Alteromonas macleodii Deep ecotype uid58251

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|196154893|ref|YP_002124382.1| glpE protein [Alteromonas macleodii 'Deep ecotype']
    MTTFSHISVNDVANFQGDVTIVDIRDPQSFANGHMPNAAPLNNDNFAAFIEQTPKDIPVVVVCYHGVSSQQAAQVIAQQG
    FESVYSMDGGFEAWRLANPVVTA

    >gi|196154909|ref|YP_002124398.1| protein of unknown function DUF395, YeeE/YedE [Alteromonas macleodii 'Deep ecotype']
    METWTTTPFEPLDGLAGGLLIGSSVVLLLYTLGRIAGISGIAAGAMTQQGSERYWRLAFLAGIVLSAVLYIAFTGGMQVQ
    TQMGSAWLVVAGLLVGFGTRLGCG
    CTSGHGVAGLSRLSPRSIVATLTFMGAAIITTTIIRHL

    >gi|196154921|ref|YP_002124410.1| Rhodanese-related sulfurtransferase [Alteromonas macleodii 'Deep ecotype']
    MMKTPKVFISEVKAAVEEVTVDDLMVALTQPDVILIDVRESEEYQHGHINGSVNFPRGMLEAKICSHPLLAHHCEEQDAI
    NDLAQRSVYLI
    CKTGGRSALAAKSLTDMGHKYVFSVAGGMDEWQRKQLTLSH

    >gi|196154923|ref|YP_002124412.1| alkyl hydroperoxide reductase [Alteromonas macleodii 'Deep ecotype']
    MTTEIQNNVTFPQLNRPAPDFCAKTTHGQKSLSDYKGKWLVLFSHPADFTPVCTTEFIGFANAADKFASLNTELLGLSID
    STHSHIAWVRNIKEKFGVTIPFPIIADLSMEVAKAYGMVQPGASDTSAVRATFIIDPEGILRAMVYYPMSNGRAINEFVR
    LVEALQTSDANSCATPENWKVGDEVIVPPPHTIEDAEGRESAGYNYVDWYFCKKAL

    >gi|196154925|ref|YP_002124414.1| putative thiol:disulfide interchange protein [Alteromonas macleodii 'Deep ecotype']
    MFMSISIGPIALTVDSLLTIVSVISLWLLTAFFTRKASYKSFATDTLFYSLFTGLFAARVAFVIAMWEVYQHDWLSAIDI
    RDGGFNQSIGWFAGVCIMLFRSKKYSQLFSIYIKSAAITAVAVFPFFVFNSMLSNQRTIETINVYNADGTPIELVLNNNK
    PTVINFWASW
    CPPCRREMPMLEYAQKNDVNIEYIFVNQGEAPSKVRQFLGKQKIDLKNTYFDFTGSTAKELGAFGLPTTL
    FFNAGGKLVDSHMGELSEASLQYYLDPLRKKAINSSD

    >gi|196154967|ref|YP_002124456.1| Thiamine biosynthesis protein ThiF [Alteromonas macleodii 'Deep ecotype']
    MEEDGQAKLANSHAVVVGLGGLGSLVARYLVGAGVGSITLVDGDTVDISNLQRQVTYNEMHLGELKAKSLYNELRKVNPK
    LNIRYKSLYVDSNNLPTLISSADCVLDCTDKIDTRKLINAATYRASTPLFIAAASGLSWQALNLPQNSTSCGCYACLVEY
    INVRED
    CLSKGVLGPVVGMAACHQATQALLFLAKGFSANIKWGHYLTGNADLGSLKSFTLPSSSTCEVCHDPN

    >gi|196154983|ref|YP_002124472.1| antioxidant, AhpC/Tsa family protein [Alteromonas macleodii 'Deep ecotype']
    MIQVGSTLPEVDFGLLVDGEMTNPGTNELFSDKRVVLFAVPGAFTPTCSQAHLPGYVALADKIKAKGIDSIICLSVNDAF
    VMDAWGKANNAEEIIMLADGNGHFTKQIGLDMNTSNFGGLRSLRYSMLIEDGEVKKINVEDPGRFDVSDAQSMLDSL

    >gi|196155010|ref|YP_002124499.1| glutaredoxin [Alteromonas macleodii 'Deep ecotype']
    MSKRATLYRMVMPNHICPFGLKSKDLLERKGFEVNDHHLTTRSETDAFKEKHEVKTTPQTFIDDKRIGGYDDLRDYFNLK
    QESEFGSRYTPIIVIFSLAALMVAALMLKGGLAADVEPFVMNFIGITMVILALQKLQDLVAFSNQFITYDLLAMKHVRYA
    YVYPFAEAYAGLGMLAGLPALMVSPVSIFIGAIGAVSVIKAVYVDKRELKCACVGGNSDLPLGFISLTENLAMFGAGLYM
    LVNWLAL

    >gi|196155178|ref|YP_002124667.1| Cation transport ATPase [Alteromonas macleodii 'Deep ecotype']
    MNSKTDDAKIHSCCGGDKKVSTASKAVESETNTEQVSASSGELQLNIQGASCASCVSKIEAALKQVSGVTNAEMNFAERS
    VLVMGSSSSHALIKAVEQAGYNATLANTDSDEAAIEEKEQADWAYYKKLMRDMVIALSLGVPLMLYGLVTGEMSVNTTTE
    RIVWLIVGIMTLGVMVFSGRHFYVGAWNSFKNHAANMDTLIALGTGTAWLYSMVVVFFPGYVPEMARHVYFEATAMIIGL
    INLGLALEIKARGKTSEAIKRLIGLQAKTARVIRDGHDIDIPIEDVLLNDLIRVRPGERISVDGLVVEGQTSIDESMLTG
    EPMPIEKRKDDEVVAGTINKSGSIVFRAERVGKDTALAQIINMVKRAQNSKPPIGRLADMISAYFVPVVMIIAVISALAW
    LNYGPSPEVAFAIVSATTVLIIACPCALGLATPMSVMVGVGKAAEAGVLIRNGEALQSASKITTMVLDKTGTITEGAPKV
    TDVVIASDHSHNDVLSLAASLESGSEHPLAMAIVESAKEQGVPIHSVTDFQSIAGKGVEAMLNSQRLLFGNEKLMIDQGI
    ELHHYIDKAQRLAADAKTPMYFAIDSTLVAVIAVADPIKSDSIDAIKRLQHNGIRVVMLTGDNRLTAKAVARKAGIADYV
    AEVMPEDKANKILELQREGEIVGMTGDGINDAPALAHANVGFAIGTGTDVAIESADITLMRGSLHGLADAIAVSKATLRN
    IKQNLFGAFIYNVAGIPFAAGLFYPFLGILLNPVIAGAAMAFSSLTVVTNANRLRLFKAKEH

    >gi|196155218|ref|YP_002124707.1| Cation transport ATPase [Alteromonas macleodii 'Deep ecotype']
    MSAEVTQRQLVIEGAGCASCVGKIEAALKQTPGVQNAEMNFADRTVLVSGTADSQLLVQAVESVGYNAKPFEDKPDTDVV
    DEKEAADRTYYKKLMRDTFIALSLGIPLMTYSIVVDEMTVETNVERLLWLAVGLLTLGVMFFSGRHFYIGAWKSFKNHSA
    NMDTLIALGTGTAWFYSMLVVLVPEAVPLMARHVYFEATAMIIGLIDLGLALELKARGKTSEAIKRLIGLQAKTATVIRD
    NKEVQVAIEQVLFNDVIKVRPGEKVPVDGVVVEGHTSIDESMLTGEPMPVEKSHDDEVVAGTLNKSGMFLFKATRVGKDT
    ALAQIIAMVKRAQNSKPPIGRLADVISAYFVPVVMIISVLSALAWLNFGPEPALAFAIVSATTVLIIACPCALGLATPMS
    VMVGVGKAAEAGVLIRNGEALQTASKISVMILDKTGTITEGTPKVTDIILANFSDEKTVLQLAASLENGSEHPLAMAIVE
    SAHDQGIELLKTEEFNAITGMGVEGRCEGKALLFGNSKLMASKGVGIGNYSEKAQTLAKDAKTPMYFAVDGQLAAIIAVA
    DPIKPDSVSAIKRLQANDIRVIMLTGDNKETAAAVAKKAAISEFFAEVLPEDKANKVHELQQQREVVGMTGDGINDAPAL
    ALADVGFAIGTGTDVAIESADITLMRGSLHGLADAIAVSKATLRNIKQNLFGAFIYNVAGIPFAAGVLYPFFGVLLSPVI
    AGAAMAFSSLTVVSNANRLRLFKAKDH

    >gi|196155229|ref|YP_002124718.1| hypothetical protein MADE_00406 [Alteromonas macleodii 'Deep ecotype']
    MVTKEHICPYGLRSKDLLEREGYSVEDNHLTSRNDTDDFKQKHGVETTPQTFIEEKRVGGYDELRKYFGKGEAGQNGTTY
    APVIAIFSVAALLSLAFQFFVSEDFISIRTLVLFIAFSMTLLAVQKLKDLYSFTNSFITYDLLAMRWLRYGYIYPFLEAY
    AGIGMVAQLPAIAVAPFSLFIGTVGAISVFKAVYVDKRELKCACVGGDSNVPLGFVSLSENIFMIAGALLMLSF

    >gi|196155365|ref|YP_002124854.1| glutaredoxin 3 GrxC [Alteromonas macleodii 'Deep ecotype']
    MSKVELYTKGHCPYCHRAKALLTQKGVEFIEYPIDVKPELRDEMIERANGGWTVPQIFIDDQHVGGCDDMMALEAQSKLS
    PMLGLA

    >gi|196155366|ref|YP_002124855.1| rhodanese domain protein [Alteromonas macleodii 'Deep ecotype']
    MDQLIEFASNNFILAGIWVALIAMLIFSYISAWTSSVKELSTHEATLLINKHDAIVLDTRPAKEFNAGHILGARQIKPEE
    VREKNFKKLENSKDKPIIVV
    CAMGNQARGTANAMQKDGFANVNVLKGGMNAWQSASLPVSK

    >gi|196155392|ref|YP_002124881.1| thioredoxin [Alteromonas macleodii 'Deep ecotype']
    MEKRMSDKIIQLSDDKFEADVINAEGPVLVDFWAEWCGPCKMIAPILEEVATEFDGKLTVGKLNVDENNETPPKYGIRGI
    PTLLLFKNGNVAATKVGALSKAQLTEFLNENL

    >gi|196155404|ref|YP_002124893.1| Thioredoxin domain-containing protein [Alteromonas macleodii 'Deep ecotype']
    MENLVANSQATIVDITVENFQQIIVEASQEKLVLIDFWADWCESCKDLMPILEKLAGEYSQHLILAKVDCEAQQEVAAQF
    GIRSLPTVMVVQNGQPVDGFAGVQPEQQIREMLTKYLPNPEDELLATAGKAIQQGEYAEALPAAKEALSLNPDNVNAKYM
    LIDCYIETGSIDTAKALLEDIKLVDQDSRYKSLAGKIELAEQAADTPEIRQLQAAVEANPDDLQLKIDLAIQLQQANKAQ
    DALALLYSVLKTELGFGDARKLMMDMMNALADGDPLKSEYRRKVYSLLY

    >gi|196155567|ref|YP_002125056.1| Na(+)-translocating NADH-quinone reductase subunit D [Alteromonas macleodii 'Deep ecotype']
    MADTKEMKKALFGPILDNNPIALQVLGICSALAITTKLETALVMSLALTSVVAFSNLFISLIRNQIPSSVRIIIQMTIIA
    SLVIVVDQILKAYSYEISKQLSVFVGLIITN
    CIVMGRAEAYAMKSPPLMSFLDGIGNGLGYSFILIVIGTIKELFGFGTI
    LGFEILPLVQNGGWYQGNGLLILPFSSFFLIGGMIWVIRTIRPEQVEPKE

    >gi|196155568|ref|YP_002125057.1| Na(+)-translocating NADH-quinone reductase subunit E [Alteromonas macleodii 'Deep ecotype']
    MEHYLSLFVRSIFVENMALSLFLGMCTFLAVSKKVKTAMGLGVAVIVVLGISVPVNQIIYVNILAPGALAWAGFPEADLS
    FLNFLTFIGVIAALVQILEMSLDKFFPALYNALGIFLPLITVN
    CAIFGGVAFAVQREYNLTESVVYGVGSGIGWAIAIVL
    LAAVREKLKYADMPDGVRGLGSVFMIAGLMALGFQSFTGIQL

    >gi|196155865|ref|YP_002125354.1| molybdopterin biosynthesis protein MoeB [Alteromonas macleodii 'Deep ecotype']
    MSKSLTNQQAMRYNRHIVLPKIDLDGQEALLNANICIIGIGGLGTAAATSLCASGVGSLTLIDHDTVEATNLPRQILFSE
    QDVGVNKVEAAKARLHAINSDCDITAIAEPFSAPNAAELSPTSKQAIEGADVVLDCTDNTDSRDLINVLCFELNTPLVSG
    AAIRFEGQLFVAIPGESRCYACLRTLFASPDLS
    CVEAGIFSPVVNIIGTYQAMLAMQVLMDFDNIPKNTLMTFDALSHEW
    RNWKLPKGVNCELCAC

    >gi|196155875|ref|YP_002125364.1| probable DSBA oxidoreductase [Alteromonas macleodii 'Deep ecotype']
    MQKVTVNMVSDVVCPWCIVGYQRLQEAIKTLDDIEVDIKFHPFELNPNMPEEGQNLREHIMEKYGIGAEQSAQNRARLVE
    AGKDVGFAFNFDDDSRMQNTFKAHQLIHFAAEKGLEEQMKLSLFSAYFTDGKDINDNAVLVKLAAGAGLDKSQASEVLES
    GKYASVVREEETLWMQRGIQSVPTFVIGNQGVAGAQEPATLASFIKEAASQ

    >gi|196155965|ref|YP_002125454.1| disulfide bond formation protein B (Disulfide oxidoreductase) [Alteromonas macleodii 'Deep ecotype']
    MRALVHTISQWAEHKSSWLVLFATSLALEIAALYFQYGMGLKPCIMCIYQRTAMYGIVLSALLVVIKNNGFTRMLGFAGW
    AVSAGWGFLIAKEHVGILNAANPFFAS
    CEIVPNFPSWLQLHEWLPAVFAAEGDCLADSWQFLSMGMAEWMQIIFAAYFAV
    FAIVFACRLLDKKPF

    >gi|196155993|ref|YP_002125482.1| Alkylhydroperoxidase [Alteromonas macleodii 'Deep ecotype']
    MSKSYKEITEGLNPYLAEVKKGVPEVMKGFSAMAKAATADGALDKKTKELLALAIGIATRCDGCIGFHAKALVHLGATRA
    EIEEVCGMSVYMGGGPSFMYAADALRAFDEFSESE

    >gi|196156075|ref|YP_002125564.1| methionine sulfoxide reductase B [Alteromonas macleodii 'Deep ecotype']
    MSTDKKQDESIAEKDWKVELSEQEYYVCREAGTERPFTGVLLDEQRDGLYVCKCCEAPLFPSDTKFDAGCGWPSFYKQLD
    DGNVDYREDVSHGMRRVEIFCKQCGSHLGHVFPDGPAPTGQRY
    CVNSLSMTFKGEDNVEVKG

    >gi|196156099|ref|YP_002125588.1| hypothetical protein MADE_01280 [Alteromonas macleodii 'Deep ecotype']
    MLIDIKKRLENIDLDIRTITAEQAVSEQKNNGGTLIDVREAAEVSKEPVPCALHIPRGVLEMKALEHFSDASTPLYIHCA
    SGVRATLAAEQLLKMGYENVSVITCSVPTINQASTND

    >gi|196156180|ref|YP_002125669.1| Fe-S cluster assembly scaffold protein [Alteromonas macleodii 'Deep ecotype']
    MSVETFVPSTKLITLTDSAVKHFESKLKDKPGQLIRLSTKVSGCTGYAYVLDFADSAQADDEIIEISPLVNVAVAADATD
    LLRNTEIDYVMEGVNGIIKYNNPNVVDECGCGESFNVG

    >gi|196156224|ref|YP_002125713.1| putative mercuric reductase [Alteromonas macleodii 'Deep ecotype']
    MSTNSCCSSNDIQPEQLHVAIIGSGSGAFASAIKAAEGGARVTIIEGADVIGGCCVNVGCVPSKILIRAAQLAHQQRTNP
    FDGLENIQPQLSRSLLAHQQNARVEELRDAKYQRILESNPALSLLKGYARFKNQNTLLVHKSDGSEEELVADRILIATGS
    TPSIPPIKGLVDTPYWTSTEALFAEELPSSLVVIGSSVVALEIAQAYARLGSRVTILARHTLLYAEDPLLGEKLAECFEK
    EGIRVLNNTQASHVSYDSNGFSLETNEGTLIAEKLLISTGRHANTGKLGLENVGVETDKSGAIVVNSMMETSTANIYAAG
    DCSNMPQFVYVAAAAGSRAGINMTGGNAQLDLSTMPAVIFTDPQVATVGLTEVQASAVGINTISRVLDMENVPRALANFE
    TDGFIKLVAEESTGKLIGAQILAHEGGELIQSAALAIHNKMTVEELAGQLFPYLTMVEGLKLCAQTFSKDVKELSC
    CAG

    >gi|196156334|ref|YP_002125823.1| hypothetical protein MADE_01523 [Alteromonas macleodii 'Deep ecotype']
    MTERIKTIDEFAKHVDYSLLESLNCDPQATQDGNDHNPRQVFSGHYVPVTPTPLTSPKYIAHSETLFAELGLDDSLATSK
    AFTQLFSGDMSAVPAPMKPFGWATGYALSIYGTEYTQQCPFRTGNGYGDGRAISIVEAVLNGKRWEMQLKGAGRTPYCRG
    ADGRAVLRSSVREFLVQEHMHALGIPTSRSLSLFMSESDSVDRPWYREGSHSYEPEVMVENITAISTRVAPSFLRVGQIE
    LFARRARCDEHEHARDELKAIVMHLIEREYAKEIDTTAPLEEQVIRLAELFRDRLTNLVSQWVRVGYCQGNFNSDNCAAG
    GFTLDYGPFGFCEFFEADYQPWTGGGRHFSFLNQPIAAQKNFDMFCRSLMTLLEENSAQLSQLNAINDGFSGVMERAMES
    MWATKLGLASYDHDLLIKLLQLMLRTGVDYNMFFRELSSIPEDMASLTKSFYYPPKAEVMTEWEAWLQSWRERIEKDAEA
    QGNQTNAIATIAENMQQANPKFTWREWLIVPAYKAAEKGDFTQIHELQNILTAPYDEQSEEVENKYYQLRPLEFFSAGGV
    AHYS
    CSS

    >gi|196156418|ref|YP_002125907.1| HesB protein family [Alteromonas macleodii 'Deep ecotype']
    MGMSVETALPIEFSDAAAAKVKTLVSEEENPDLKLRVYVTGGGCSGFQYGFTFDEKVNEGDMTIEKDSVTLVVDPMSLQY
    LVGGVVDYVDGLEGSRFLVQNPNATTTCGCGASFSV

    >gi|196156433|ref|YP_002125922.1| putative phage shock protein E [Alteromonas macleodii 'Deep ecotype']
    MRIVVAVFLVVVGIALFVSLQCTAKATSQSQASVAASPYLIERVANNDWLLIDVRSPKEFADGHIPGAVNMPHENINDYL
    SELEGHKDKPIIIY
    CRSGRRAKLAMKVLEDLDFSEVMHLEGDMLGWSAAGMTVDRM

    >gi|196156449|ref|YP_002125938.1| thioredoxin reductase, FAD/NAD(P)-binding protein [Alteromonas macleodii 'Deep ecotype']
    MGSGPAGYSAAVYAARANLEPVLLTGIQQGGQLTTTTEVENWPGDPEGLTGPDLMVRMQKHAEKFDTEIIFDHINKTDLT
    KRPYTLYGDSGTYTCDALIIATGASAKYLGLESEQAFMGKGVSA
    CATCDGFFYRNQKVAVVGGGNTAVEEALYLSNIASE
    VHVIHRRDSFRSEKILEQRLREKAENGNVVLHLNRTLDEVLGDEMGVTKIRIKETEGDATEELDVMGLFIAIGHKPNTDI
    FDGQLEMKDGYITVNSGTNGNATQTSVEGVFAAGDVSDHIYRQAITSAGTGCMAALDAEKYLDGIMPEQG

    >gi|196156583|ref|YP_002126072.1| Peroxiredoxin [Alteromonas macleodii 'Deep ecotype']
    MALINTAIKPFKATAFKDGEFIDVSSEDIKGKWAVFVFYPADFTFVCPTELGDIADKYEELQSRGVEVFSVSTDTHFTHK
    AWHDSSDTINKIKFAMIGDPTGEITRNFDCMRETMGLADRATFVVDPEGIVQAMEITSEGIGRDADDLVRKVKAAQYVAN
    NPGEVCPAKWKEGEETLAPSLDLVGKI

    >gi|196156584|ref|YP_002126073.1| probable alkyl hydroperoxide reductase subunit F [Alteromonas macleodii 'Deep ecotype']
    MLTKEILQALKSYAETMQKNVTFVVQTGEHSKRDELVKFLSDIASVSEKLNVEERDTNGELRSAISFLLEADGEDTGIRF
    SGIPGGHEFNSLVLAMLHAAGTELKLDDSVKAMVKAINEPLNFEVFISLS
    CHNCPEVVQALNQFALVNPNIKAEMIDGGL
    YQNLIQERDIQGVPSVYLNGELFANGKVDASVLINKLIERDPSLKEANKGDALPLQDVTVIGGGPAGVASAIYSARKGLK
    VAIVAETFGGQVKDTMGIENLISVPKTTGPELVGNLMEHVRDYDITLKEHVRVDSIEKGNIKTITLSSGEQIRTRTVIVA
    TGARWRELGVPGERENVGNGVAY
    CPHCDGPFFKGKDVAVIGGGNSGIEAALDLAGIVKSVTVFEFMPELKADQVLIDQAE
    KRDNITIIKNAATRQITAENGKVNAIEYQDRSTNEIHTRELAGVFVQIGLVPNSQFMKDTVEMTQYGEIVVDNKCHTSEP
    GIFAAGDVTTVPYKQIVISMGEGAKASLAAFEYLLSHEVVESEDESEAA

    >gi|196156596|ref|YP_002126085.1| mercuric reductase (Hg(II) reductase) [Alteromonas macleodii 'Deep ecotype']
    MFKKIALLGVIAAAIFSFFYFDLNSYLTLEGMKGSLDTFKSQIADNPVLSIGVFFAIYVAVTALSLPGAAILTLAAGALF
    GLVQGLVIVSFASSVGATLAFLVSRFILRDTVRNKFKEKLKKIDEGVEKQGAFYLFTLRLVPVFPFFLINLLMGLTSLKT
    WTFYWVSQIGMLAGTAVYVNAGTQLAQIDSLSGIVSPGLIFSFVLLGIFPWIAKGIVALVNRRRVYKGYNKPKKFDRNLV
    VIGAGAGGLVTSYIAAAVKAKVTLVEAGEMGGD
    CLNYGCVPSKAIIKTAKVANQMRHADNYGLEPVSPAMSFKKVMARVH
    EIIAAIAPNDSVERYTSLGVDVVKGYAKIIDPWTVEIKKNDGGTQTLTTKTIVVATGAAPFVPDLPGIEQSGYVTSDTLW
    SKFADLEESPKRLIVLGGGPIGCELAQAFSRLGSKVTQVERAPRLMGKEDADVAEYAESVLRESGVNVLTSHDALRFERQ
    NGEKVLVVAKEGVESTIAYDEVIIAVGRKARLNGFGLEDLGIKFDRTIDTDEYLQTLMPNIFAAGDVVGPYQFTHVAAHQ
    AWYAAVNALFGTFKKFKVDYRVIPWTTFIDPEVARVGLSERDAAEQDIDVEVTRYEFAELDRAVAESARKGFIKVLTPPG
    KDKILGVTIVSEHAGDLLAEFVIAMKHDLGLNKILGTIHAYPTWAEGAKYAAGNWKRANAPEKLLGFVEKFHTWRRG

    >gi|196156711|ref|YP_002126200.1| probable glutathione peroxidase [Alteromonas macleodii 'Deep ecotype']
    MTLELYQHSLTLNTGEQTTLEQYKGKVLLIVNTASKCGFTPQYEGLEALYKKYHDKGFEILGFPCDQFGHQEPGSDEDIA
    QFCTLNFGVSFPLFKKTNVNGPDANPLFEALKNEAPGLLGSKRIKWNFTKFLINAEGKVLKRYAPTIKPSSIDSDIAELL
    EKNSE

    >gi|196156746|ref|YP_002126235.1| hypothetical protein MADE_01937 [Alteromonas macleodii 'Deep ecotype']
    MYKFVALENYKEIRQPLLEAMEANGIKGTLLLASEGINGTVSGTREGIDALLAYLNSDARINPISFKESLHDEQPFYRTK
    VKLKKEIVTMGVEGIDPRETVGTYVKPKDWNALISDPEVTVIDTRNGYEIEIGTFKNAIDPKTETFREFPEYVSKELDPS
    KNKKVAMF
    CTGGIRCEKSTAYLKEQGFEEVYHLEGGILQYLDDVPKEESMWEGDCFVFDNRVAVNHDLEKSHYEQCYACR
    LPITAEDKQSDKYEPGVSCPHCFGTHTDDQIARFREREKQVQLAKERQQEHVGTGARLTMEQKRKEKAEAQRLRALKANE
    NQA

    >gi|196156851|ref|YP_002126340.1| putative mercuric reductase [Alteromonas macleodii 'Deep ecotype']
    MNAQGSSNCCASKAKQLHVAIIGSGSAAFSCAIKAAENGARVTIIEGADVIGGCCVNVGCVPSKILIRAAQLAHQQRSNP
    FTGIEDHEPKIDRTLLSHQQISRVDELRTAKYQNILKNNPALTLIKGYARFSSKNALNITHADGTEVTLLADKFLIATGS
    TPTFPKIEGLQNTPYWTSTEALFEKELPKSLAVIGSSVVAVEIAQAYARLGCQVTILARSTLLKSEDPLLGDRLSQCFEK
    EGIEIINNTQVTRITHDDNGFFIQTEDEQVLCEKLLISTGRHANTVGLDLDVVGVRTDGSGAVLVNEKLETNVSHIYAAG
    DCSTIPQYVYVAAAAGSRAGSNMTGDNLKLDLSIMPAVIFTDPQVATVGLSEGEAENQGISVISRVLEMENVPRALANFE
    TDGFIKLVADKQSNKLIGAQILAHEGGELIQSAALAIHNQMTIEDLANQLFPYLTMVEGLKLCAQTFNKDVSELSCCAG

    >gi|196156867|ref|YP_002126356.1| copper-translocating P-type ATPase [Alteromonas macleodii 'Deep ecotype']
    MATHDCYHCGLPIASHEEGKFNTVILGQQRNMCCPGCLAVAEAIVDNGLEDYYQFRTEPAQKSDDGILETLDKLKVYDDP
    SLQEEFVFEEGQDKQIQLTLEGIT
    CAACGWLIEKQLSKVEGIKQVAVNVQERRALVTWSPFQIKLSQILSTLKRIGYVGS
    PFHPDEHEASYKREQKTFLKKLGLAGIMTMQVMMLMTGLYFDWFGAIELETRQYFYWVALTLTTPVVLYSGSTFYVGAAK
    ALSARTVNMDVPVSLAIFGTYIAGIRSTVLEQGEVYFESICMFIFLLLLSRFLEHRSRQRAAQISANMMQYVPVSATKLE
    ANDSVTECLAKQLKIDDIVLVKPGETIPIDGLVTQGSAAVDESMLTGEFNPVRKSANSTVYGGTVCQDGTLTVKVTQTLK
    NALVNQIVRLQASAMASKPKAAQLADNFSRYFVSAVLVISALTYGFWYVNGSEDAFWITISVLVATCPCALGLATPSALT
    CAMAKLNRQGILLKRADALEQITNIDTIALDKTGTLTQGKFTISNAWFADGIDSESAMAIACALEARSEHPIAKAFNGKV
    SHKVDNFTVTPGGGISGVINDTHFSMGSAAFSLANLPSSDTYPSANVFLTVKGQIIAAFEVRDTLRDDTHETLDILSQSH
    TLAVLSGDTQQNVDTLTAPLPIKTAKGGLTPEQKYEAVQQMQQGGAKVMMMGDGINDAPVLASADVAIAVGNATDVAKTA
    ADVILLGDQLLSVPALIKTSHQVKQKIRQNIGWAVGYNLLILPFAVSGLLSPWMAVVGMSLSSIIVVTNSTRLLSK

    >gi|196156880|ref|YP_002126369.1| rhodanese-related sulfurtransferase [Alteromonas macleodii 'Deep ecotype']
    MSSVLLSVAELASSMQQKPITLLRALMDDPVSKTPDTRKAMVLPASVDFDLDSEGSDHTTGFPHSMPSAEDLAIYLGNQG
    VTANTPIVVYDTRGIYTAPRVWWMLKALGHSDVYLLNGGQPAWENAGLPVSEQQQYGKLTYQATPRPGWFSNSSAVLQAL
    NTDAQLVDARSSARFKGEISEPRKGVRAGHMPGAFNVPFDILLKNGHFLPVSELENVFKGAHIDLRKPIICT
    CGSGVTAC
    IIGVAALMCGATQVSVYDGSWSEWGAGTHYPVVTDE

    >gi|196156881|ref|YP_002126370.1| Peroxiredoxin [Alteromonas macleodii 'Deep ecotype']
    MASVTFQGNAVSTIGQLPEVGAKAPDFTLVKADLGEVTLSELAGKNIVLNIFPSIDTGTCAMSVRKFNEEAAKLDNTTVI
    CVSADLPFAAGRFCGAEGIENVLTGSTFRSTFGDDYGVTFESAPLTGLLSRSVVVIDTEGKVVYTEQVAETTEEPNYDAA
    IAALSE

    >gi|196156944|ref|YP_002126433.1| thioredoxin-dependent thiol peroxidase [Alteromonas macleodii 'Deep ecotype']
    MKTLQAGDKAPQFSLQNQDDQTVSLSDYAGKKVLVYFYPKAMTPGCTVQAQGLRDVNDELKEKNVVVLGISPDAVKRLPK
    FIEKENLNFTLLSDEDHAVADAFGVWGPKKFMGKEYDGIHRLTFLIDENGVVEHVFNKFKTKEHHTVVLDYLNS

    >gi|196156947|ref|YP_002126436.1| Thioredoxin related protein [Alteromonas macleodii 'Deep ecotype']
    MGLLKAKANTNKLKPLLTLLLLVTAAMGGIFTYQHLQHDFETLEGRTYSWSTLKGQWVVVNYFAPWCAPCLREMPELAKF
    NASLPSNTKLFAVNYDLKTLSELKEMTEKYNITIPVIVSSQSTALPMEKPPYLPATFIIGPEGKVVDTIMGELTAAHLTQ
    RLQALRRE

    >gi|196156948|ref|YP_002126437.1| putative arsenate reductase ArsC [Alteromonas macleodii 'Deep ecotype']
    MTDITIIHNPRCSKSRQTLALLEEKGLSPVVVQYLKEPLNASALKDIFKKLNVESVREMMRTKENEYKDANLGDETLSDD
    DLFNAMEATPKLIERPIVIKGDSARIGRPPESVLEIL

    >gi|196156997|ref|YP_002126486.1| Glutathione peroxidase [Alteromonas macleodii 'Deep ecotype']
    MKTKGYAAALLSLSLFTSLSYANECPSVLKFMKRKLNSQETVNLCDEYAGKTLLVVNTASYCGYTPQFEGLEALYRNYKD
    KDFAVLGFPSHDFNQEDSDEGKTAELCELTYGVKFPMFEPISVKGDDADPMYRMLKNATGKAPSWNFNKYLIDSSGKQIT
    HYPSSTKPTDAAFIADIEALLKSE

    >gi|196157026|ref|YP_002126515.1| putative alkylhydroperoxidase AhpD family core domain protein MED92 [Alteromonas macleodii 'Deep ecotype']
    MNDFTLHTKDTAPEAAKPLIDNSVSAFGMLPNLHAVMAEAPTLLEGYQVLHKLAQETSFSADELTVVWQSINVEHACHYC
    VPAHTGIAKSMNVSDTLIEELRNDEVLSDSKLNTLKETVLAVTRGRGNVEETQLKAFYDAGYAHKQLLEIILVLAQKVMS
    NYTNHLAETPVDEPFKKFEWSPK

    >gi|196157344|ref|YP_002126833.1| arsenate reductase [Alteromonas macleodii 'Deep ecotype']
    MSTILYGIPNCDTIKKAKKWLTENDIPFSFHDYRKDGIDNNFLSRAEAELGWETMLNKRGTTFRQLEEQEKATLNKDKAL
    ALLELHPAMVKRPILFHNNTFHIGFKPAQYEEIFC

    >gi|196157530|ref|YP_002127019.1| Na(+)-translocating NADH-quinone reductase subunit E [Alteromonas macleodii 'Deep ecotype']
    MTEFLLLLIGTVLVNNFVLVKFLGLCPFMGVSGKLETAMGMSMATTFVLTLASASSYLVETYLLAPLGIGYLRTLAFILV
    IAVVVQFTEMVVHKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNLTEQHNFMQSLIYGFGAAVGFSLVLVLFAAMRERLAA
    ADVPVAFKGASIAMITAGLMSLAFMGFSGLVKV

    >gi|196157535|ref|YP_002127024.1| NADH-ubiquinone oxidoreductase [Alteromonas macleodii 'Deep ecotype']
    MTDFRDLSLQGLWKNNPALVQLLGLCPLLAVTATFINGLGLGLATMLVLIGSNVTVSLVRNVVRNEIRIPVFVMIIAAFV
    TIVQLLMNAFTYELYLALGIFIPLIVTN
    CAIIGRAEAFASKNGPLASAYDGLMMGLGFTAVLVILGGMREILGAGTLLTG
    ADRLFGPIAENWTIVLFNTENPFLLAVLPPGAFLGMGLLIAIKNSIDAKIAAQQTAPTEKAARVRVTAES

    >gi|196157544|ref|YP_002127033.1| antioxidant, AhpC/Tsa family protein [Alteromonas macleodii 'Deep ecotype']
    MSVLVGRPAPDFTAAAVLGSGEIVDSFTLSEAIKGKKAVVFFYPLDFTFVCPSELIAFDKRFDEFKKRGVEVIGVSIDSQ
    FSHNAWRNTPVNQGGIGPVKYTLVADVKHDICQAYDVEHPEDGVAFRGSFLIDEAGMVRHQVVNDLPLGRNVDEMLRMVD
    ALAFHEEHGEVCPAGWTEGKSGMDASPEGVAKYLSEEADKL

    >gi|196157550|ref|YP_002127039.1| putative glutaredoxin like protein [Alteromonas macleodii 'Deep ecotype']
    MDNTENQSTLDRIKQQIEENPILLYMKGSPKLPSCGFSSQASQALMSCGEPFAYVDILQNPDIRAELPKYANWPTFPQLW
    VEGELVGGCDIIIEMFQQNELQPLIKETAEKFKEEE

    >gi|196157750|ref|YP_002127239.1| putative mercuric reductase [Alteromonas macleodii 'Deep ecotype']
    MVRRLSFTICNARPIVDAQQWRHLAYHLPMNLGVTFMSDNNLHIAVIGSGGSAMAAALKATERGARVTLIERGTIGGTCV
    NIGCVPSKIMIRSAHIAHLRRESPFDDGLSAQAPAVNRSALLAQQQARVEELRESKYQSILNDNAAITVLKGEARFVDER
    TLTVTLNDGGEQTVHFDRAFIGTGARPAEPPVPGLSETPYLTSTSALELDHIPERLVVIGASVVAIELAQAFARLGSRVT
    ILARSRVLSQEDPAVGEAVEAAFRREGIEVLKQTQASEITHNGRVFTLQTNAGTLEAEQLLVASGRTPNTENLNLEAVGV
    ATERGAIRIDNHLQTTASGIYAAGDCTDQPQFVYVAAAGGSRAAINMTGGDASLDLSAMPEVIFTDPQVATVGLSEAEAQ
    AQGYDTDSRTLTLDNVPRALVNFDAGGFIKMVAERGSGRLLGVQSVAGEAGELIQTAVMALRARMTVNDIADELFPYLTM
    VEGLKLCAQTFTKDVKQLSCYAG

    >gi|196157760|ref|YP_002127249.1| MerT mercuric transport protein [Alteromonas macleodii 'Deep ecotype']
    MIQRSESKKSLLVASLTAIGASVCCVGPLVLLTLGVGGSWASTLTAFEPVRPIFILITLGLLVWTFRKLYIAPRQCNEGE
    LCAIPRVQRNQRIIFWVVSVLIMLLLTFPYYAEFIIT

    >gi|196157867|ref|YP_002127356.1| thiol:disulfide interchange protein dsbE (cytochrome c biogenesis protein ccmG) [Alteromonas macleodii 'Deep ecotype']
    MKKTSLVAIPIVLFSLLVIFLFKGLFSDPRELDSQVKDKTLPAFSLPDLMQPDVTYTPEDLKGQVTILNVWGVWCVTCAV
    EMPYLTQLKNEQDVHIVGLYFDQDLDPDFGTKTLSRVQQEVTEMLSRYGNPYAYNIFDVYRDTSLDLGVTGAPEHFVIDA
    NGVIRMHHIGDINERVWNTKVGPLYNKLVAQAAKTQGADAHTEVNAVMSDDKSAQGGLQ

    >gi|196157940|ref|YP_002127429.1| putative organic hydroperoxide resistance protein [Alteromonas macleodii 'Deep ecotype']
    MHKLQQVVYTGTATATGGREGTAKSSDGKLDLDLSTPKELGGAGGEGTNPEQMFAAGYSACFIGALKHVAASQKIKLADD
    ISVTGDVSIGPIDQGFAIAVKLTVDLGDMDKTQAQSLVDTAHQV
    CPYSNATRGNIEVDINLA

    >gi|196158022|ref|YP_002127511.1| dihydrolipoamide dehydrogenase [Alteromonas macleodii 'Deep ecotype']
    MSEIKTQLVVLGGGPGGYSAAFRAADLGIETVIVDSRDTLGGVCLNVGCIPSKALLHVAKVMKEAKHLANHGVTFGEPTI
    DLDKIREYKDSVVSQLTNGLGGMSKMRKTKHVQGYGKFTGANTLEVKNGDDVTTITFEKAIIAAGSEPVSLPFIPEDDRV
    IDSTGALEMKDIPEKMLVLGGGIIGLEMGTVYEALGSKIDVVEFLDQLIPAADKDIMKVFMKDYKDKFNIMLETKVTAVE
    AKDDGLYVTFEGKKAPAEPVRYDKVLVAVGRKPNGKLVGADAAGVNVDDRGFINVDKQMRTNVDHIFAIGDLVGQPMLAH
    KAVHEGHVAAEVIAGQKHYFDPRAIPSVAYTEPEVAWVGLTEKEAKEQGVSYETATFPWAASGRAIASDATNGMTKMIFE
    KETGRVIGGAMVGTNAGEMLGEIGLAIEMGADAEDVALTIHAHPTLNESIGLASEIFEGSITDLPNPKAKKKK

    >gi|196158076|ref|YP_002127565.1| putative peroxiredoxin/glutaredoxin family protein [Alteromonas macleodii 'Deep ecotype']
    MSESRFTSKEGQKIPSVSFQCREGDAWVTKTTEALFSGKNVVVFSLPGAFTPTCSSTHLPRYNALAKKFAKHGIDDIVCM
    SVNDTFVMNAWAADQEADNITVIPDGNGEFTDGMGMLVDKADLGFGKRSWRYSMLVKDGVVDKMFIEPDVAGDPFEVSDA
    DTMLAYIAPEEQNNPPVSILTKPS
    CPFCAKAKALLDEKGYEYEEIVLGKGASLTSLTAISGRETVPQVFIGGKHIGGSDD
    LEAYFS

    >gi|196158105|ref|YP_002127594.1| osmotically inducible protein [Alteromonas macleodii 'Deep ecotype']
    MSIVKSGSAAYKPLGKEGKGSISTETGALSNQPYGFNTRFEDGKGTNPEELIGAAHASCFTMALSFALSDAGYDDGELNT
    TAKISLDKSDDGFEITKSALTLDAEVEGITEDEFEKIAQEAKEN
    CPVSQLLNANITLEYKLNNS

    >gi|196158205|ref|YP_002127694.1| thiol:disulfide interchange protein DsbC [Alteromonas macleodii 'Deep ecotype']
    MKAVQKMLLAGAFAVGSLLSISTQAADEAAIRDKLTSMLGLDVETIADSPVSGLVQVSTNRGLFYVSENGQYLLQARVFN
    IDEEMRNETELALSGLRKDGVKQMKSSSITFKAENEKYEISVFTDIT
    CGYCRKFHNEIDELNDAGITVHYLAFPRSGLNS
    QNYDDMVSVWCAKDPQKALTKAKAGSDVASASCKNKVAEQYMLGQKLGVNGTPNIVLPDGSLIPGYQPAKMLAKALAATE


    >gi|196158294|ref|YP_002127783.1| glutathione reductase [Alteromonas macleodii 'Deep ecotype']
    MTHFDYICIGGGSGGIASANRAAKHGKKAAIIEAKDIGGTCVNVGCVPKKAMWYGAQVAEAIHRYAPEYGFDLSVNHFSW
    DSLIASRQAYIERIHASYDRALTANDVTLIRGFAKFIDNNTVEVNGEQYTADHITIAVGGRPTIPDIEGAEHGIDSDGFF
    ALKEQPKRAVVVGAGYIGVELAGVLHALGTESHLVVRKHAPLRNFDPIIHETLVDMIHAEGCKLHDHASVEKVEKAENGE
    LSIYLTNGEVLEADCLIWAIGRQPSTDKIDIENTDVELNDDGTIKVDKYQNTTAKNVYAVGDITGEAELTPVAVKAGRLL
    SERLFNGQKDAHMDYSLIPTVVFSHPPIGTIGLTEPEAIEKYGEDDIKVYTSSFASMYTAVTRHRQMTKMKLVCAGKDEK
    VVGLHGIGHGMDEILQGFAVAIKMGATKADFDACVAIHPTSAEEFVTMT

    >gi|196158379|ref|YP_002127868.1| soluble pyridine nucleotide transhydrogenase [Alteromonas macleodii 'Deep ecotype']
    MAAKQKQKSPSYHYDAIVIGTGPGGEGVAMQLAKAGKKVAVVERYEAVGGGCTHWGTIPSKALRHSVSRLIEYTSSPLFA
    DNHLSKSLTFSDIMRHASGVVKSQTRLRSSFYDRNRVTLFYGEASFVDAHTLEITREDGSKDTVTAAQIAIATGSRPYCP
    KDIDFNHPRVYNSDTILSLDHDPKSIIIYGAGVIGSEYASIFRGLGVKVDLVNMRDRLLSFLDDEISDALSYHLWNNGVL
    IRHNETYSSVETLDDSVILNLESGKRMRADCLLFANGRTGNTDTLKLENVGLKADNRGQLRVNENYQTEIDNIYAVGDVI
    GYPSLASAAYNQGRFAAEAMLGISTHSALVADIPSGIYTIPEISSVGKTEQELTAAKVPYEVGRAQFKHLARAQIASTQT
    GSLKILFHRETKEILGIHCFGERASEIVHIGQAIMQQKGEGNTIDYFVNTTFNYPTMAEAYRVAAINGLNRIF

    >gi|196158435|ref|YP_002127924.1| peptide methionine sulfoxide reductase MsrA [Alteromonas macleodii 'Deep ecotype']
    MANLQVATLAGGCFWCIESAFNTVEGVEKAISGYAGGEKADPTYEEVCTGTTGHAEVVQVTFDADSISYREILEIFFALH
    NPTQLNRQGNDVGPQYRSAVFYHNAEQKAEAEKIIAEITEEEIWPDPVVTEIVEINNYYDAEDYHQDYFKNNPQNQYCSM
    VVAPKLAKFKKTFASRLRSDA

    >gi|196158445|ref|YP_002127934.1| thiol:disulfide interchange protein DsbA [Alteromonas macleodii 'Deep ecotype']
    MKKFAVMFVMAMLLPLTACAQEPASKWKEGTHYKVLDKEATDKPVITEYFSFWCPHCFQFEPIVAQIKEKKSDGTKFNKV
    HVNFMRFTGPEVQDDATKAMLIARAMKQEDAMNKAIFNYIHKQRASITGLKDLRNIFVVNGVDGEEFDKMAKSFGVNSML
    RKNQQQIDEYREHLTGVPSFIINGKYQPTFTADMSFDDIADLIVWLSEQK

    >gi|196158659|ref|YP_002128148.1| molybdopterin biosynthesis protein MoeB [Alteromonas macleodii 'Deep ecotype']
    MRYSRHILLSDFDLERQEALVNCSVLVIGVGGLGCAASQYLTASGVGHLTLVDDDKVELTNLQRQVLHTEKSVGANKVDS
    AQLALQQINSEVNITTLCLRPSEKQLDELIAKQDVVLDCTDNLESRNRINQICYRQSIPLVSGAAIRMEGQILCIDPRQQ
    SACYACVSHFFGEQNLS
    CVESGVMSPLVGIIGAMQALEAIKLVTHYGKPLCNRLHLYDAMQATWSEFKVTRQQDCQVCGS
    KAKL

    >gi|196158686|ref|YP_002128175.1| Methylated DNA-protein cysteine methyltransferase [Alteromonas macleodii 'Deep ecotype']
    MIYTASIKSPQGLVEVCANNKGVTSIAFINDDANLLAAGVKEAEQQTNDITTEACRQLAAYFNKKLKDFDLPLDHKGTAF
    QQRVWAALLQVQYGDTASYLDIAKTIGNPKAVRAVGMANGRNPIAIVVP
    CHRIIGSNKTLTGYAGGLSRKQYLLNLEGAQ
    GVLW

    >gi|196158717|ref|YP_002128206.1| thiol:disulfide interchange protein precursor [Alteromonas macleodii 'Deep ecotype']
    MSCNFMTTLTQFSSKSAPLWRRFIALIVSVLCLSQLLSAPAFAQMPSAFDDPFVDEPQFLDVDQAFVFDFNQQRDTLTLT
    FDIADGYYLYLKQFKFVSKQAEIGDPTFPRGVMIEDEFFGESEVFYDRVSITLPISYANSDGVVKVRYQGCADAGLCYPP
    TIKVVYLNEMGSNAATTQPAGDENNAASSLQSEQFNLAQKLIDKDNLPLTLALFFALGVGLAFTPCVFPMYPIVSGIVIG
    QGKPKTASHSFWLTFVYVQGMAITYSLLGLVVAVAGAQFQAALQHPAILGVFIVLFVALAIALFGGFDIQLPAKYQEKLT
    HMSNSQTPGSFAGVFVMGVLSGLIASPCTTAPLTGILLFIAQTGDMTLGFISLYLLSIGMGVPLILFGMTGGKLLPKAGN
    WMNVVKVTFGFMMLAVAIVFIERLYTSPYTAFLWALLGFGLFGYYWVINRASPNSLIKLARAVIVAMGIMGSAGLTYQAG
    INTGLWGEHAEIVHSSHPEFVVARDLTDLRHKIAAANGEGKTVMVDLYADW
    CVACKEFEKYTFPDEKVVTALSNTVWMQM
    DLTDNTPERQEIFDTFNVLGLPTILFFDANGDELTKARVTGFMKADAFARHVNEWLNDAPVTRDSKHEPGN

    >gi|196158799|ref|YP_002128288.1| uncharacterized secreted protein of SCO1/SenC/PrrC family [Alteromonas macleodii 'Deep ecotype']
    MNQRITVGLVAFLALCAGIVGALYIAPPSVEGEPDYFQTYPEPRAISPFSLVSHKGERFDTSSLKGQWSLVFVGYTFCPD
    ICPTTMAELNNIYPELQALNSVEPIRIVFVSVDPKRDSVERLAEYVSYFNEEFIALTGEHKTLFPFVRNLGMMYAIAEST
    DNPNYLVDHSASVVLIDPEARVIGRFKPKREPGKLSISDSQQILADMPVIISKQ