Haemophilus influenzae 86 028NP uid58093

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|68248634|ref|YP_247746.1| thioredoxin [Haemophilus influenzae 86-028NP]
    MSEVLHINDADFESVVVNSDIPVLLDFWAPWCGPCKMIAPVLDELAPEFAGKVKIVKMNVDDNQATPAQFGVRSIPTLLL
    IKNGQVVATQVGALPKTQLANFINQHI

    >gi|68248713|ref|YP_247825.1| hypothetical protein NTHI0184 [Haemophilus influenzae 86-028NP]
    MITVYGIKNCDTVKKALKWLADHNIEHKLHDYRVDGLDLNFLTQAETQFGWDVLVNKRSTTWRNLDEQVKNSLDKTTALS
    VLAENPTLIKRPIILQDEKALIGFNEKEYQAVFA

    >gi|68248726|ref|YP_247838.1| glutathione S-transferase [Haemophilus influenzae 86-028NP]
    MKLYGLIGACSFVPHVALEWVKIRENADYEFEPVTRELIKSPEFLSLNPRGAVPVLVDGDLVLSQNQAILHYLDELYPNS
    KLFGSKTVRDKAKAARWLAFFNSDVHKSFVPLFRLPNYAKDNETLAHTIRQQAVEQILDQLAVANEHLESHIYFGEDISV
    ADAYLYIMLNWCRAVGIDFSHLTQLSAFMQRVETDQAVENVRKSEELKV

    >gi|68248736|ref|YP_247848.1| peroxiredoxin [Haemophilus influenzae 86-028NP]
    MTMVLVTRQAPDFTSSAVLSNGEIVDNFNFKKHIAGKAAVIFFYPLDFTFVCPSELIAFDHRYEEFKKRGVEVVGVSIDS
    QFTHNAWRNTPTENGGIGQVKYALAADVKHEIAQAYGIEHPEAGVALRASFLIDKNGVVRHQVVNDLPLGRNIDEMLRMV
    DALQFHEDHGEVCPAQWEKGKEGMKDNPEGVAKYLKQNADKL

    >gi|68248769|ref|YP_247881.1| glutathione reductase [Haemophilus influenzae 86-028NP]
    MTKHYDYIAIGGGSGGIASLNRAASYGKKCAIIEAKHLGGTCVNVGCVPKKVMFYGAHIAEAINNYAPDYGFDVEVKKFD
    FSKLIESRQAYISRIHTSYNNVLAKNNIDVINGFGKFVDAHTIEVTLADGTKEQVTADHILIATGGRPYRPNIKGQEYGI
    DSDGFFALTELPKRAVVIGAGYIAVELSGVLNSLGVETHLLVRRHAPMRNQDPLIVETLVEVLAQDGIQLHTNSTPSEIV
    KNADGSLTVKCDGQSDVTVDCVIWAAGRVPTTDKIGLENAGVETNEHGYVKVDKYQNTNVKGIYAVGDIIENGIELTPVA
    VAAGRRLSERLFNNKPTEYLDYSLVPTVVFSHPPIGTVGLTEPQAIEQYGAENVKVYKSSFTAMYTAVTQHRQPCKMKLV
    CVGKDEKVMGLHGIGFGVDEMIQGFAVAIKMGATKADFDNTVAIHPTGSEEFVTMR

    >gi|68248774|ref|YP_247886.1| Na(+)-translocating NADH-quinone reductase subunit D [Haemophilus influenzae 86-028NP]
    MSGKTSYKDLLLAPIAKNNPIALQILGICSALAVTTKLETAFVMAIAVTLVTGLSNLFVSLIRNYIPNSIRIIVQLAIIA
    SLVIVVDQILKAYAYGLSKQLSVFVGLIITN
    CIVMGRAEAFAMKSPPVESFVDGIGNGLGYGSMLIIVAFFRELIGSGKL
    FGMTIFETIQNGGWYQANGLFLLAPSAFFIIGFVIWGLRTWKPEQQEK

    >gi|68248775|ref|YP_247887.1| Na(+)-translocating NADH-quinone reductase subunit E [Haemophilus influenzae 86-028NP]
    MEHYISLFVKAVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVTFVLGIAVPVNQLIYANVLKENALIEGVDLSFLNF
    ITFIGVIAGLVQILEMVLDKFMPSLYNALGIFLPLIAVN
    CAIFGGVSFMVQRDYNFPESIVYGFGSGLGWMLAIVALAGL
    TEKMKYADIPAGLKGLGITFISVGLMALGFMSFSGIQL

    >gi|68248845|ref|YP_247957.1| putative arsenate reductase [Haemophilus influenzae 86-028NP]
    MSVIIYHNPHCSKSRETLALLENKGIQPIIELYLQKQYSVNELQSIAKKLGIDDVRQMMRTKDELYKSLNLDNLDLSQAE
    LFKAMSEHSALIERPIVINGDKAKIGRPPETVLEIL

    >gi|68248861|ref|YP_247973.1| thioredoxin-dependent thiol peroxidase [Haemophilus influenzae 86-028NP]
    MNPLSVGNQAPAFTLLNQQEKFVSLSDFRGKKVLIYFYPKALTPGCTTQACGLRDSKSELDALGLVVLGISPDAPKKLAQ
    FIEKKALNFTLLSDPDHQVAEQFGVWGEKKFMGRTYDGIHRISFLINESGTIMQVFDKFKIKDHHQMIIDYLRSL

    >gi|68248894|ref|YP_248006.1| putative cation-transporting ATPase [Haemophilus influenzae 86-028NP]
    MLDLTPQSKKISIQIGGMTCQSCANRIEKVLNKKPFVQQAGVNFAVEEAQVVFDATQASETQIIEIIHKTGFSAHIKQAN
    ELPIEENTSIPWRLIILWIINIPFLIGMLGMIGGSHHLMLPPIWQFALASIVQLWLAIPFYCGAIGSIRGGLANMDVLVS
    TGTLTIYLYSAFMLFYHADHAMGHVYFEASVMVIGFVSLGKFLEDRTKKHSLNSLSMLLQLTPKKVTVLRNEKWTEIALD
    QVNIGEIIRANQGERIAADGIIESGNGWCDESHLTGESRPEEKQKGGKVLAGAMVTEGSIIYQANQLGSQTLLGDMMNAL
    SDAQGSKAPIARFADKVASVFVPVVLVISLVTFALTYILTNDSVSSLIHAVSVLVIACPCALGLATPAAIMVGLGKAVNA
    GVWFKDAAAMEETAHVDTVVLDKTGTLTKGELEISALWQPQSAVYSEDDLYRFAAAVERQANHPIAKAIVQAAEQKMLEI
    PTALFSKMEVGQGIQAELEQVGTIKVGKPDYCGLILPKNLEDIWQIASIVAVSINDEPIGAFALTDTLKNDSLHAIQRLQ
    QQNIDVVIMSGDQQSVVDYIAKQLGIKKAFGGLSPRDKAEQIQKLKAQGHIVAMVGDGINDAPALASANVSFAMKSGSDI
    AEQTASATLMQHSVNQLVDALFIARATLKNIKQNLFFALIYNILGIPLAAFGFLSPIIAGAAMALSSISVLMNALRLKKV
    RF

    >gi|68248979|ref|YP_248091.1| hypothetical protein NTHI0496 [Haemophilus influenzae 86-028NP]
    MGITLTEKAAQRVKAFLDNRGKGIGLRLGVKTSGCSGLAYVLEFVDVLNSEDQVFEQHGVNIIVDPKSLVYLNGIELDYV
    KEGLNEGFKYNNPNVKESCGCGESFHV

    >gi|68249005|ref|YP_248117.1| methylated-DNA--protein-cysteine methyltransferase [Haemophilus influenzae 86-028NP]
    MLFFYKTRRKMTALYYTYYPSPVGRLLILSDGESITHIDFEKEQYAPNPKWLKQDELPVFQKVRLAFERYFNGEVERFAD
    IPLKPEGTAFQQAIWQALREIAYGELSTYGELALRINNPKAVRAVGGAVGSNPISIIIP
    CHRILGKDRTLTGFGGGLEAK
    RFLLQLEKIPYIDKGTENTKPRFFKKYHE

    >gi|68249028|ref|YP_248140.1| disulfide bond formation protein B [Haemophilus influenzae 86-028NP]
    MLALLKQFSEKRFVWFLLAFSSLALESTALYFQYGMGLQPCVLCVYERLAMIGLFVAGIIALLQPLAFILRLIALALGLF
    SSIKGLLISFRHLDLQMNPAPWKQ
    CEFIPNFPETLPFHQWFPFIFNPTGSCNESQWSLFGLTMVQWLVVIFSLYVVILTL
    LLIAQVIKTRKQRRLFN

    >gi|68249172|ref|YP_248284.1| peroxiredoxin/glutaredoxin [Haemophilus influenzae 86-028NP]
    MSSMEGKKVPQVTFRTRQGDKWVDVTTSELFDNKTVIVFSLPGAFTPTCSSSHLPRYNELAPVFKKYGVDDILVVSVNDT
    FVMNAWKEDEKSENITFIPDGNGEFTEGMGMLVGKEDLGFGKRSWRYSMLVKNGVVEKMFIEPNEPGDPFKVSDADTMLK
    YLAPQHQVQESISIFTKPG
    CPFCAKAKQLLHDKGLSFEEIILGHDATIVSVRAVSGRATVPQVFIGGKHIGGSDDLEKYF
    A

    >gi|68249176|ref|YP_248288.1| hypothetical protein NTHI0709 [Haemophilus influenzae 86-028NP]
    MRYVIAVKSPIYGKQGAFLAYQFANALIKKGHEISQIFFFQDGVSNGNALVYPANDEVNLQKHWQMFSITHNVPLHLCVA
    ASQRRGVVDNLTTPTTAHYNLAEGFIIAGLGEFIAASLNADRVITL

    >gi|68249258|ref|YP_248370.1| thiosulfate sulfurtransferase GlpE [Haemophilus influenzae 86-028NP]
    MSFKEITPQQAWEMMQQGAILVDIRDNMRFAYSHPKGAFHLTNQSFLQFEELADFDSPIIVSCYHGVSSRNVATFLVEQG
    YKNVFSMIGGFDGWCRAELPIDTTY

    >gi|68249348|ref|YP_248460.1| thiol peroxidase [Haemophilus influenzae 86-028NP]
    MTVTLAGNPIEVGGHFPQVGEIVENFILVGNDLADVALNDFAGKRKVLNIFPSIDTGVCATSVRKFNQQAVKLSNTVVLC
    ISADLPFAQARFCGAEGIENAKTVSTFRNHALHSQLGVDIQTGPLAGLTSRAVIVLDEQNNVLHSQLVEEIKEEPNYEAA
    LAVLA

    >gi|68249440|ref|YP_248552.1| thiol:disulfide interchange protein DsbA [Haemophilus influenzae 86-028NP]
    MKKVLLALGLGVSTLMSVNSFAADLQEGKQYVQVSQQASQQKEVIEFFSFYCPHCYAFEMEYKIPQQVVDALPKDVKFKQ
    YHVNFLGHQSENLTRAWALAMALGAESKVKSPLFEAAQKDALKSMDDIRAIFLSNGITAEQFDGGINSFAVNGLVNKQVN
    AAEQFKVRGVPDFYVNGKFRVNPEGLNYDDFVKDYVQTVKGLLQK

    >gi|68249472|ref|YP_248584.1| thiol:disulfide interchange protein precursor [Haemophilus influenzae 86-028NP]
    MKKLFLFFTLIFTAFAANSGLFDKKQTFLKVDDAFAFSATLSTDKSQLQAHWDIADGYYLYQDKISAELVGKSNPLSLHT
    QQAAELHQDPYFGEVKVFTHSIDGIFRGTFNNADDKVEITYQGCTEGFCYPPETKVLRIGDLAVSQEQIVEKTVEKNTAL
    LSEQDRLADGLFHSKWTIFGFFLLGLGLAFTPCVLPMLPLLSAIVIGQQQRPNMMRAFSLAFLYVQGMALTYTLLGLAVA
    AIGLPFQIALQHPYVMIGLSILFVALALSMFGLFTIQLPNSLQNKLNTWSQKQTSGAFGGAFAMGMIAGLVASPCTSAPL
    SGALLYVAQSGDLFTGAATLYLLALGMGVPLMLITLFGNKILPKSGEWMNTVKQTFGFVMLALPVFLLSRILPEVWEPRL
    WAGLATVFFIWFALQMSKNGFGYAIKIISFALAMVTVQPLQNWIWQTQTTTQSAVENMPVSQVKFKQIKNTEELDRTLAE
    NPHSIAMLDLYADW
    CVACKEFEKLTFSDPQVQQQFQNILLLQVNMTKNSPENKALMERFNVMGLPTILFFDQQNNEIQGS
    RVTGFMDADAFSNWLKALH

    >gi|68249522|ref|YP_248634.1| thiol:disulfide interchange protein DsbE [Haemophilus influenzae 86-028NP]
    MNKKLLFFAPLFVLLGVCVLLIAGLNQDPKKIASALIDKPVPEFYQANLHDPSQIVSPKDFPKQPFLLNVWGSWCGYCKE
    EHPLLIEIAKTLPIVGVDYRDNPQNGIEILKRMGNPFILTIDDSQGELALKLGVDGAPETYLVDENGVIRYRHSGLLDKE
    TWQTVFLPKIEALKNK

    >gi|68249611|ref|YP_248723.1| mercuric transporter MerT [Haemophilus influenzae 86-028NP]
    MASTLCCIAPLIYLVFGVSSTWLIGLGEYDYLRIPMLIISLCAFAYGFWLLMFSKKIICSKYISRKKLIVLYWIVFIVMI
    FFLTYPTILPWILELAN

    >gi|68249612|ref|YP_248724.1| copper chaperone MerP-like protein [Haemophilus influenzae 86-028NP]
    MKKLCTALLLSLFAISFAHANETKQIVLKVKEMNCQLCAYLVNKELRNIDGVISTKASIKDGLVTVVEDPKVTNQQLFDA
    IHKLKYTAEVVN

    >gi|68249615|ref|YP_248727.1| hypothetical protein NTHI1214 [Haemophilus influenzae 86-028NP]
    MFADWKEHTSHVKKSFGALGKQHPKMLQAYQALGSAAEEGNVLDAKTRELIALAVAVTTRCESCISVHAEEAVKAGASEA
    EVAAALATAIALNAGAAYTYSLRALEAYSVQKG

    >gi|68249652|ref|YP_248764.1| thiol-disulfide interchange protein [Haemophilus influenzae 86-028NP]
    MKKKLLVPLILFLSITIAFLVQLKRNAQGEDIKALESALVGKPVPEKNLTELFENKAYTNELFQQGKPVLLNVWATWCPT
    CYAEHQYLNKLAKEGVRIIGLDYKDESPKAMKWLKDLGNPYQVVLKDEKGSFGLDLGVYGAPETFIVDGKGVIHYRYAGD
    VNEKVWTQTLKPIYDKLSEQQ

    >gi|68249666|ref|YP_248778.1| thioredoxin-like protein [Haemophilus influenzae 86-028NP]
    MKIKKLLKNGLSLFLTFIVITSILDFVRRPVVPKEINKITLQDLQGSTFSLDSLDQNKPTLLYFWGTWCGYCRYTSPAIN
    SLANEGYQVVSVALRSGNEADVNDYLSKHDYHFTTVNDPKGEFAERWQINVTPTIVLLSKGKMDLVTTGLTSYWGLKVRL
    FFAEFFG

    >gi|68249707|ref|YP_248819.1| thioredoxin reductase [Haemophilus influenzae 86-028NP]
    MSDIKHAKLLILGSGPAGYTAAIYAARANLKPVLVTGLQQGGQLTTTDEIENWPGDFEMTTGSGLMQRMLQHAEKFETEI
    VFDHINRVDLSSRPFKLFGDVQNFTCDALIIATGASARYIGLPSEENYKGRGVSA
    CATCDGFFYRNKPVGVIGGGNTAVE
    EALYLANIASTVHLIHRRDSFRAEKILIDRLYKKVEEGKIVLHTDRTLDEVLGDNMGVTGLRLANTKTGEKEELKLDGLF
    VAIGHSPNTKIFQGQLELNNGYIVVKSGLEGNATATSVEGVFAAGDVMDHNYRQAITSAGTGCMAALDAERYLDAQEA

    >gi|68249713|ref|YP_248825.1| glutaredoxin-related protein [Haemophilus influenzae 86-028NP]
    MIKCLPRLFIGNIMETLDKIKKQISENPILIYMKGSPKLPSCGFSARASEALMHCKVPFGYVDILQHPDIRAELPTYANW
    PTFPQLWVEGELIGGCDIILEMYQAGELQTLLAEVAAKHA

    >gi|68249759|ref|YP_248871.1| thiol-disulfide interchange protein [Haemophilus influenzae 86-028NP]
    MKKIFTALLCVAAANAMADDAAIKRKLQSFNVSNIAIKSSPISGIRTAVTDQGILYVSEDGKYLFEGKLYELTNNGPVDV
    AGKILVDKLNSYKDEMIVYPAKNEKHVVTVFMDIT
    CHYCHLLHQQLKEYNDLGITVRYLAFPRAGMNNQTAKQMEAIWTA
    KDPVFALNEAEKGNLPKEVKTPNIVKKHYELGIQFSVRGTPSIVTSTGELIGGYLKPADLLRALEETAQ

    >gi|68249761|ref|YP_248873.1| hypothetical protein NTHI1387 [Haemophilus influenzae 86-028NP]
    MSDRMKLKGILAFCLLFLSSFVLAEVNQKEFSVQNSPHLPSRDTIYFEDGRDYFSYKEPIEQVSRADKKIRIQFFFDYDC
    RVCSSAQDILELYSQIRTYKVVLEQYPIATADSQFSARIFYTLQALSASELSNVLLFETSEKSRYTELSTSNKIQQWAEE
    QGLDKQLFIQTENSQSVKEQIQNAIELTEEYGVFTYPYVVIGGKYVLTASTLYNDDYSVAVLDFLVNKIEQEQKQ

    >gi|68249951|ref|YP_249063.1| glutaredoxin 1 [Haemophilus influenzae 86-028NP]
    MFVVIFGRPGCPYCVRAKNLAEKLKGEVADFDYRYVDIHAEGITKEDLSKSVGKPVETVPQIFIDEKPIGGCTDFEALMK
    EQFGIVA

    >gi|68250015|ref|YP_249127.1| bifunctional methionine sulfoxide reductase A/B protein [Haemophilus influenzae 86-028NP]
    MKLSKTFLFITALCSATPTLAIQNSTSSSGEQKMAMENTQNIREIYLAGGCFWGMEAYMERIHGVKDAISGYANGNTGKT
    SYHMIGLTDHAETVKVTYDANQISLDKLLKYYFKVIDPTSVNKQGNDRGRQYRTGIYYQDGADKAVIEQALAQLQTKYKK
    PVQVEVQPIKNYIVAEEYHQDYLKKNPNGYCHIDITKADEPVIDEKDYPKPSDAELKAKLTPLQYSVTQNKHTERSFSNE
    YWDNFQPGIYVDVTTGEPVFSSNDKFESGCGWPSFTKPIIKDVVHYETDNSFNMQRTEVLSRAGNAHLGHVFDDGPKDKG
    GLRY
    CINSASIKFIPLAEMEKAGYGYLIQSIKK

    >gi|68250017|ref|YP_249129.1| hypothetical protein NTHI1679 [Haemophilus influenzae 86-028NP]
    MKKLLSIFLMAFSLNAFAQTNLADVQLKDLNNQPVTLSQYKGKPVYVKMWASWCPICLAGLAEIDDLSAEKDRNFEVITI
    VSPDHKGEKDTADFIEWYKGLEYKNITVLLDEKGEIIDKARVRGYPFNLFLDSDLNLKKTVPGHLGAEQIKVFAGK

    >gi|68250019|ref|YP_249131.1| molybdopterin biosynthesis protein MoeB [Haemophilus influenzae 86-028NP]
    MIELSHEEELRYNRQIILKSVDFDGQEKLKASKMLIVGLGGLGCAASQYLAAAGVGNLTLLDFDTVSLSNLQRQVLHCDT
    RLNMPKVESAKIALEQINPHINIETINAKLDEEKLAEIIPHFDIVLDCTDNVEIRNQLDRQCNHAKIPLISGAAIRMEGQ
    VSVFTYEPNTPTYRDLSKLFGQNVLS
    CVEAGVLAPIVGIVGCIQALEAIKVRLKIGKNLCGRLLMIDGFSMNIREIKLPT
    NME

    >gi|68250236|ref|YP_249348.1| dihydrolipoamide dehydrogenase [Haemophilus influenzae 86-028NP]
    MSKEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKHANKNGIYFSEPR
    IELDEVRAGKEAVVAKLTGGLAGMAKARKVTVVEGLATFTDSHTLVARDRDGNPTTVKFDNAIIAAGSRPVQLPFIPHED
    PRIWDSTDALKLKEVPKKLLIMGGGIIGLEMGTVYNALGSEVEVVEMFDQVIPAADKDVVGIYTKQVEKKFKLMLETKVT
    AVEAKDDGIYVSMEGKACNDTKRYDAVLVAIGRVPNGKLIDAGKAGVEVDDRGFIHVDKQMRTNVPHIYAIGDIVGQPML
    AHKGVHEGHVAAEVIAGQKHYFDPKVIPSIAYTEPEVAWVGKTEKECKQEGLNYEVAKFPWAASGRAIASECSEGMTKLI
    FDKDTHRILGGAIVGSNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNAKAKKK

    >gi|68250287|ref|YP_249399.1| Na(+)-translocating NADH-quinone reductase subunit E [Haemophilus influenzae 86-028NP]
    MTHYILLIIGTALINNFVLVKFLGLCPFMGVSKKIETAVGMGLATMFVLTVASLCAYLVDHYILIPLNATFLRTLVFILV
    IAVVVQFTEMAINKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNVNLAHNLTESVVYGFGASLGFSLVLVLFAALRERLVA
    ADIPATFRGSAIALITAGLMSLAFMGFTGLVK

    >gi|68250292|ref|YP_249404.1| SoxR-reducing system protein RsxE [Haemophilus influenzae 86-028NP]
    MTDLTEKNTALEEEKIESAVENQQKSIWKEIFAQGIWKNNPAVVQLLGLCPLLAVSSTATNALGLGLATMLVLTCTNTVI
    SLFRQYIPKEIRIPIYVMIIATTVTAVQLLMNAYTYTLYQSLGIFIPLIVTN
    CIIIGRAEAFASKNSLLHSIWDGFSMGL
    GMALSLTILGALREIIGQGTIFEGIENLFGEQAKFLTHHIYHTDSSFLLFILPPGAFIGLGLLLAIKNRIDNVKK

    >gi|68250321|ref|YP_249433.1| iron-sulfur cluster insertion protein ErpA [Haemophilus influenzae 86-028NP]
    MIDDMAVPLTFTDAAANKVKSLISEEENTNLKLRVYITGGGCSGFQYGFTFDEKVNDGDLTIEKSGVQLVIDPMSLQYLI
    GGTVDYTEGLEGSRFTVNNPNATSTCGCGSSFSI