVPVNQLIYANVLKENALIEGVDLSFLNF
    ITFIGVIAGLVQILEMVLDKFMPSLYNALGIFLPLIAVN
    CAIFGGVSFMVQRDYNFPESIVYGFGSGLGWMLAIVALAGL
    TEKMKYADIPAGLKGLGITFISVGLMALGFMSFSGIQL

    >gi|16272198|ref|NP_438407.1| arsenate reductase [Haemophilus influenzae Rd KW20]
    MSVIIYHNPHCSKSRETLALLENKGIQPIIELYLQKQYSVNELQSIAKKLGIDDVRQMMRTKDELYKSLNLDNLDLSQAE
    LFKAISEHSALIERPIVINGDKAKIGRPPETVLEIL

    >gi|16272212|ref|NP_438423.1| thioredoxin-dependent thiol peroxidase [Haemophilus influenzae Rd KW20]
    MNPLSVGNQAPAFTLLNQQEKFVSLSDFRGKKVLIYFYPKALTPGCTTQACGLRDSKSELDVLGLVVLGISPDAPKKLAQ
    FIEKKELNFTLLSDPDHQVAEQFGVWGEKKFMGRTYDGIHRISFLINESGTIMQVFDKFKIKDHHQMIIDYLRSL

    >gi|16272245|ref|NP_438457.1| putative cation-transporting ATPase [Haemophilus influenzae Rd KW20]
    MLDLTPQSKKISIQIGGMTCQSCANRIEKVLNKKPFVQQAGVNFAAEEAQVVFDATQASEAQIIEIIHKTGFSAHIKQAN
    ELPIEENTSIPWRLIVLWIINIPFLIGMLGMIGGSHNLMLPPIWQFALASIVQLWLAIPFYRGAIGSIRGGLTNMDVLVS
    TGTLTIYLYSAFMLFYHANHAMGHVYFEASVMVIGFVSLGKFLEDRTKKHSLNSLSMLLQLTPKKVTVLRNEKWIEIALD
    QVNIGEIIRANQGERIAADGVIESGNGWCDESHLTGESRPEEKQKGGKVLAGAMVTEGSIIYRANQLGSQTLLGDMMNAL
    SDAQGSKAPIARFADKVTSVFVPVVLVISLVTFALTYILTNDSVSSLIHAVSVLVIACPCALGLATPAAIMVGLGKAVNA
    GVWFKDAAAMEETAHVDTVVLDKTGTLTKGELEISALWQPQSAVYSEDDLYRFAAAVERQANHPIAKAIVQAAEXKMLEI
    PTALFSKMEVGQGIQAELEQVGTIKVGKPDYCGLILPKNLEDIWQIASIVAVSINDEPIGAFALTDTLKNDSLHAIQRLQ
    QQNIDVVIMSGDQQSVVDYIAKQLGIKKAFGKLTPRDKAEQIQKLKDLGHIVAMVGDGINDAPALASANVSFAMKSSSDI
    AEQTASATLMQHSVNQLVDALFIARATLKNIKQNLFFALIYNILGIPLAAFGFLSPIIAGAAMALSSISVLMNALRLKKV
    RF

    >gi|16272324|ref|NP_438537.1| hypothetical protein HI0376 [Haemophilus influenzae Rd KW20]
    MGITLTEKAAQRVKAFLDNRGKGIGLRLGVKTSGCSGLAYVLEFVDVLNSEDQVFEQYGVNIIVDPKSLVYLNGIELDYV
    KEGLNEGFKYNNPNVKESCGCGESFHV

    >gi|16272351|ref|NP_438564.1| methylated-DNA-protein-cysteine methyltransferase [Haemophilus influenzae Rd KW20]
    MCFSFYKTRRKMTALYYTYYPSPVGRLLILSDGESITHIDFEKEQYAPNPKWHKQDELPVFQKVRLAFERYFNGEVECFS
    NIPLKPEGTAFQQAIWQALREIDYGELSTYGELALRINNPKAVRAVGGAVGSNPISIIIP
    CHRILGKDRTLTGFGGGLEA
    KRFLLQLEKIPYIDKGTENTKPRFFKKYHE

    >gi|16272376|ref|NP_438589.1| disulfide bond formation protein B [Haemophilus influenzae Rd KW20]
    MLALLKQFSEKRFVWFLLAFSSLALESTALYFQYGMGLQPCVLCVYERLAMIGLFVAGTIALLQPRVFILRLIALALGLF
    SSIKGLLISFRHLDLQMNPAPWKQ
    CEFIPNFPETLPFHQWFPFIFNPTGSCNESQWSLFGLTMVQWLVVIFSLYVVILTL
    LLIAQVIKTRKQRRLFN

    >gi|16272515|ref|NP_438729.1| peroxiredoxin hybrid Prx5 [Haemophilus influenzae Rd KW20]
    MSSMEGKKVPQVTFRTRQGDKWVDVTTSELFDNKTVIVFSLPGAFTPTCSSSHLPRYNELAPVFKKYGVDDILVVSVNDT
    FVMNAWKEDEKSENISFIPDGNGEFTEGMGMLVGKEDLGFGKRSWRYSMLVKNGVVEKMFIEPNEPGDPFKVSDADTMLK
    YLAPQHQVQESISIFTKPG
    CPFCAKAKQLLHDKGLSFEEIILGHDATIVSVRAVSGRTTVPQVFIGGKHIGGSDDLEKYF
    A

    >gi|16272519|ref|NP_438733.1| hypothetical protein HI0576 [Haemophilus influenzae Rd KW20]
    MRYVIAVKSPIYGKQGAFLAYQFAESLIKKEHEISQIFFFQDGVSNGNALVYPANDEVNLQKHWQMFSITYNVPLHLCVA
    ASQRRGVVDNLTTPTTAHYNLAEGFTIAGLGEFIAASLNADRVITL

    >gi|16272621|ref|NP_438839.1| GlpE [Haemophilus influenzae Rd KW20]
    MPFKEITPQQAWEMMQQGAILVDIRDNMRFAYSHPKGAFHLTNQSFLQFEELADFDSPIIVSCYHGVSSRNVATFLVEQG
    YKNVFSMIGGFDGWCRAELPIDTTY

    >gi|16272692|ref|NP_438910.1| thiol peroxidase [Haemophilus influenzae Rd KW20]
    MTVTLAGNPIEVGGHFPQVGEIVENFILVGNDLADVALNDFASKRKVLNIFPSIDTGVCATSVRKFNQQAAKLSNTIVLC
    ISADLPFAQARFCGAEGIENAKTVSTFRNHALHSQLGVDIQTGPLAGLTSRAVIVLDEQNNVLHSQLVEEIKEEPNYEAA
    LAVLA

    >gi|16272787|ref|NP_439006.1| periplasmic oxidoreductase [Haemophilus influenzae Rd KW20]
    MKKVLLALGLGVSTLMSVNSFAADLQEGKQYVQVSQQASQQKEVIEFFSFYCPHCYAFEMEYKIPQQVVDALPKDVKFKQ
    YHVNFLGHQSENLTRAWALAMALGAESKVKSPLFEAAQKDALKSMDDIRAIFLSNGITAEQFDGGINSFAVNGLVNKQVN
    AAEQFKVRGVPDFYVNGKFRVNPEGLNYDDFVKDYVQTVKGLLQK

    >gi|16272825|ref|NP_439046.1| thiol:disulfide interchange protein precursor [Haemophilus influenzae Rd KW20]
    MKKLFLFFTLIFTAFAANSGLFDKKQTFLKVDDAFAFSATLSTDKSQLQAHWDIADGYYLYQDKISAELVGKSNPLSLHT
    QQAAELHQDPYFGEVKVFTHSIDGIFRGAFNNADDKVEITYQGCTEGFCYPPETKVLRIGDLVVSQKQIVEKTVEKNTAL
    LSEQDRLADGLFHSKWAIFGFFVLGLGLAFTPCVLPMLPLLSAIVIGQQQRPNMMRAFSLAFLYVQGMALTYTLLGLAVA
    AIGLPFQIALQHPYVMIGLSILFVALALSMFGLFTIQLPNSLQNKLNTWSQKQTSGAFGGAFAMGMIAGLVASPCTSAPL
    SGALLYVAQSGDLFTGAVTLYLLALGMGVPLMLITLFGNKILPKSGEWMNTVKQTFGFVMLALPVFLLSRILPEVWEPRL
    WAGLATVFFIWFALQMSKNGFGYAIKIISFALAMVTVQPLQNWIWQTQTTTQSAVENMPVSQVKFKQIKNTEELDRTLAE
    NPHSIAMLDLYADW
    CVACKEFEKLTFSDPQVQQQFQNILLLQVSMTKNSPENKALMERFNVMGLPTILFFDQQNNEIKGS
    RVTGFMDADAFSNWIEKLL

    >gi|16272872|ref|NP_439095.1| thiol-disulfide interchange protein [Haemophilus influenzae Rd KW20]
    MNKKLIFFTPLFVLLGVCILLIAGLNQDPKKIASALIDKPVPEFYQANLHEPSQIVSPKEFPKQPFLLNVWGSWCGYCKE
    EHPLLIEIAKTLPIVGVDYRDNRQNGIKMLKRMGNPFILTIDDSHGELGLKLGVDGAPETYLVDENGVIRYRHSGLLDKE
    TWQTVFLPKIEALKNK

    >gi|16272981|ref|NP_439208.1| mercuric ion transport protein [Haemophilus influenzae Rd KW20]
    MASTLCCIAPLIYLVFGVSSTWLIGLGEYDYLRIPMLIISLCAFAYGFWLLMFSKKIICSKYISRKKLIVLYWIVFIVMI
    FFLTYPTILPWILELAN

    >gi|16272982|ref|NP_439209.1| mercuric ion scavenger protein [Haemophilus influenzae Rd KW20]
    MKKLCTALLLSLFAISFAHANETKQIVLKVKEMNCQLCAYLVNKELRNINGVISTKASIKDGLVTVVEDPNVTNQQLFDA
    IHKLKYTAEVVN

    >gi|16272985|ref|NP_439212.1| hypothetical protein HI1053 [Haemophilus influenzae Rd KW20]
    MFTDWKEHTSHVKKSFGELGKQYPKMLQAYQALGAAAAEGNVLDAKTRELIALAVAVTTRCESCISAHAEEAVKAGASEA
    EVAAALATAIALNAGAAYTYSLRALEAYSVQKA

    >gi|16273023|ref|NP_439252.1| thiol-disulfide interchange protein [Haemophilus influenzae Rd KW20]
    MKKKLLVPLILFLSITIAFLVQLKRNAQGEDIKALESALVGKPVPAKNLTELFENKTYTNELFQQGEPVLLNVWATWCPT
    CYAEHQYLNKLAKEGVRIIGLDYKDESPKAMKWLKDLGNPYQVVLKDEKGSFGLDLGVYGAPETFIVDGKGVIHYRYAGD
    VNEKVWTQTLKPIYDKLSEQQ

    >gi|16273040|ref|NP_439272.1| thioredoxin [Haemophilus influenzae Rd KW20]
    MKIKKLLKNGLSLFLTFIVITSILDFVRRPVVPEEINKITLQDLQGNTFSLESLDQNKPTLLYFWGTWCGYCRYTSPAIN
    SLAKEGYQVVSVALRSGNEADVNDYLSKNDYHFTTVNDPKGEFAERWQINVTPTIVLLSKGKMDLVTTGLTSYWGLKVRL
    FFAEFFG

    >gi|16273083|ref|NP_439316.1| thioredoxin reductase [Haemophilus influenzae Rd KW20]
    MSDIKHAKLLILGSGPAGYTAAIYAARANLKPVLVTGLQQGGQLTTTDEIENWPGDFEMTTGSGLMQRMLQHAEKFETEI
    VFDHINRVDLSSRPFKLFGDVQNFTCDALIIATGASARYIGLPSEENYKGRGVSA
    CATCDGFFYRNKPVGVIGGGNTAVE
    EALYLANIASTVHLIHRRDSFRAEKILIDRLYKKVEEGKIVLHTDRTLDEVLGDNMGVTGLRLANTKTGEKEELKLDGLF
    VAIGHSPNTEIFQGQLELNNGYIVVKSGLDGNATATSVEGVFAAGDVMDHNYRQAITSAGTGCMAALDAERYLDAQEA

    >gi|30995428|ref|NP_439323.2| hypothetical protein HI1165 [Haemophilus influenzae Rd KW20]
    METLDKIKKQISENPILIYMKGSPKLPSCGFPARASEALMHCKVPFGYVDILQHPDIRAELPTYANWPTFPQLWVEGELI
    GGCDIILEMYQAGELQTLLAEVAAKHA

    >gi|16273132|ref|NP_439369.1| thiol-disulfide interchange protein [Haemophilus influenzae Rd KW20]
    MKKIFTALLCVAAANAMADDAAIKRKLQSFNISNIVIKSSPISGIKTAVTDQGILYVSEDGKYLFEGKLYELTNNGPVDV
    AGKILVDKLNSYKDEMIVYPAKNEKHVVTVFMDIT
    CHYCHLLHQQLKEYNDLGITVRYLAFPRAGMNNQTAKQMEAIWTA
    KDPVFALNEAEKGNLPKEVKTPNIVKKHYELGIQFGVRGTPSIVTSTGELIGGYLKPADLLRALEETAQ

    >gi|30995432|ref|NP_439371.2| thiol-disulfide interchange protein [Haemophilus influenzae Rd KW20]
    MKLKGLLAFCLLFLSSFVLAEVNQKEFSVQNSPHLPSRDTIYFEDGRDYFSYKEPIEQASRTDKKIRIQFFFDYDCRVCS
    SAQDILELYSQIRTYKVALEQYPIATADNQFSARIFYTLQALSAGELSNVLLFETSEKSRYTELSTSNKIQQWAEEQGLD
    KQLFIQTENSQSVKEQIQNAIELTEEYGVFTYPYVVIGGKYVLTASTLYNDDYSVAVLDFLVNKIEQEQKQ

    >gi|16273150|ref|NP_439387.1| dihydrolipoamide dehydrogenase [Haemophilus influenzae Rd KW20]
    MSKEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKHANKNGIYFSEPR
    IELDEVRAGKEAVVAKLTGGLAGMAKARKVTVVEGLATFTDSHTLVARDRDGNPTTVKFDNAIIAAGSRPVQLPFIPHED
    PRIWDSTDALKLKEVPKKLLIMGGGIIGLEMGTVYNALGSEVEVVEMFDQVIPAADKDVVGIYTKQVEKKFKLMLETKVT
    AVEAKDDGIYVSMEGKACNDTKRYDAVLVAIGRVPNGKLIDAGKAGVEVDDRGFIHVDKQMRTNVPHIYAIGDIVGQPML
    AHKGVHEGHVAAEVIAGQKHYFDPKVIPSIAYTEPEVAWVGKTEKECKQEGLNYEVAKFPWAASGRAIASECSEGMTKLI
    FDKDTHRVLGGAIVGSNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNAKAKEKIISI

    >gi|16273356|ref|NP_439601.1| molybdopterin biosynthesis protein MoeB [Haemophilus influenzae Rd KW20]
    MIELSHEEELRYNRQIILKSVDFDGQEKLKASKMLIVGLGGLGCAASQYLAAAGVGNLTLLDFDTVSLSNLQRQVLHCDA
    RLNMPKVESAKIALEQINPHINIETINAKLDEEKLAEIIPHFDIVLDCTDNVEIRNQLDRQCNHMKVPLISGAAIRMEGQ
    VSVFTYEPNTPTYRDLSKLFRQNVLS
    CVEAGVLAPIVGIVGCIQALEAIKVRLKIGKNLCGRLLMIDGFSMNIREIKLPT
    NME

    >gi|16273359|ref|NP_439604.1| phosphoribosylformylglycinamidine synthase [Haemophilus influenzae Rd KW20]
    MKKLLSIFLMAFSLNAFAQTNLADVQLKDLNNQPVTLSQYKGKPVYVKMWASWCPICLAGLAEIDDLSAEKDRNFEVITI
    VSPDHKGEKDTADFIEWYKGLEYKNITVLLDEKGEIIDKARVRGYPFNLFLDSDLNLKKTVPGHLGAEQIRVFAEK

    >gi|16273361|ref|NP_439606.1| bifunctional methionine sulfoxide reductase A/B protein [Haemophilus influenzae Rd KW20]
    MKLSKTFLFITALCCATPTLAIQNSTSSSGEQKMAMENTQNIREIYLAGGCFWGMEAYMERIHGVKDAISGYANGNTEKT
    SYQMIGLTDHAETVKVTYDANQISLDKLLKYYFKVIDPTSVNKQGNDRGRQYRTGIYYQDGADKAVIGQALAQLQTKYKK
    PVQIEVQPLKNYIVAEEYHQDYLKKNPNGYCHIDITKADEPVIDEKDYPKPSDAELKAKLTPLQYSVTQNKHTERSFSNE
    YWDNFQPGIYVDITTGEPVFSSNDKFESGCGWPSFTKPIIKDVVHYETDNSFNMQRTEVLSRAGNAHLGHVFDDGPKDKG
    GLRY
    CINSASIKFIPLAEMEKAGYGYLIQSIKK

    >gi|16273432|ref|NP_439681.1| glutaredoxin 1 [Haemophilus influenzae Rd KW20]
    MFVVIFGRPGCPYCVRAKNLAEKLKGEVADFDYRYVDIHAEGITKEDLSKSVGKPVETVPQIFIDEKPIGGCTDFEALMK
    EQFGIVA

    >gi|16273570|ref|NP_439825.1| Na(+)-translocating NADH-quinone reductase subunit E [Haemophilus influenzae Rd KW20]
    MTHYILLIIGTALINNFVLVKFLGLCPFMGVSKKIETAVGMGLATMFVLTVASLCAYLVDHYILIPLNATFLRTLVFILV
    IAVVVQFTEMAINKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNVNLAHNLTESVVYGFGASLGFSLVLVLFAALRERLVA
    ADIPATFRGSSIALITAGLMSLAFMGFTGLVK

    >gi|16273575|ref|NP_439830.1| SoxR-reducing system protein RsxE [Haemophilus influenzae Rd KW20]
    MTDLTEKNTALEEEKIESAVENQQKSIWKEIFAQGIWKNNPAVVQLLGLCPLLAVSSTATNALGLGLATMLVLTCTNTVI
    SLFRQYIPKEIRIPIYVMIIATTVTAVQLLMNAYTYTLYQSLGIFIPLIVTN
    CIIIGRAEAFASKNSLLHSIWDGFSMGL
    GMALSLTILGALREIIGQGTIFEGIENLFGEQAKFLTHHIYHTDSSFLLFILPPGAFIGLGLLLAIKNRIDNIKK

    >gi|16273609|ref|NP_439864.1| iron-sulfur cluster insertion protein ErpA [Haemophilus influenzae Rd KW20]
    MIDDMAVPLTFTDAAANKVKSLISEEENTDLKLRVYITGGGCSGFQYGFTFDEKVNDGDLTIEKSGVQLVIDPMSLQYLI
    GGTVDYTEGLEGSRFTVNNPNATSTCGCGSSFSI