Granulibacter bethesdensis CGDNIH1 uid58661

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|114326678|ref|YP_743835.1| thymidylate kinase [Granulibacter bethesdensis CGDNIH1]
    MTVYGMTMTVAPNRNHLSEALSPYLLQHADNPVHWLPWGTQALEHARKTDRPILLSIGYAACHWCHVMAHESFEDQATAD
    EMNNAFICIKVDREERPDIDHIYMSALHAMGQQGGWPLTMFLTPEGQPFWGGTYFPPEPRFGRPSFRQVLAAIRDAWATR
    RSAIEQNLGQLTRAMNRLSETAAGPEVDVLLLNAVDAALLRNLDPEKGGFTGAPKFPNAPVFRFFWQEFHRTGRPELSDA
    VHAVLSHMARGGIYDHLGGGFARYSTDAEWLVPHFEKMAYDNGQILELLSLGYAQNPTPLYARCIEETVGWLIRDMSVPV
    EGGGTAFAASEDADSEGEEGRFYIWHEDEIDALLGEAATGFKQAFDVTREGNWEGHTILRRLTISPEADAESWAQERRIL
    FQSRENRPRPGRDDKVLADWNGLVIVGLVRAAIALDRADWLSAAESAYEAVRAALGSEDGRIAHAWRLGRITAAGLLDDQ
    ASMIRAALSLYEATGQERYLSDAVTLAQSARSFFSSETGAFYTTAHDADDVPLTRPCTASDNAVPSGNGMMADALARLYH
    LTGEQRWYEAASGLIRAFTGRPQSLASSPYLLMAADLLTRGTLVSIHGQADDPHLQSMVREVLALGDPSVLVCRKPLHAA
    PDRQTDHVAQTFFVLVCRQTLCSAPLTTLDAVKAAISAS

    >gi|114326679|ref|YP_743836.1| O6-methylguanine-DNA methyltransferase [Granulibacter bethesdensis CGDNIH1]
    MLLSFTSIFYETGSPMPQLSLHSPLGVLTITEDEGAIVSLDWGEGMDSRDRTPLLKKAAEQVQAYFDGDLKNFDLPLMPE
    GTGYRRKVWQALQDIPYGKTMTYGALAAKVGGSARSIGQANHFNPIPIIIP
    CHRVIGSNGALGGYSGLDGVETKQYLLSL
    ENPDPDMVHPASPSFQPSLPRS

    >gi|114326731|ref|YP_743888.1| organic hydroperoxide resistance protein [Granulibacter bethesdensis CGDNIH1]
    MSVDVKYQTTATATGGRDGSARTADGRFEVALSTPRELGGAGGEGTNPEQLFASGYAACFLGALKVAGQQLKQKIPSDTS
    VTATIGIGPRSEGGFGITAQLSIHLPGVEAAEAHKLVETAHQI
    CPYSNATRGNVDVGLVVA

    >gi|114326792|ref|YP_743948.1| thiol:disulfide interchange protein tlpA [Granulibacter bethesdensis CGDNIH1]
    MPVSKHLKTRRTMLAAIGGTLAGGVMGRKLALSQASGATIGELPHGLKPVDPPARLPAFRFTDAMGDTRSMAYFSGKGVV
    LNLWATW
    CAPCVAEMPSLDQLAAAVKDEGIVVLPLSADQGGVQAVDSFYRKHGIVHLGTWLDHDGEAQTALKLRGIPTTL
    IIDRQGRERARLEGGTNWAAPAYHDAIRALVG

    >gi|114326812|ref|YP_743970.1| thiol:disulfide interchange protein DsbD [Granulibacter bethesdensis CGDNIH1]
    MVRPISRRAGKQSPGRIMKTCYPGLIMRFLLSVLGVCLSLLYGSSPAYALESAPVSSPHATVTLMSDADSYTSGHPFRLG
    LQFRMAPGWHIYGKDPGDSGLPPELTFTLPSGVTAGPVDWPPTMQLKEGPLRVNAYQGTVVLPVTIDPHGARGPIEIDLQ
    ANWLICQTICVPEEGHFHLTLLEGQGGEGSSASPLSGQVSQPQPSDTSSLPMVLLFAVLGGLILNLMPCVFPVLAMKALA
    LARLGSGERAAVRSHAVAYTAGVLLAFLALGMMAIGLRHAGAAVGWGFQFASPVFVTGMAWLLMAVGLNLSGVYQIGARM
    VGTGHTLSSRDGLSGSFFTGLLAVVVATPCTAPFMGLALAVALNAPAVTMLTILLAMGLGLALPYLLVAIFPQLVAAMPK
    PGRWMEVLKQALAFPVYASVCWLVWVIAQEAGANGVLIVGEGLTAIAFAAWVWGVAQFGSGVRSLVGRGLAILAIGISLL
    LLQRLHQASGLAVADVAGTTMAERQGAEPFSRARLDALRAEGRPVFVNLTAAW
    CVTCLVNEQVALSNHTVKEAFRNGGVA
    YLLGDWTRQDRKLTAFLRDHGRDGVPLYLFYPAGGGDPVTLPQLLTPEIVINAVRAR

    >gi|114326852|ref|YP_744009.1| arsenate reductase [Granulibacter bethesdensis CGDNIH1]
    MTVTIYHNPGCGTSRAVLAMIEEAGHKPVVIEYMKTPLTRPQLSGLLHRMNGTAHDLLRRKGPVYEQSGLDRPDLTEEDI
    LTAILAEPALLNRPIVDTPLGVKLCRPAETVMTILPPAPAAESKN

    >gi|114326915|ref|YP_744072.1| thioredoxin [Granulibacter bethesdensis CGDNIH1]
    MSLIIGAGGNSAGGAGASRRGPSAQGSGLVGAAGQDVSSQNPATLSAQEMIIDGSQDTFMEDVIEASRTTPVLVDFWATW
    CGPCKQLTPVLEKAVRAAQGRIKLVKIDIDQNRSLVQQLAQLGLPVQSVPTVAAFWQGQIADLFQGAVPESEIKRFVEPL
    LKMTGGELPGADLLAEAKRATEAGEHEMAAQLYSALIQQDAEKPEGWAGLARSLLALDQPEEAAAVLDQAPPAIAAHADI
    EGARSAVAVAEEGRQARARLAELQAAHEANPDDRQAAYDLSAALSAAGEREQAAGLLLDIIRHDRAWNEDAARLQLLRFF
    DAWGQGDPATLAARRKLSALLFS

    >gi|114326932|ref|YP_744089.1| thiol:disulfide interchange protein tlpA [Granulibacter bethesdensis CGDNIH1]
    MIPSPPPSRPVWTRRLLLSVPLVLAVAAGAAFLGMLHGMEDGHFDPRGVPSPLIGKPVPVFDLPAQTPSPEGFTSAALTQ
    HGHPVLVNFFASW
    CVPCKIEQPALMALKQRGIALWGIAYKDKPEAAAAMLKADGNPYQRIARDAAGGTAIDWGVYGVPET
    YFVDPKGIVRWKWAGPLTEQVIKDQIEPLLKAYP

    >gi|114327041|ref|YP_744198.1| outer membrane protein [Granulibacter bethesdensis CGDNIH1]
    MSSLPLFYSHASRQSLRRYGLLALPILAGLLLPGAARSETFTPAQRAEIVSILRQALVKDPTILKDAITALQQDENSRAL
    SAREGAIAANASRLTSDPADPVAGNPKGSTSIVEFYDVR
    CPYCRRMVPVMDELIRKHPELRVVYKDMPILGAKSELGSRA
    LLAAQKQGGYVQLRAALMHGSPDLTQEDIDRQARTLGLDVDRLHKDMQDPAIEKRLADNIALGRSLGLEGTPAYVIGSKL
    FPGAVDLPTLENAIAPAAR

    >gi|114327261|ref|YP_744418.1| glutaredoxin [Granulibacter bethesdensis CGDNIH1]
    MIEIYTQPYCPYCSRALALLERKQVPFKEIQALPGSPARAEARQRSGGRTSVPQIFIGGRHIGGCDDMMALEAAGELDPL
    LQAA

    >gi|114327301|ref|YP_744458.1| DNA-binding protein [Granulibacter bethesdensis CGDNIH1]
    MAGKMLDWAAYRGQLGGELGKLAKVNPDVLKGHDILAAAAPSPNVLDAKTRELIALAVAVTTRCDGCLAFHTEAARKAGA
    TKEEVAEALGVAIALNTGAALVYSARAMDAFGDQSAD

    >gi|114327343|ref|YP_744500.1| peroxiredoxin reductase AhpD (NAD(P)H) [Granulibacter bethesdensis CGDNIH1]
    MTGTNTMSIENLKNALPEYAKDLKLNLGSLANEDVLNQQQKAGTFIASALASRSNLVTSAILAEFGPQLSAEALAAAKAA
    AAIMGMNNVYYRFVHLVGGDYANLPARLRMNVMAKPGVDKVDFELWSLAVSAINGCGM
    CMESHEKIVRQNGLTQEQVQAA
    IRIAATVHAVAATLDGEAALS

    >gi|114327344|ref|YP_744501.1| peroxiredoxin [Granulibacter bethesdensis CGDNIH1]
    MLSVGDKFPSFKLTAVKPGKEGLDLKDPFFEVTENSAEGKWKVVFFWPKDFTFVCPTEIVAFAKLNSDFADRDAVLYGVS
    TDNEFVHVNWRLHHDDLRELQIPMVSDIRRELSEALGILDQAEGVAQRATFIVDPQNIIRFAYVTDLSVGRNPAEVLRVL
    DALQSDELCPCNWSKGDEFIKVG

    >gi|114327369|ref|YP_744526.1| glutathione S-transferase family protein [Granulibacter bethesdensis CGDNIH1]
    MRTLYHLPLCPFSRKVRVVLAERKLPFELKVEKVWERRPEYLEMNPAATVPVLVEQNGLPIPDSSVICEYLEEAYPDISL
    LGRSLAERVETRRLAAWFDGRFYQEVTKNLVGEKYLKRLLGRGNPDATAIRTGFTSLRYHMEYLGYLADTRKWLAGAAIG
    LADFAAAAHVSCLDFGGDIDWEKFPAARDWYARIKSRPSFRGILADRVPGIIPPAHYADLDF

    >gi|114327384|ref|YP_744541.1| thioredoxin reductase [Granulibacter bethesdensis CGDNIH1]
    MIHRSKVLIIGAGPAGYTAAIYAARASMKPILVCGLQPGGQLTITTDVENYPGFAESVQGPWLMEQMEAQARHVGTEIVY
    DLITDVDFTRTPFRCTADSGDVFEADSVIIATGAQARWLGLPNEKRLQGAGVSA
    CATCDGFFFRGKRVAVIGGGNTAVEE
    ALYLTHHASEVVLIHRRDSLRAEKILQDRLFAHPKISVVWNSVVEDITASGPPDRVDGIVLRNTIKGDTSTLPVDGVFVA
    IGHSPNTAIFRGKLELDEEGYVVTRPGTPCTSIPGVFAAGDVQDKIYRQAVTAAGTGCMAALEAEKWVAEHTDSSMLAAE


    >gi|114327505|ref|YP_744662.1| thioredoxin peroxidase [Granulibacter bethesdensis CGDNIH1]
    MSSEGSMKFPAWLAPGFLAGWVALTGLTVCLPDKAQAELAEGQQAPGFSLEAALAGKTFRFSLAEALRSGPVVVYFYPAA
    FTSG
    CTREAHDFAEAMPRFKAQHATVIGVSGDALTTLEKFSESACGGKFPVAADPDRAVLRQYQVLPDALSMHATRTSYV
    IVPGAAGQPGRIIYVYTDGNPEKHVSNTLHALQQWRSHPSGHEEQVRSH

    >gi|114327529|ref|YP_744686.1| peroxiredoxin [Granulibacter bethesdensis CGDNIH1]
    MKDSSGRMTPPVSPSTPIEEKPTHSACPPRLGDIVPGFCARTTHGQVSLADYRGRWLIFFSHPADFTPVCTSEFMAIARA
    ADRFADRQCDLLGLSVDSLHAHLAWIRAIKAQFGITIPFPIVEDPSMVIGRAYGMIDPSAPDSSAVRGTFFIDPHGVLRA
    AIYYPMQVGRSVEEMLRLLIALQETSRTGTLTPEGWQPGEDTLLPAPVTQAEMAEITDRWLCRFQSSVP

    >gi|114327572|ref|YP_744729.1| peroxidase [Granulibacter bethesdensis CGDNIH1]
    MSIQLGQTAPDFEQDSNQGKIRFHEWLGQSWGILFSHPKDFTPVCTTELGEAARLAPEWEKRNVKVIGLSVDTGENHKGW
    EADISETQGQTVKFPILADADRKVSALYGMIHPEADPNVTVRAVFIIDPNKKVRLTLTYPPSTGRNFKEILRVVDSLQTS
    DKFKVATPVNWEKGGEAIIPPSTSDDAAKEQFPQGWKTLKPYLRVVKLPEEA

    >gi|114327635|ref|YP_744792.1| 3-mercaptopyruvate sulfurtransferase [Granulibacter bethesdensis CGDNIH1]
    MARKGRVMATLPVLVDAEWLRESMGAADLIIFDATKFLPNQGRNGHDDYRRSHIPTAIYFDIDAIADQQTNLPHMVPPPG
    QFAAQLGALGVSNNSRVVFYDQNSMMWAARGWWLFRLFGLEAAVLDGGLDAWVRAGGPTESGEIAPLPAASALLTDWRPK
    YVRGIGDIKDNLISGAELVLDARSAERFAGAAAEPRPGVESGRIPGSLNLPFNQVLAANGTLLPPETLRQRFAAAGIDGS
    KPVITS
    CGSGVSASLLSFAMAVAGLEAAAIYDGSWSEWGSRPDTQKQRDAI

    >gi|114327643|ref|YP_744800.1| frnE protein [Granulibacter bethesdensis CGDNIH1]
    MNMLAPPRALLAIAVVFDLICPWSYLGVRRLRECLARRADISPVIEWRPFLLNPDMKHSSAGRADHIIRRPGTEDRTQRL
    HRSITALGRREGISFRFDLINTLPSSFDAHRLVRWVAEQATAYHLSHSSAGLSNFNTSFSARPADAAGGMVERLFAACFT
    EGRDIGDLDELAHIAAEAGFSRTDALSYLRGPEGRSEIQLATAQAHRLGITGVPCFVFDHHHAIAGAQEPHVIDRLLDVT
    IAALETASAC

    >gi|114327697|ref|YP_744854.1| glutathione peroxidase [Granulibacter bethesdensis CGDNIH1]
    MTSLYDFQATMLDGQVVPLSRWRGQVALVVNTASRCGFTPQYQGLEALYQRFAASGFVVLGFPCNQFGAQEPGSSEEIRT
    FCDTRYSVSFPMFARVEVNGTNAHPLFDYLTRQRRGLLGTRRIKWNFTKFLIGRDGVPVARYAPSCKPEKLEKAVYRLL

    >gi|114327851|ref|YP_745008.1| dihydrolipoamide dehydrogenase [Granulibacter bethesdensis CGDNIH1]
    MADTVFDLIVVGGGPGGYVAAIRAAQLGMKTALVERAHLGGICLNWGCIPTKALLRAAEINHLLHHLSDFGFAADNIRYD
    LDAVVKRSRTVAGQLSSGVKHLLKKNKVTVFDGHARLSGRHRLDVSKDGQPVATLEAPHIVLATGARARQLPGLEADGTL
    IWSYREAMVPKALPKRLLVVGSGAIGIEFASFYRSLGSEVTVLEAVERILPAEDEEIAAFARKSFEAQGMTIHTGVKIGK
    VEKGRDEVTISFEAAGKKHSLTVDRIIAAVGIVGNVENLGLEGTAVTIEKTHIVTDGLGRTGEDGVYAIGDLTGPPWLAH
    KASHEAVLCVEAIAGLDVHPLDITNIPGCTYCRPQIASVGLTEAKARERGYEVRVGRFPFIGNGKAIAMGEAEGLTKTIF
    DAKTGELLGAHMVGPEVTEMIQGFTIARTLETTEAELMHTVFPHPTVSETMHEAVLDAYGRALHF

    >gi|114327926|ref|YP_745083.1| hesB protein family protein [Granulibacter bethesdensis CGDNIH1]
    MQHRWKASCSPGFFAYFHGMDALETSPDISSSGSAVGFGVSASAAARIAEIAQGQALRVSVLAGGCSGFQYQFALDGQRA
    DDDVVIERDGAVVLVDPASLEFLAGAELDYKDALMGSHFTIRNPNATASCGCGTSFSVE

    >gi|114327983|ref|YP_745140.1| hesB protein family protein [Granulibacter bethesdensis CGDNIH1]
    MGYDAMTVDTNQTTGTAPRRALPPLMSLTDAAAERLQQLYTTGQQGRLLRIAVSTKGCSGKSYDMSWVEEKGEGDEVVID
    KGVTVLIDRKATLFLIGTVMDYQVKQLEAGFTFINPNEKGRCGCGESFHV

    >gi|114328091|ref|YP_745248.1| glutathione reductase [Granulibacter bethesdensis CGDNIH1]
    MGRDAGKQKEQRMAYDYDLFVIGGGSGGVRCARIAAGHGARVGVAEDRFWGGTCVNVGCVPKKIMVQAAEYGGFVEDSHG
    FGWNTQRGEHDWAALITAKDREIERLNGAYRRILSSAGADIIDARATLLAPHRLRLTSGDGTAREITAERIVIATGGHPS
    RPDIPGAELGIVSDDAFHLPSLPRRIAILGGGYIAVEFAGLFRGLGADVDLIYRQSLPLRGFDGDMRTALADAYAADGIR
    LHPDSTITAIEKHDGQRVVMLDHGGETLTVDLVFFATGRVPATQGLGLKEAGIETGKDGAIPVDDRWETNVAGHYAIGDV
    TNRMNLTPVALAEGHMLANRLFSSGHAGQVWNFHQVPTAVFSTPPIATVGMTEEEAEKNGPTEVFTTGFTPMRHQISGRK
    RRSFMKLLVDQASQKIIGAHMFGEDAPEIMQGLAVAITTGATKQDFDRTIGIHPTAAEEFVTMRSRTRTVG

    >gi|114328336|ref|YP_745493.1| glutaredoxin [Granulibacter bethesdensis CGDNIH1]
    MSDTASRIQADINENPVMLYMKGTAMFPQCGFSARVTQILNHLEVPYKTANVLEDQALREGIKAFSNWPTIPQLYIKGEF
    IGGCDIVMEMFQSGELQALLSEKGIPHKAAA

    >gi|114328527|ref|YP_745684.1| thiol:disulfide interchange protein dsbA [Granulibacter bethesdensis CGDNIH1]
    MAAKPRYWVKKILTRNTMSITRRSFCTAALFSLPLIQAARAEAPATSGGDLSSFLSERSIGKADAKVTVMEFFSLTCTHC
    AAFSQNTLPELIKKQIDTGHLRIVFRDFPLDQVALSAAMVARALPQERYEPFISALFASQDRWAFNRDGNVTESLAQMAL
    LAGLSRAKFDAVINNEALKRAMLERQQQESIKYNINSTPTFALTNGKTQSGALSYSDFVSFAGLS

    >gi|114328542|ref|YP_745699.1| peroxiredoxin [Granulibacter bethesdensis CGDNIH1]
    MTIKTGDVFPAIKIMASTPDGPKEVETGTLFADKKVVLFAVPGAFTPTCSAKHLPGYLNALEAFQQKGVDIIACLSVNDP
    FVMGAWAKEQGVEERILMLADGSAVLTRALGLELDLTARGLGVRSQRFAMVVEKGVVTHLAIEPPGGFDVSRAEQILAVL


    >gi|114328583|ref|YP_745740.1| hypothetical protein GbCGDNIH1_1919 [Granulibacter bethesdensis CGDNIH1]
    MAEESMRTMRLAAGLIASLLVGAASPAPEPDGYRMQDFRAPTPATLKGAIVLDAEALHTVIERGRVVLIDAMVAPRKPKG
    SAPETPWMPPPRLDIPGSLWLADIGLGTLPPGVDTWFRHQLANATMGDKGKLLVFYCLPN
    CWMSWNAAKRALSYGYPHVA
    WFPGGTEAWKAAGYRLVPNQPVFPPEQP

    >gi|114328670|ref|YP_745826.1| ferredoxin--NAD(P)(+) reductase [Granulibacter bethesdensis CGDNIH1]
    MDEEEVVRDMRLTMPHPEQCNRPGSTSHVTGAALFGNVGIGSRNRQLSHFRGRLMVPPMTQIDLAPPASSTQPRIIDTDV
    AIIGAGPAGLFAAFELGMLRLRAVLIDALQEVGGQ
    CAALYPEKPIYDIPAHPAISGGDLITALERQIAPFDMPRLLSRRV
    ETLTGTQGDFTLTTSAGDTVCARAVVLAAGAGAFGPNRPPLDGLEAFEASGAVQYYVRRREDFRGRSVVIAGGGDSAVDW
    ALALRGIAARIFVVHRRAKFRAAPESLAQLEQAAAAGEVELVVPYQLHGLQGAEGVLSVVEVATLDGEIRRLEADCLLPF
    FGLSMDLGPIAEWGLALERHHITIDPSRCETNVPGIFAIGDVATYPGKLKLILQGFSEAAMAAHAIHPIVHPDQALHFEY
    STSTGVPG

    >gi|114328675|ref|YP_745832.1| thioredoxin [Granulibacter bethesdensis CGDNIH1]
    MIEKRLPMSEHTKPVTDATFETDVLGASGPVLVDFWAEWCGPCRMIAPALEEVAAENTGRLTVAKVNIDENPDSPNRYGV
    TGIPTLILFKDGQPIAKQVGALPKSALKQWVSGNI

    >gi|114328730|ref|YP_745887.1| dihydrolipoamide dehydrogenase [Granulibacter bethesdensis CGDNIH1]
    MSDAFDLIVIGAGPGGYVCAVRAAQLGLKVACVEKRETLGGTCLNIGCIPSKALLQSSENYHALLHQFAEHGIQAKDVAL
    DLDRMQARKAEVVSANVKGIEFLFRKNGVTWLKGAASISAPGKVEVGGQSYDARHIVIATGSESVPLPGVPVDEVRIVTS
    TGALSLPAVPKHLVVIGGGVIGLELGSVWRRLGAEVTVIEYLDRIVPGMDQEVAKAFQRILEKQGLAFRLGTKVTGAQVD
    EGGVTLTLEPAKGGETDTLQADIVLVAIGRRPYLDGLGLDDIGVVRDERGRVRTDAHFATNIDGLYAIGDAIAGPMLAHK
    AEDEGVALAEMLAGQAGHVNYDVIPAVVYTWPEVASLGRTEEELKAAGIAYKVGKFPFTANGRARAMGDTDGFVKILADA
    RTDRLLGAHILGPDAGTLIAELATAMEFGASSEDVARICHAHPSLSEAVKEAALAVDGRAIHI

    >gi|114328752|ref|YP_745909.1| copper-exporting ATPase [Granulibacter bethesdensis CGDNIH1]
    MTPTTILAIKGMTCEGCVNAVRRILLAVPGVSDASVTLGRAEISGGETARLMEAVRDAGFGAEILATE

    >gi|114328753|ref|YP_745910.1| copper-exporting ATPase [Granulibacter bethesdensis CGDNIH1]
    MPVETMPSGSARQELDITGMTCASCSGRVERALRNVEGVSRAVVSLISHRALVEGSARIETLVAAVTRSGFTATPLTGER
    EQEERIEQQARRATRQEALRVLLSALLTAPLLLPMLGVPLPGLLMLVLAGIVQIGFGYRFYIAAWRGLRAGAGNMDQLVA
    IGTSAAFLYSAIAVLCGDSEHGYFDASAVVISLILFGRWLESRARQATGSATRALSALRPDTARLQNGDEERLVPASHLM
    PEDIVIIRPGERFAADGKVVSGQSDADESLLTGESHPVPKHPGDSVIGGAMNGSGLLRVRVTATVNDGTLARVISLVREA
    EASRAPVQRLVDQVAAIFVPGVVTIAVLTFLGWWIIGHDIANGFRAAVSVLVIACPCALGLATPAALITGTGIAARRGIL
    IRDAASLERAGSIDTVALDKTGTITEGKPVLHEIILLPSAPIGMDKATILRLAAAAESGSTHPLAHAVRESALTKGTTLP
    MPDFLQERPGEGVIAHVSGHEIAIGNAALFTHLDIPDSPQAMALEQETPAAILRVAIDRIPAALLLVEDTLRPGAAVAIR
    RIHATGCTVMLLTGDTEASGLKAAKTAGIELVETRLRPEDKAARIAAWQAKGHVVAMVGDGVNDAPSLAQADLGIAIGTG
    ADAARHAAGVILMRPEPGLIADAISLSRATRRKIRQNLFWAFIYNAIGLPFAALGLLNPVIAGAAMAFSSVSVVVNALLL
    KRWNPSSP

    >gi|114328781|ref|YP_745937.1| molybdopterin biosynthesis MoeB protein [Granulibacter bethesdensis CGDNIH1]
    MLSLCPIAVPMISIMTIDLTEPEIHRYSRHILLPEMGATGQGRLKAARVLVVGAGGLGSPLLLYLAAAGVGTIGVIDDDR
    VELSNLQRQIAHSTDRIGMLKVDSARQAAEAINPEIRIETHVGRLDESNAASLISAYDLVCDGSDNFQTRFIVADAALHV
    RRTLVSAAVLRFEGQLSTFRPHLDPEGPCYRCLTPEIPPRGAVPS
    CAEAGILGAVTGVLGSLQATEVIKELCGMGESLSG
    RLLIWEALAGRFRTIRLPRDPHCPSCGGLHGRG

    >gi|114328823|ref|YP_745980.1| peptide methionine sulfoxide reductase msrB [Granulibacter bethesdensis CGDNIH1]
    MADHNTGCGCGNHAPSCGDDRWQDTLTPEQYRILRQHGTERPGTSPLNDEKRPGLYACAGCGQVLFDAAAKYDSGSGWPS
    FFQPREGAVATTTDTSHGMVRTEVHCSQCNGHLGHVFPDGPRPTGLRY
    CMNGLALRFEPAPD

    >gi|114328967|ref|YP_746124.1| hypothetical protein GbCGDNIH1_2303 [Granulibacter bethesdensis CGDNIH1]
    MMSRFPLRTLENAPTEAQPALAAAEKNNGFLPNLLRVLANAPVALETYLTVSGINARASLTLQEREVVQITAAATHGCGF
    CVAGHTALATKKAGLDAATVEALRQLDRVTDARLATLADFTRAVIASRGAVSDEALATFKAAGFTDQQALEVVLGVSLAT
    LCNFANNLGQPPLNEQLEPFRWNGLNADSAG

    >gi|114329083|ref|YP_746240.1| peptide methionine sulfoxide reductase msrA [Granulibacter bethesdensis CGDNIH1]
    MWMETAVIGGGCFWCVEAVLRELNGVASIRPGYAGGHTANPTYKEVCTGTTFHAEVVEVTFDPAILSYVDLLRIFLTIHD
    PTTPNRQGADVGTQYRSVIMPASTEQENAARGVLAEVEAAQIWQAPLSTTIEPLQIFYPAEPEHVDYFARHPEAAYCQAV
    IAPKVRAFRKHAADHVRANISPNHA