Haemophilus influenzae PittEE uid58591

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|148825145|ref|YP_001289898.1| sulfur transfer complex subunit TusD [Haemophilus influenzae PittEE]
    MRYVIAVKSPIYGKQGAFLAYQFANALIKKGHEISQIFFFQDGVSNGNALVYPANDEVNLQKHWQMFSITHNVPLHLCVA
    ASQRRGVVDNLTTPTTAHYNLAEGFIIAGLGEFIAASLNADRVITL

    >gi|148825149|ref|YP_001289902.1| hypothetical protein CGSHiEE_00105 [Haemophilus influenzae PittEE]
    MSNMEGKKVPQMTFRTRQGDKWVDVTTSELFDNKTVIVFSLPGAFTPTCSSSHLPRYNELAPVFKKYGVDDILVVSVNDT
    FVMNAWKEDEKSENITFIPDGNGEFTEGMGMLVGKEDLGFGKRSWRYSMLVKNGVVEKMFIEPNEPGDPFKVSDADTMLK
    YLAPQHQVQESISIFTKPG
    CPFCAKAKQLLHDKGLSFEEIILGHDATIVSVRAVSGRATVPQVFIGGKHIGGSDDLEKYF
    A

    >gi|148825292|ref|YP_001290045.1| disulfide bond formation protein B [Haemophilus influenzae PittEE]
    MLALLKQFSEKRFVWFLLAFSSLALESTALYFQYGMGLQPCVLCVYERLAMIGLFVAGIIALLQPLAFILRLIALALGLF
    SSIKGLLISFRHLDLQMNPAPWKQ
    CEFIPNFPETLPFHQWFPFIFNPTGSCNESQWSLFGLTMVQWLVVIFSLYVVILTL
    LLIAQVIKTRKQRRLFN

    >gi|148825317|ref|YP_001290070.1| methylated-DNA-protein-cysteine methyltransferase [Haemophilus influenzae PittEE]
    MTALYYTYYPSPVGRLLILSDGESITHIDFEKEQYAPNPKWHKQDELPVFQKVRLAFKRYFNGEVERFLDIPLKPEGTAF
    QQAIWQALREIDYGELSSYGELALRINNPKAVRAVGGAVGSNPISIIIP
    CHRILGKDRTLTGFGGGLEAKRFLLQLEKIP
    YIDKGTENTKPRFFKKYHE

    >gi|148825341|ref|YP_001290094.1| hypothetical protein CGSHiEE_01125 [Haemophilus influenzae PittEE]
    MGITLTEKAAQRVKAFLDNRGKGIGLRLGVKTSGCSGLAYVLEFVDVLNSEDQVFEQHGVNIIVDPKSLVYLNGIELDYV
    KEGLNEGFKYNNPNVKESCGCGESFHV

    >gi|148825432|ref|YP_001290185.1| putative cation-transporting ATPase [Haemophilus influenzae PittEE]
    MLDLTPQSKKISIQIGGMTCQSCANRIEKVLNKKPFVQQAGVNFAVEEAQVVFDATQASETQIIEIIHKTGFSAHIKQAN
    ELPIEENTSIPWRLIILWIINIPFLIGMLGMMSGSHHLMLPPIWQFALASIVQLWLAIPFYRGAIGSIRGGLANMDVLVS
    TGTLTIYLYSAFMLFYHADHAMGHVYFEASVMVIGFVSLGKFLEDRTKKHSLNSLSMLLQLTPKKVTVLRNEKWSEIALD
    QVNIGEIIRANQGERIAADGIIESGNGWCDESHLTGESRPEEKQKGGKVLAGAMVTEGSIIYRANQLGSQTLLGDMMNAL
    SDAQGSKAPIARFADKVASVFVPVVLVISLVTFALTYILTNNNVSSLIHAVSVLVIACPCALGLATPAAIMVGLGKAVNA
    GVWFKDAAAMEETAHVDTVVLDKTGTLTKGELEISALWQPQSAVYSEDDLYRFAAAVERQANHPIAKAIVQAAEQKMLEI
    PTALFSKMEVGQGIQAELEQVGTIKVGKPDYCGLILPKNLEDIWQIASIVAVSINDEPIGAFALTDTLKNDSLHAIQRLQ
    QQNIDVVIMSGDQQSVVDYIAKQLGIKKAFGGLSPRDKAEQIQKLKDLGHIVAMVGDGINDAPALASANVSFAMKSGSDI
    AEQTASATLMQHSVNQLVDALFIARATLKNIKQNLFFALIYNILGIPLAAFGFLSPIIAGAAMALSSISVLMNALRLKKV
    RF

    >gi|148825467|ref|YP_001290220.1| thioredoxin-dependent thiol peroxidase [Haemophilus influenzae PittEE]
    MNPLSVGNQAPAFTLLNQQEKPVSLNDFRGKKVLIYFYPKALTPGCTTQACGLRDSKSELDALGLVVLGISPDAPKKLAQ
    FIEKKALNFTLLSDPDHQVAVQFGVWGEKKFMGRTYDGIHRISFLINESGNIMQVFDKFKIKDHHQMIIDYLRSL

    >gi|148825480|ref|YP_001290233.1| putative arsenate reductase [Haemophilus influenzae PittEE]
    MSVIIYHNPHCSKSRETLALLENQGIQPIIELYLQKQYSIDELKSIAQKLGIDDVRQMMRTKDDLYKSLNLDNLELSQAE
    LLKAMSEHSALIERPIVINGDKAKIGRPPETVLEIL

    >gi|148825555|ref|YP_001290308.1| Na(+)-translocating NADH-quinone reductase subunit D [Haemophilus influenzae PittEE]
    MSGKTSYKDLLLAPIAKNNPIALQILGICSALAVTTKLETAFVMAIAVTLVTGLSNLFVSLIRNYIPNSIRIIVQLAIIA
    SLVIVVDQILKAYAYGLSKQLSVFVGLIITN
    CIVMGRAEAFAMKSPPVESFVDGIGNGLGYGSMLIIVAFFRELIGSGKL
    FGMTIFETIQNGGWYQANGLFLLAPSAFFIIGFVIWGLRTWKPEQQEK

    >gi|148825556|ref|YP_001290309.1| Na(+)-translocating NADH-quinone reductase subunit E [Haemophilus influenzae PittEE]
    MEHYISLFVKAVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVTFVLGIAVPVNQLIYANVLKENALIEGVDLSFLNF
    ITFIGVIAGLVQILEMVLDKFMPSLYNALGIFLPLIAVN
    CAIFGGVSFMVQRDYNFPESIVYGFGSGLGWMLAIVALAGL
    TEKMKYADIPAGLKGLGITFISVGLMALGFMSFSGIQL

    >gi|148825570|ref|YP_001290323.1| glutathione reductase [Haemophilus influenzae PittEE]
    MTKHYDYIAIGGGSGGIASLNRAASYGKKCAIIEAKHLGGTCVNVGCVPKKVMFYGAHIAEAINNYAPDYGFDVEVKKFD
    FSKLIESRQAYISRIHTSYNNVLAKNNIDVINGFGKFVDAHTIEVTLADGTKEQVTADHILIATGGRPYRPNIKGQEYGI
    DSDGFFALTELPKRAVVIGAGYIAVELSGVLNSLGVETHLLVRRHAPMRNQDPLIVETLVEVLAQDGIQLHTNSTPSEIV
    KNADGSLTVRCDGQSDVTVDCVIWAAGRVPTTDKIGLENAGVETNEHGYVKVDKYQNTNVKGIYAVGDIIENGIELTPVA
    VAAGRRLSERLFNNKPTEYLDYSLVPTVVFSHPPIGTVGLTEPQAIEQYGAENVKVYKSSFTAMYTAVTQHRQPCKMKLV
    CVGKDEKVVGLHGIGFGVDEMIQGFAVAIKMGATKADFDNTVAIHPTGSEEFVTMR

    >gi|148825612|ref|YP_001290365.1| methyltransferase [Haemophilus influenzae PittEE]
    MKLYGLIGACSFVPHVALEWVKIRENADYEFEPVTRELIKSPEFLSLNPRRTVPVLVDGDLVLSQNQAILHYLDELYPNS
    KLFGSKTVRDKAKVARWLAFFNSDVHKSFVPLFRLPNYAKDNETLAHTIRQQAVEQILDQLAVANEHLESHIYFGEDISV
    ADTYLYIMLNWCRAVGINFSHLTQLSAFIQRVETDQAVENVRKIEELKV

    >gi|148825624|ref|YP_001290377.1| heat shock protein 90 [Haemophilus influenzae PittEE]
    MITVYGIKNCDTVKKALKWLADHNIEYKLHDYRIDGLDLNFLTQAETQFGWDVLVNKRSTTWRNLDEQVKNSLDKTTALS
    VLAENPTLIKRPIILQDGKALIGFNEKEYQAAFA

    >gi|148825638|ref|YP_001290391.1| thioredoxin [Haemophilus influenzae PittEE]
    MSEVLHINDADFESVVVNSDIPVLLDFWAPWCGPCKMIAPVLDELAPEFSGKVKIVKMNVDDNQATPAQFGVRSIPTLLL
    IKNGQVVATQVGALPKTQLANFINQHI

    >gi|148825738|ref|YP_001290491.1| iron-sulfur cluster insertion protein ErpA [Haemophilus influenzae PittEE]
    MIDDIAVPLTFTDAAANKVKSLISEEENTDLKLRVYITGGGCSGFQYGFTFDEKVNDGDLTIEKSGVQLVIDPMSLQYLI
    GGTVDYTEGLEGSRFTVNNPNATSTCGCGSSFSI

    >gi|148825768|ref|YP_001290521.1| electron transport complex RsxE subunit [Haemophilus influenzae PittEE]
    MTDLTEKNTALEEEKIESAVENQQKSIWKEIFAQGIWKNNPAVVQLLGLCPLLAVSSTATNALGLSLATMLVLTCTNTVI
    SLFRQYIPKEIRIPIYVMIIATTVTAVQLLMNAYTYTLYQSLGIFIPLIVTN
    CIIIGRAEAFASKNSLLHSIWDGFSMGL
    GMALSLTILGALREIIGQGTIFEGIENLFGEQAKFLTHHIYHTDSSFLLFILPPGAFIGLGLLLAIKNRIDNVKK

    >gi|148825773|ref|YP_001290526.1| Na(+)-translocating NADH-quinone reductase subunit E [Haemophilus influenzae PittEE]
    MTHYILLIIGTALINNFVLVKFLGLCPFMGVSKKIETAVGMGLATMFVLTVASLCAYLVDHYILIPLNATFLRTLVFILV
    IAVVVQFTEMAINKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNVNLAHNLTESVVYGFGASLGFSLVLVLFAALRERLVA
    ADIPATFRGSAIALITAGLMSLAFMGFTGLVK

    >gi|148825826|ref|YP_001290579.1| dihydrolipoamide dehydrogenase [Haemophilus influenzae PittEE]
    MSKEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKHANKNGIYFSEPR
    IELDEVRAGKEAVVAKLTSGLAGMAKARKVTVVEGLATFTDSHTLVARDRDGNPTTVKFDNAIIAAGSRPVQLPFIPHED
    PRIWDSTDALKLKEVPKKLLIMGGGIIGLEMGTVYNALGSEVEVVEMFDQVIPAADKDVVGIYTKQVEKKFKLMLETKVT
    AVEAKDDGIYVSMEGKACNDTKRYDAVLVAIGRVPNGKLIDAGKAGVEVDDRGFIHVDKQMRTNVPHIYAIGDIVGQPML
    AHKGVHEGHVAAEVIAGQKHYFDPKVIPSIAYTEPEVAWVGKTEKECKQEGLNYEVAKFPWAASGRAIASECSEGMTKLI
    FDKDTHRVLGGAIVGSNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNAKAKKK

    >gi|148825992|ref|YP_001290745.1| molybdopterin biosynthesis protein MoeB [Haemophilus influenzae PittEE]
    MIELSHEEELRYNRQIILKSVDFDGQEKLKASKMLIVGLGGLGCAASQYLAAAGVGNLTLLDFDTVSLSNLQRQVLHCDT
    RLNMPKVESAKIALEQINPHINIETINAKLDEEKLAEIIPHFDIVLDCTDNVEIRNQLDRQCNHAKIPLISGAAIRMEGQ
    VSVFTYEPNTPTYRDLSKLFGQNVLS
    CVEAGVLAPIVGIVGCIQALEAIKVRLKIGKNLCGRLLMIDGFSMNIREIKLPT
    NME

    >gi|148825994|ref|YP_001290747.1| hypothetical protein CGSHiEE_04855 [Haemophilus influenzae PittEE]
    MKKLLSIFLMAFSLNAFAQTNLADVQLKDLNNQPVTLSQYKGKPVYVKMWASWCPICLAGLAEIDDLSAEKDRNFEVITI
    VSPDHKGEKDTADFIEWYKGLEYKNITVLLDEKGEIIDKARVRGYPFNLFLDSDLNLKKTVPGHLGAEQIKVFAGK

    >gi|148825996|ref|YP_001290749.1| bifunctional methionine sulfoxide reductase A/B protein [Haemophilus influenzae PittEE]
    MKLSKTFLFITALCSATPTLAIQNSTSSSGEQKMAMENTQNIREIYLAGGCFWGMEAYMERIHGVKDAISGYANGNTGKT
    SYHMIGLTDHAETVKVTYDANQISLDKLLKYYFKVIDPTSVNKQGNDRGRQYRTGIYYQDGADKAVIEQALAQLQTKYKK
    PVQVEVQPIKNYIVAEEYHQDYLKKNPNGYCHIDITKADEPVIDEKDYPKPSDAELKAKLTPLQYSVTQNKHTERSFSNE
    YWDNFQPGIYVDVTTGEPVFSSNDKFESGCGWPSFTKPIIKDVVHYETDNSFNMQRTEVLSRAGNAHLGHVFDDGPKDKG
    GLRY
    CINSASIKFIPLAEMEKAGYGYLIQSIKK

    >gi|148826058|ref|YP_001290811.1| glutaredoxin 1 [Haemophilus influenzae PittEE]
    MFVVIFGRPGCPYCVRAKNLAEKLKGEVADFDYRYVDIHAEGITKEDLSKSVGKPVETVPQIFIDEKPIGGCTDFEALMK
    EQFGIVA

    >gi|148826176|ref|YP_001290929.1| hypothetical protein CGSHiEE_05955 [Haemophilus influenzae PittEE]
    MKLKGLLAFCLLFLSSFVLAEVNQKEFSVQNSPHLPSRDTIYFEDGRDYFSYKEPIEQVSRAGKKIRIQFFFDYDCRVCS
    SAQDILELYSQIRTHKVVLEQYPIATADSQFSARIFYTLQALSAGELSNVLLFETSEKSRYTELSTSNKIQQWAEEQGLD
    KQLFIQTENSQSVKEQIQNAIELTEEYGVFTYPYVVIGGKYVLTASTLYNDDYSVAVLDFLVNKIEQEQKQ

    >gi|148826179|ref|YP_001290932.1| thiol-disulfide interchange protein [Haemophilus influenzae PittEE]
    MKKIFTALLCVAAANAMADDAAIKRKLQSFNISNIVIKSSPISGIKTAVTDQGILYVSEDGKYLFEGKLYELTNNGPIDV
    AGKILVDKLNSYKDEMIVYPAKNEKHVVTVFMDIT
    CHYCHLLHQQLKEYNDLGITVRYLAFPRAGMNNQTAKQMEAIWTA
    KDPVFALNEAEKGNLPKEVKTPNIVKKHYELGIQFGVRGTPSIVTSTGELIGGYLKPADLLRALEETAQ

    >gi|148826223|ref|YP_001290976.1| glutaredoxin-related protein [Haemophilus influenzae PittEE]
    METLDKIKKQISENPILIYMKGSPKFPSCGFSARASEALMNCKVPFGYVDILQHPDIRAELPTYANWPTFPQLWVDGELI
    GGCDIILEMYQAGELQTLLAEVAAKHV

    >gi|148826229|ref|YP_001290982.1| ferrochelatase [Haemophilus influenzae PittEE]
    MSDIKHAKLLILGSGPAGYTAAIYAARANLKPVLVTGLQQGGQLTTTDEIENWPGDFEMTTGSGLMQRMLQHAEKFETEI
    VFDHINRVDLSSRPFKLFGDVQNFTCDALIIATGASARYIGLPSEENYKGRGVSA
    CATCDGFFYRNKPVGVIGGGNTAVE
    EALYLANIASTVHLIHRRDSFRAEKILIDRLYKKVEEGKIVLHTDRTLDEVLGDNMGVTGLRLANTKTGEKEELKLDGLF
    VAIGHSPNTQIFQGQLELNNGYIIVKSGLDGDATATSVEGVFAAGDVMDHNYRQAITSAGTGCMAALDAERYLDAQEA

    >gi|148826270|ref|YP_001291023.1| deoxyribose-phosphate aldolase [Haemophilus influenzae PittEE]
    MKIKKLLKNGLSLFLTFIVITSILDFVRRPVVPKEINKITLQDLQGSTFSLDSLDQNKPTLLYFWGTWCGYCRYTSPAIN
    SLANEGYQVVSVALRSGNEADVNDYLSKHDYHFTTVNDPKGEFAERWQINVTPTIVLLSKGKMDLVTTGLTSYWGLKVRL
    FFAEFFG

    >gi|148826291|ref|YP_001291044.1| thiol-disulfide interchange protein [Haemophilus influenzae PittEE]
    MVQLKRNAQGEDIKALESALVGKPVPAKNLTELFENKTYTNELFQQGEPVLLNVWATWCPTCYAEHQYLNKLAKEGVRII
    GLDYKDESPKAMKWLKDLGNPYQVVLKDEKGSFGLDLGVYGAPETFIVDGKGVIHYRYAGDVNEKVWTQTLKPIYDKLSE
    QQ

    >gi|148826328|ref|YP_001291081.1| hypothetical protein CGSHiEE_06805 [Haemophilus influenzae PittEE]
    MFTDWKEHTSHVKKSFGELGKQYPKMLQAYQALGAAAAEGNVLDAKTRELIALAVAVTTRCESCISAHAEEAVKAGASEA
    EVAAALATAIALNAGAAYTYSLRALEAYSVQKA

    >gi|148826331|ref|YP_001291084.1| hypothetical protein CGSHiEE_06820 [Haemophilus influenzae PittEE]
    MKKLSTALLLSLFAVSFAHANETKQIVLKVKEMNCQLCAYLVNKELRNIDGVISTKASIKDGLVTVVEDPKVTNQQLFDA
    IHKLKYTAEVVN

    >gi|148826415|ref|YP_001291168.1| thiol-disulfide interchange protein [Haemophilus influenzae PittEE]
    MNKKLIFFTPLFVLLGVCILLIAGLNQDPKKIASALIDKPVPEFYQANLHEPSQIVSPKEFPKQPFLLNVWGSWCGYCKE
    EHPLLIEIAKTLPIVGVDYRDNPQNGIEMLKRMGNPFVLTIDDSHGKLGLKLGVDGAPETYLVDENGVIRYRHSGLLDKE
    TWQTVFLPKIKALKNK

    >gi|148826470|ref|YP_001291223.1| thiol:disulfide interchange protein [Haemophilus influenzae PittEE]
    MKKLFLFFTLIFTAFAANSGLFDKKQTFLKVDDAFAFSATLSTDKSQLQAHWDITDGYYLYQDKISAELVGKSNPLSLHT
    QQAAELHQDPYFGEVKVFTHSIDGIFRGTFNNADDKVEITYQGCTEGFCYPPETKVLRIGDLAISQEQIVEKTVEKNTAL
    LSEQDRLADGLFHSKWTIFGFFLLGLGLAFTPCVLPMLPLLSAIVIGQQQRPNMMRAFSLAFLYVQGMALTYTLLGLAVA
    AIGLPFQIALQHPYVMIGLSILFVVLALSMFGLFTIQLPNSLQNKLNTWSQKQTSGAFGGAFAMGMIAGLVASPCTSAPL
    SGALLYVAQSGDLFTGAATLYLLALGMGVPLMLITLFGNKILPKSGEWMNTVKQTFGFVMLALPVFLLSRILPEVWEPRL
    WAGLATVFFIWFALQMSKNGFGYAIKIISFVLAMVTVQPLQNWIWQTQTTTQSAVENKSVSQVKFKQIKNTEELDRTLAE
    NPHSIAMLDLYADW
    CVACKEFEKLTFSDPQVQQQFQNILLLQVNMTKNSPENKALMERFNVMGLPTILFFDQQNNEIKGS
    RVTGFMDADAFSNWLKALH

    >gi|148826509|ref|YP_001291262.1| thiol:disulfide interchange protein DsbA [Haemophilus influenzae PittEE]
    MKKVLLALGLGVSTLMSVNSFAADLQEGKQYVQVSQQASQQKEVIEFFSFYCPHCYAFEMEYKIPQQVVDALPKDVKFKQ
    YHVNFLGHQSENLTRAWALAMALGAESKVKSPLFEAAQKDALKSMDDIRAIFLSNGVTAEQFDGGINSFAVNGLVNKQVN
    AAEQFKVRGVPDFYVNGKFRVNPEGLNYDDFVKDYVQTVKGLLQK

    >gi|148826605|ref|YP_001291358.1| thiol peroxidase [Haemophilus influenzae PittEE]
    MTVTLAGNPIEVGGHFPQVGEIVENFILVGNDLADVALNDFAGKLKVLNIFPSIDTGVCATSVRKFNQQAAKLSNTVVLC
    ISADLPFAQARFCGAEGIENAKTVSTFRNHALHSQLGVDIQTGPLAGLTSRAVIVLDEQNNVLHSQLVEEIKEEPNYEAA
    LAVLA

    >gi|148826669|ref|YP_001291422.1| DNA-binding transcriptional regulator IlvY [Haemophilus influenzae PittEE]
    MSFKEITPQQAWEMMQQGAILVDIRDNMRFAYSHPKGAFHLTNQSFLQFEELADFDSPIIVSCYHGVSSRNVATFLVEQG
    YENVFSMIGGFDGWCRAELPIDTAY