Haemophilus influenzae PittGG uid58593

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|148826809|ref|YP_001291562.1| glutaredoxin 1 [Haemophilus influenzae PittGG]
    MFVTIFGRPGCPYCVRAKNLAEKLKGKVADFDYRYVDIHAEGITKEDLSKSVGKPVETVPQIFIDEKPIGGCTDFEALMK
    EQFGIVA

    >gi|148826952|ref|YP_001291705.1| molybdopterin biosynthesis protein MoeB [Haemophilus influenzae PittGG]
    MIELSHEEELRYNRQIILKSVDFDGQEKLKASKMLIVGLGGLGCAASQYLAAAGVGNLTLLDFDTVSLSNLQRQVLHCDA
    RLNMPKVESAKIALKQINPHINIETINAKLDEEKLAEIIPHFDIVLDCTDNVEIRNQLDRQCNHAKIPLISGAAIRMEGQ
    VSVFTYEPNTPTYRDLSKLFGQNVLS
    CVEAGVLAPIVGIVGTIQALEAIKVRLKIGKNLCGRLLMIDGFSMNIREIKLPT
    NME

    >gi|148826954|ref|YP_001291707.1| phosphoribosylformylglycinamidine synthase [Haemophilus influenzae PittGG]
    MKKLLSIFLMAFSLNAFAQTNLADVQLKDLNNQPVTLSQYKGKPVYVKMWASWCPICLAGLAEIDDLSAEKDRNFEVITI
    VSPDHKGEKDTADFIEWYKGLEYKNITVLLDEKGEIIDKARVRGYPFNLFLDSDLNLKKTVPGHLGAEQIRVFAENNDDK
    RLIFKPLFISNLMAC

    >gi|148826956|ref|YP_001291709.1| bifunctional methionine sulfoxide reductase A/B protein [Haemophilus influenzae PittGG]
    MKLSKTFLFITALCCAAPTLAIQNSTSSSGEQKMAMENTQNIREIYLAGGCFWGMEAYMERIHGVKDAISGYANGNTGKT
    SYHMIGLTDHAETVKVTYDANQISLDKLLKYYFKVIDPTSVNKQGNDRGRQYRTGIYYQDGADKAVIEQALAQLQTKYKK
    PVQVEVQPIKNYIVAEEYHQDYLKKNPNGYCHIDITKADEPVIDEKDYPKPSDAELKAKLTPLQYSVTQNKHTERSFSNE
    YWDNFQPGIYVDVTTGEPVFSSNDKFESGCGWPSFTKPIIKDVVHYETDNSFNMQRTEVLSRAGNAHLGHVFDDGPKDKG
    GLRY
    CINSASIKFIPLAEMEKAGYGYLIQSIKK

    >gi|148827059|ref|YP_001291812.1| dihydrolipoamide dehydrogenase [Haemophilus influenzae PittGG]
    MSKEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKHANKNGIYFSEPR
    IELDEVRAGKEAVVAKLTGGLAGMAKARKVTVVEGLATFTDSHTLVARDRDGNPTTVKFDNAIIAAGSRPVQLPFIPHED
    PRIWDSTDALKLKEVPKKLLIMGGGIIGLEMGTVYNALGSEVEVVEMFDQVIPAADKDVVGIYTKQVEKKFKLMLETKVT
    AVEAKDDGIYVSMEGKACNDTKRYDAVLVAIGRVPNGKLIDAGKAGVEVDDRGFIHVDKQMRTNVPHIYAIGDIVGQPML
    AHKGVNEGHVAAEVIAGQKHYFDPKVIPSIAYTEPEVAWVGKTEKECKQEGLNYEVAKFPWAASGRAIASECSEGMTKLI
    FDKDTHRVLGGAIVGSNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNAKAKKK

    >gi|148827106|ref|YP_001291859.1| Na(+)-translocating NADH-quinone reductase subunit E [Haemophilus influenzae PittGG]
    MTHYILLIIGTALINNFVLVKFLGLCPFMGVSKKIETAVGMGLATMFVLTVASLCAYLVDHYILIPLNATFLRTLVFILV
    IAVVVQFTEMAINKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNVNLAHNLTESVVYGFGASLGFSLVLVLFAALRERLVA
    ADIPATFRGSAIALITAGLMSLAFMGFTGLVK

    >gi|148827111|ref|YP_001291864.1| electron transport complex RsxE subunit [Haemophilus influenzae PittGG]
    MTDLTEKNTALEEKIESAVENQQKSIWKEIFAQGIWKNNPAVVQLLGLCPLLAVSSTATNALGLGLATMLVLTCTNTVIS
    LFRQYIPKEIRIPIYVMIIATTVTAVQLLMNAYTYTLYQSLGIFIPLIVTN
    CIIIGRAEAFASKNSLLHSIWDGFSMGLG
    MALSLTILGALREIIGQGTIFEGIENLFGEQAKFLTHHIYHTDSSFLLFILPPGAFIGLGLLLAIKNRIDNIKK

    >gi|148827141|ref|YP_001291894.1| iron-sulfur cluster insertion protein ErpA [Haemophilus influenzae PittGG]
    MIDDMAVPLTFTDAAANKVKSLISEEENTNLKLRVYITGGGCSGFQYGFTFDEKVNDGDLTIEKSGVQLVIDPMSLQYLI
    GGTVDYTEGLEGSRFTVNNPNATSTCGCGSSFSI

    >gi|148827234|ref|YP_001291987.1| thioredoxin [Haemophilus influenzae PittGG]
    MSQVLHINDADFESVVVNSDIPVLLDFWAPWCGPCKMIAPVLDELAPEFAGKVKIVKMNVDDNQATPAQFGVRSIPTLLL
    IKNGQVVATQVGALAKTQLANFINQHI

    >gi|148827244|ref|YP_001291997.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae PittGG]
    MITVYGIKNCDTVKKALKWLADHNIEHKLHDYRVDGLDLNFLTQAEAQFGWDVLVNKRSTTWRNLDEQVKNSLDKTTALS
    VLAENPTLIKRPIILQDGKALIGFNEKEYQAAFA

    >gi|148827256|ref|YP_001292009.1| glutathione S-transferase [Haemophilus influenzae PittGG]
    MKLYGLIGACSFVPHVALEWVKIRENADYEFEPVTRELIKSPEFLSLNPRGAVPVLVDGDLVLSQNQAILHYLDELYPNS
    KLFGSKTVRDKAKAARWLAFFNSDVHKSFVPLFRLPNYAKDNETLAHTIRQQAVEQILDQLAVANEHLESHIYFGEDISV
    ADAYLYIMLNWCRAVGIDFSHLTQLSAFMQRVETDQAVENVRKIEELKV

    >gi|148827266|ref|YP_001292019.1| peroxiredoxin [Haemophilus influenzae PittGG]
    MVLVTRQAPDFTSSAVLGNGEIVDNFNFKKHIAGKAAVIFFYPLDFTFVCPSELIAFDHRYEEFKKRGVEVVGVSIDSQF
    THNAWRNTPTENGGIGQVKYALAADVKHEIAQAYGIEHPEAGVALRASFLIDKNGVVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEDHGEVCPAQWEKGKEGMKDNPEGVAKYLKQNADKL

    >gi|148827301|ref|YP_001292054.1| glutathione reductase [Haemophilus influenzae PittGG]
    MTKHYDYIAIGGGSGGIASLNRAASYGKKCAIIEAKHLGGTCVNVGCVPKKVMFYGAHIAEAINNYAPDYGFDVEVKKFD
    FSKLIESRQAYISRIHTSYNNVLAKNNIDVINGFGKFVDAHTVEVTLADGTKEQVTADHILIATGGRPYRPNIKGQEYGI
    DSDGFFALTELPKRAAVIGAGYIAVELSGVLNSLGVETHLLVRRHAPMRNQDPLIVETLVEVLAQDGIQLHTNSTPSEIV
    KNADGSLTVRCDGQSDVTVDCVIWAAGRVPATDKIGLENAGVETNEHGYVKVDKYQNTNVKGIYAVGDIIENGIELTPVA
    VAAGRRLSERLFNNKPTEYLDYSLVPTVVFSHPPIGTVGLTEPQAIEQYGTENVKVYKSSFTAMYTAVTQHRQPCKMKLV
    CVGKDEKVVGLHGIGFGVDEMIQGFAVAIKMGATKADFDNTVAIHPTGSEEFVTMR

    >gi|148827307|ref|YP_001292060.1| Na(+)-translocating NADH-quinone reductase subunit D [Haemophilus influenzae PittGG]
    MSGKTSYKDLLLAPIAKNNPIALQILGICSALAVTTKLETAFVMAIAVTLVTGLSNLFVSLIRNYIPNSIRIIVQLAIIA
    SLVIVVDQILKAYAYGLSKQLSVFVGLIITN
    CIVMGRAEAFAMKSPPVESFVDGIGNGLGYGSMLIIVAFFRELIGSGKL
    FGMTIFETIQNGGWYQANGLFLLAPSAFFIIGFVIWGLRTWKPEQQEK

    >gi|148827308|ref|YP_001292061.1| Na(+)-translocating NADH-quinone reductase subunit E [Haemophilus influenzae PittGG]
    MEHYISLFVKAVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVTFVLGIAVPVNQLIYANVLKENALIEGVDLSFLNF
    ITFIGVIAGLVQILEMVLDKFMPSLYNALGIFLPLIAVN
    CAIFGGVSFMVQRDYNFPESIVYGFGSGLGWMLAIVALAGL
    TEKMKYADIPAGLKGLGITFISVGLMALGFMSFSGIQL

    >gi|148827376|ref|YP_001292129.1| arsenate reductase [Haemophilus influenzae PittGG]
    MSVIIYHNPHCSKSRETLALLENKGIQPIIELYLQKQYSVNELQSIAKKLGIDDVRRMMRTKDELYKSLNLDNLDLSQAE
    LFKAISEHSALIERPIVINGDKAKIGRPPETVLEIL

    >gi|148827397|ref|YP_001292150.1| thioredoxin-dependent thiol peroxidase [Haemophilus influenzae PittGG]
    MNPLSVGNQAPAFTLLNQQEKFVSLSDFRGKKVLIYFYPKALTPGCTTQACGLRDSKSELDALGLVVLGISPDAPKKLAQ
    FIEKKELNFTLLSDPDHQVAEQFGVWGEKKFMGRTYDGIHRISFLINESGTIMQVFDKFKIKDHHQMIIDYLRSL

    >gi|148827442|ref|YP_001292195.1| putative cation-transporting ATPase [Haemophilus influenzae PittGG]
    MLDLTPQSKKISIQIGGMTCQSCANRIEKVLNKKPFVQQAGVNFAVEEAQVVFDATQASETQIIEIIHKTGFSAHIKQAN
    ELPIEENTSIPWRLIILWIINIPFLIGMLGMIGGSHHLMLPPIWQFALASIVQLWLAIPFYCGAIGSIRGGLANMDVLVS
    TGTLTIYLYSAFMLFYHADHAMGHVYFEASVMVIGFVSLGKFLEDRTKKHSLNSLSMLLQLTPKKVTVLRNEKWTEIALD
    QVNIGEIIRANQGERIAADGIIESGNGWCDESHLTGESRPEEKQKGGKVLAGAMVTEGSIIYQANQLGSQTLLGDMMNAL
    SDAQGSKAPIARFADKVASVFVPVVLVISLVTFALTYILTNDSVSSLIHAVSVLVIACPCALGLATPAAIMVGLGKAVNA
    GVWFKDAAAMEETAHVDTVVLDKTGTLTKGELEISALWQPQSAVYSEDDLYRFAAAVERQANHPIAKAIVQAAEQKMLEI
    PTALFSKMEVGQGIQAELEQVGTIKVGKPDYCGLILPKNLEDIWQIASIVAVSINDKPIGAFALTDTLKNDSLHAIQRLQ
    RQNVDVVIMSGDQQSVVDYIAKQLGINKAFGGLSPRDKAEQIQKLKAQGHIVAMVGDGINDAPALAAANVSFAMKSGSDI
    AEQTASATLMQHSVNQLVDALFIAIATLKNIKQNLFFALIYNILGIPLAAFGFLSPIIAGAAMALSSISVLMNALRLKKV
    RF

    >gi|148827515|ref|YP_001292268.1| hypothetical protein CGSHiGG_04690 [Haemophilus influenzae PittGG]
    MGITLTEKAAQRVKAFLDNRGKGIGLRLGVKTSGCSGLAYVLEFVDVLNSEDQVFEQHGVNIIVDPKSLVYLNGIELDYV
    KEGLNEGFKYNNPNVKESCGCGESFHV

    >gi|148827604|ref|YP_001292357.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Haemophilus influenzae PittGG]
    MTALYYTYYPSPVGRLLILSDGESITHIDFEKEQYAPNPKWQKQDELPVFQKVRLAFERYFNGEIERFSEIPLKPEGTAF
    QQAIWQALREIDYGELSTYGELALRINNPKAVRAVGGAVGSNPISIIIP
    CHRILGKDRTLTGFGGGLEAKRFLLQLEKIP
    YIDKGTENTKPRFFKKYHE

    >gi|148827626|ref|YP_001292379.1| disulfide bond formation protein B [Haemophilus influenzae PittGG]
    MLALLKQFSEKRFVWFLLAFSSLSLESTALYFQYGMGLQPCVLCVYERLAMIGLFVAGIIALLQPRALIIRLIALALGLF
    SSIKGLLISFRHLDLQMNPAPWKQ
    CEFIPNFPETLPFHQWFPFIFNPTGSCNESQWSLFGLTMVQWLVVIFSLYVVILTL
    LLIAQVIKTRKQRRLFN

    >gi|148827764|ref|YP_001292517.1| DNA-binding transcriptional regulator OxyR [Haemophilus influenzae PittGG]
    MSSMEGKKVPQVTFRTRQGDKWVDVTTSELFDNKTVIVFSLPGAFTPTCSSSHLPRYNELAPVFKKYGVDDILVVSVNDT
    FVMNAWKEDEKSENITFIPDGNGEFTEGMGMLVGKEDLGFGKRSWRYSMLVKNGVVEKMFIEPNEPGDPFKVSDADTMLK
    YLAPQHQVQESISIFTKPG
    CPFCAKAKQLLHDKGLSFEEIILGHDATIVSVRAVSGRTTVPQVFIGGKHIGGSDDLEKYF
    A

    >gi|148827768|ref|YP_001292521.1| sulfur transfer complex subunit TusD [Haemophilus influenzae PittGG]
    MRYVIAVKSPIYGKQGAFLAYQFANALIKKGHEISQIFFFQDGVNNGNVLVYPANDEVNLQKHWQVFSITHNVPLHLCVA
    ASQRRGVVDNLTTPTTGQNNLAKEFIIAGLGEFMAASLNADRVITL

    >gi|148827854|ref|YP_001292607.1| thiosulfate sulfurtransferase GlpE [Haemophilus influenzae PittGG]
    MSFKEITPQQAWEMMQQGAILVDIRDNMRFAYSHPKGAFHLTNQSFLQFEELADFDSPIIVSCYHGVSSRNVATFLVEQG
    YKNVFSMIGGFDGWCRAELPIDTTY

    >gi|148827941|ref|YP_001292694.1| thiol peroxidase [Haemophilus influenzae PittGG]
    MTVTLAGNPIEVGGHFPQVGEIVENFILVGNDLTDVALNDFAGKRKVLNIFPSIDTGVCATSVRKFNQQAAKLSNTIVLC
    ISADLPFAQARFCGAEGIENAKTVSTFRNHALHLQLGVDIQTGPLASLTSRAVIVLDEQNNVLHSQLVEEIKEEPNYEAA
    LAVLA

    >gi|148828030|ref|YP_001292783.1| molybdopterin-guanine dinucleotide biosynthesis protein A [Haemophilus influenzae PittGG]
    MKKVLLALGLGVSTLMSVNSFAADLQEGKQYVQVSQQASQQKEVIEFFSFYCPHCYAFEMEYKIPQQVVDALPKDVKFKQ
    YHVNFLGHQSENLTRAWALAMALGAESKVKSPLFEAAQKDALKSMDDIRAIFLSNGITAEQFDGGINSFAVNGLVNKQVN
    AAEQFKVRGVPDFYVNGKFRVNPEGLNYDDFVKDYVQTVKGLLQK

    >gi|148828065|ref|YP_001292818.1| thiol:disulfide interchange protein precursor [Haemophilus influenzae PittGG]
    MKKLFLFFTLIFTAFAANSGLFDKKQTFLKVDDAFAFSATLSTDKSQLQAHWDIADGYYLYQDKISAELVGKSNPLSLHT
    QQAAELHQDPYFGEVKVFTHSIDGIFRGTFNNADDKVEITYQGCTEGFCYPPETKVLRIGDLAVSQEQIVEKTVEKNTAL
    LSEQDRLADGLFHSKWAIFGFFVLGLGLAFTPCVLPMLPLLSAIVIGQQQRPNMMRAFSLAFLYVQGMALTYTLLGLAVA
    AIGLPFQIALQHPYVMIGLSILFVVLALSMFGLFTIQLPNSLQNKLNTWSQKQTSGAFGGAFAMGMIAGLVASPCTSAPL
    SGALLYVAQSGDLFTGAVTLYLLALGMGVPLMLITLFGNKILPKSGEWMNTVKQTFGFVMLALPVFLLSRILPEVWESRL
    WAGLATVFFIWFALQMSKNGFGYAIKIISFALAMVTVQPLQNWIWQTQTTTQSAVENMPVSQVKFKQIKNTEELDRTLAE
    NPHSIAMLDLYADW
    CVACKEFEKLTFSDPQVQQQFQNILLLQVNMTKNSPENKALMERFNVMGLPTILFFDQQNNEIKGS
    RVTGFMDADAFSNWIEKLL

    >gi|148828112|ref|YP_001292865.1| hypothetical protein CGSHiGG_08240 [Haemophilus influenzae PittGG]
    MKKLIFFTPLFVLLGVCILLIAGLNQDPKKIASALIDKPVPEFYQANLHEPSQIVSPKEFPKQPFLLNVWGSWCGYCKEE
    HPLLIEIAKTLPIVGVDYRDNPQNGIEMLKRMGNPFVLTIDDSHGELGLKLGVDGAPETYLVDENGVIRYRHSGLLDKAT
    WQTVFLPKIEALKNK

    >gi|148828216|ref|YP_001292969.1| hypothetical protein CGSHiGG_08890 [Haemophilus influenzae PittGG]
    MKKLCTALLLSLFAISFAHANETKQIVLKVKEMNCQLCAYLVNKELRNIDGVISTKASIKDGLVTVVEDPKVTNQQLFDA
    IHKLKYTAEVVN

    >gi|148828219|ref|YP_001292972.1| hypothetical protein CGSHiGG_08905 [Haemophilus influenzae PittGG]
    MFTDWKEHTSHVKKSFGELGKQYPKMLQAYQALGAAAAEGNVLDAKTRELIALAVAVTTRCESCISAHAEEAVKAGASEA
    EVAAALATAIALNAGAAYTYSLRALEAYSVQKA

    >gi|148828256|ref|YP_001293009.1| thiol-disulfide interchange protein [Haemophilus influenzae PittGG]
    MKKKLLVPLILFLSITIAFLVQLKRNAQGEDIKALESALVGKPVPAKNLTELFDNKTYTNELFQQGEPVLLNVWATWCPT
    CYAEHQYLNKLAKEGVRIIGLDYKDESPKAMKWLKDLGNPYQVVLKDEKGSFGLDLGVYGAPETFIVDGKGVIHYRYAGD
    VNEKVWTQTLKPIYDKLSEQQ

    >gi|148828276|ref|YP_001293029.1| ADP-L-glycero-D-mannoheptose-6-epimerase [Haemophilus influenzae PittGG]
    MDYPSFLTFIVITSILDFVRRPVVPEEINKITLQDLQGNTFSLESLDQNKPTLLYFWGTWCGYCRYTSPAINSLANEGYQ
    VVSVALRSGNEADVNDYLSKHDYHFTTVNDPKGEFAERWQINVTPTIVLLSKGKMDLVTTGLTSYWGLKVRLFFAEFFG

    >gi|148828320|ref|YP_001293073.1| ferrochelatase [Haemophilus influenzae PittGG]
    METLDKIKKQISENPILIYMKGSPKLPSCGFSARASEALMHCKVPFGYVDILQHPDIRAELPTYANWPTFPQLWVEGELI
    GGCDIILEMYQAGELQTLLAEVAAKHA

    >gi|148828362|ref|YP_001293115.1| thiol-disulfide interchange protein [Haemophilus influenzae PittGG]
    MKKIFTALLCVAAANAMADDAAIKRKLQSFNISNIVIKSSPISGIKTAVTDQGILYVSEDGKYLFEGKLYELTNNGPVDV
    AGKILVDKLNSYKDEMIVYPAKNEKHVVTVFMDIT
    CHYCHLLHQQLKEYNDLGITVRYLAFPRAGMNNQTAKQMEAIWTA
    KDPVFALNEAEKGNLPKEVKTPNIVKKHYELGIQFGVRGTPSIVTSTGELIGGYLKPADLLSALEETAQ

    >gi|148828363|ref|YP_001293116.1| lysyl-tRNA synthetase [Haemophilus influenzae PittGG]
    MKLKGLLAFCLLFLSSFVLAEVNQKEFSVQKSPHLPSRDTIYFEDGRDYFSYQEPIEQASRADKKIRIQFFFDYDCRVCS
    SAQDILELYSQIRTYKVVLEQYPIATADSQFSARIFYTLQALSAVELSNVLLFETSEKSRYTELSTSNKIQQWAEEQGLD
    KQLFIQTENSQSVKEQIQDAIELTEEYGVFTYPYVVIGENMYSLRVRFITMIIALQC