Gramella forsetii KT0803 uid58881

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|120434495|ref|YP_860192.1| thioredoxin reductase [Gramella forsetii KT0803]
    MIKTDILIIGAGPTGLFAVFEAGLLKLKCHLIDALPQPGGQCSEIYPKKPIYDIPGFPEVLAGDLVDNLMEQIKPFEPGF
    TLGERAETIDKQEDGSFIVTTSQGAKHHAPVVVIAGGLGSFEPRKPPIPSIKEYENKGVAYIIRDPEVYRDKKVVIAGGG
    DSALDWSIFLADVASEVSLVHRRKDFRGALDSVEKVEELSKIGKINLITDAEVVDLKGENELDSVLIRHRDQARGEELKD
    TDHFIPLFGLSPKLGPIANWGLEIEKNAIKVDNAYDYQTNIPGIYAIGDVNTYKGKLKLILCGFHEAAIMCQSAYQRINP
    DKKYVMKYTTVSGVSGFDGSKKEAKKEVVKSIN

    >gi|120434562|ref|YP_860256.1| electron transport protein [Gramella forsetii KT0803]
    MKNYSYVGISLVMLVFGIIFIPKIIDRIKDDEVVSSDRLNQQRTTSKKDTGDALSYIVIDGEKKKAPQFEFINQEGETIS
    NEDYKGKVYLVEFFFTT
    CPTICPIMNKNLVEIQNEFENNNDFGIASFSIDPGHDTPEVLAEYAANYGIDHPNWNLMTGNR
    DGIYKLANKGFGLYAGEDAQAAGGFAHQGMFALVDQQGYIRSRKDQFGNPVIYYRGSVERNKSVVEGEEEPQIDILIEDI
    KKLL

    >gi|120434573|ref|YP_860266.1| hypothetical protein GFO_0204 [Gramella forsetii KT0803]
    MDNNQEKHTNDLIHESSPYLLQHAHNPVDWKPWNDENLDQAQKENKLLLISVGYSACHWCHVMEHESFEDEAVAELMNVN
    YICIKVDREERPDVDQVYMNAVQIMTGMGGWPMNIVALPDGRPVWGGTYFRKEQWMEALQQISHLFNSQPEKLLEYAEKL
    EQGLKQIQIIEPVKEQNKPHKDFFIPIIEKWKRSFDPKNGGYQRSPKFMMPNNYEFLLRYAFQNSDKELKSHCLLTLNRI
    SWGGVFDPIEGGFSRYSVDEKWHVPHFEKMLYDNAQLVQLYSKTYKITKNNWYKEVVKQTLQFISAEMTDESGAFYSALD
    ADSANENGKKEEGAYYVWTKENLKSILGNEFEIFSEYYNINNYGKWEADNYVLIRTKSLDQLSQDLDIPREDLQQRIAQC
    NLKLKKAKSKREKPGLDDKSLTSWNALMISGYTEAYKAFRNGEYLEAAEKNAAFILENQLQENGRLYHSYKNGKSTINGY
    LEDYAFSISAFLDLYECTFEQEYLGRARNLIDVTDKDFTDSVSGLYFFTSDKDRELVTKTIEISDNVIPASNSEMAKNIF
    RFGKLTGDMKYVGKAEKMLQIVMDKIPEYPQSYSNWLDLMLNFTNPFYEIAITGENYKNLAETFQEDYLPNTVLAATDSK
    SNMSLLKDRLVNGKNLIYICTEGSCQLPAASKDEALQHISQV

    >gi|120434697|ref|YP_860384.1| thioredoxin reductase [Gramella forsetii KT0803]
    MIKTDILIIGAGPTGLFTVFEAGLLKLKTHLIDALPQPGGQCSEIYPKKPIYDIPAFPEILAGDLVSNLMEQIRPFKPGF
    TLGERAETLEKLDDGSFIVTTNKGTQHHAPVVAIAGGLGSFEPRKPPIPNIADFEDKGVSYFIKDPEVYRDKKVVIAGGG
    DSALDWAIYLADVASEVALVHRRAEFRGALDSVERVSELAKLGRIEMITNAEVVGLRGEDNLEQVVIRHKDKARGEEFRD
    VDDFIPLFGLSPKLGPIGSWGLEIERNAIKVDNSYDYQTNIPGVYAIGDVNTYKGKLKLILSGFHEAAIMCQSAYQRIYP
    DKKYVLKYTTVGGVEGFDGTKKEAKKEVVQSIGV

    >gi|120434769|ref|YP_860455.1| Na(+)-translocating NADH-quinone reductase subunit D [Gramella forsetii KT0803]
    MAKEKKYNSAKEEEKKQEMILFLSDSEEKEHFLSKGNRKLLSDPLDDNNPITVQVLGICSALAITVQLEPAVVMAIAVMA
    VMAFSNMIISMLRNLIPSRIRIIVQLVVVASLVILVDQILKAYAYDVSKQLSVFIGLIITN
    CIVMGRLEAFALGNGVYKS
    FLDGIGNAAGYGLILIVVAFFRELLGSGKLFGFEVLGHQGATLAESTGLYSLGYENNGLMLLSPMALIVVGLIIWVQRAR
    NRKLIEAN

    >gi|120434770|ref|YP_860456.1| Na(+)-translocating NADH-quinone reductase subunit E [Gramella forsetii KT0803]
    MELVNLFVRSIFIENMIFAYFLGMCSYLAVSKTVKTAVGLGAAVIFVLLVTVPINFLLDNYLLKPGALVWLGESYKDVDL
    SFLSFIMFIAVIASMVQLVEMIVEKFAPALYGALGIFLPLIAVN
    CAILGGSLFMQQKDFSGMSEAVTYGLGSGIGWFLAI
    LAIAAIREKIAYSNVPAPLKGLGITFIITGLMALGFMSFMGIKL

    >gi|120434779|ref|YP_860465.1| thioredoxin-like protein [Gramella forsetii KT0803]
    MNKLLILLAVITISCGNTVNKSTKESNTEDQTSKTDIQKDMLLGEFYKEDLMKKPFSTWFESKYEEFTPDAESMETISEN
    IGDYQIKLLMGTW
    CGDSKREVPKMLKILDKAGYNYKNLEMVAVDYDKTTPSKIEEELDVHHVPTIIFYKNGKEVNRFVEY
    AQEESIEEDIAKIVSKQEYKNSYAD

    >gi|120434815|ref|YP_860501.1| molybdenum cofactor biosynthesis protein [Gramella forsetii KT0803]
    MRYDRQITLDEVGDSGQEKLSNSSVLIIGVGGLGCPAAQYLVGAGIGKIALMDHDKVSISNLHRQVLYNENDIGRSKAMV
    SQEKLQQLNSEIEIVAIDEALSIENAEKLFSQYDLILDGTDNFETKYLINDACILANKPWVYASIYKNEGQLSVFNYQNG
    PSYRCLFPKTTRNNVS
    CEATGVLGVVPGIFGMLQAMEVLKILLGVGNLLSGKLKISNLLIGSEQIMNIQKREKEIEKIRE
    SGIIPVIIECKINDNTRLYLDIREIFEQPKITSEKVIQIPMSDLDERLWEIPKEEEIFVF
    CQSGKRSKKIVDLLKAEYGF
    ENLNNVEGGIETIIYG

    >gi|120434882|ref|YP_860568.1| OsmC-like protein [Gramella forsetii KT0803]
    MNSCFRHHQMLGILKQTKLLKLFYAMKNLYKTKVTTHGGRNGHTRSEDGILDMELKKPEGLGGPGGDYSNPEQLFAAGYS
    ACYGSALEVVAEKHKVDLGDYSVTATVKLGKTDSGNLQLSATLDSYIPGVDVETGEKLVNEAHEI
    CPYSRATRDNIDVTL
    NLLLDE

    >gi|120434953|ref|YP_860639.1| carboxymuconolactone decarboxylase family protein [Gramella forsetii KT0803]
    MINEVDEFNSYRAKMNDKILSENNKVLKRIFNLDTNAFAEGALDKKTKELLGLVASTVLRCDDCVKYHLEASHKEGISRE
    EVMETLSIGTLIGGTIVIPHLRRAFEYWEALEDAK

    >gi|120435175|ref|YP_860861.1| hypothetical protein GFO_0819 [Gramella forsetii KT0803]
    MSTLKIHNMETAPEDSKPLLEQSKKAYGMIPNLHGVLAESPGIYEAYLTLHNLFENSSFNKEELTVVWQTINVEHECHYC
    VPAHTGIANMMKVDLAITEALRNRTEMPTEKLQKLHEMTLSIVRNRGQVAEKELENFFAAGYTRRQLLEIILGLSQKVIS
    NYTNHIAETPVDEPFKKFEWNKEDVAS

    >gi|120435178|ref|YP_860864.1| DSBA thioredoxin oxdioreductase family protein- polyketide synthase [Gramella forsetii KT0803]
    MKKKLKIDIVSDVVCPWCTIGYKRLARAITELGVEDQVEIEWQPFELNPNMPAEGQNVTEHITEKYGSTIDQQKESQQHM
    TQIGEELGFTFDYFDEMKMVNTFDAHILLDYAKEFGKQTELKMHLTKAFFSERKNVSDKDVLRQALLDVGLDAEEGLARL
    ESEEARYEVRSQQAYWKNLGVSSVPTVVFNRKSAVTGAQPVDTFKQVLSELIAE

    >gi|120435283|ref|YP_860969.1| thiol-disulfide oxidoreductase [Gramella forsetii KT0803]
    MKYFITLGLIINLIACKKPVEDKFNVDVKVKGDYSGYLYLITNKKLDSSLVINGKSQFSGRVDSPLKAGIITDTISGYNK
    EFYLENNDLELEINVTKNNFGNGPVDWIIVENVTGSKTEKIRENFEEFKSLNAEKENWNKKLYNELYKLITENQNNRLPG
    DLLAEVSSTYTLKKIQLQNLYFKLDKKVQDPFTIKKLEENIYPDKIFTVGDQLFDIKGENYLSKEVSTQDFRGDILLIDF
    WASW
    CKPCIDQFPELKTLEKRFKEDNLTIIGISLEEERNKWTKAIDKYNLTWTNIFINQNMTGEISKIYGINAIPFNIVI
    NREGQIIAKNVSENDISQIIDELKEAS

    >gi|120435327|ref|YP_861013.1| metallo-beta-lactamase/rhodanese-like domain-containing protein [Gramella forsetii KT0803]
    MTIKQFKDSPLAHYSYAIVSNGEMALVDPSRNPMDYYRYAEEQNAKIVAVFETHPHADFVSSHLQIHEETGATIYVSEKV
    GADYPHKSFDEGDSFKLGDVEFKAINTPGHSPDSITVVAKKDDETALFTGDTLFIGNVGRPDLREKAGNMKAKRIDLAKQ
    MYHTIQNKFTDLPDEALVYPAHGAGSLCGKNMSDASSSTLGNERQGNWAFKEQTEDEFVEEILKDQPFIPHYFGFNVDIN
    KTGPENVQRTKWANKLQLNVDEVEEGVTIVDTRDEEKFKKGHLPNSINIMARSEKDKYETWLGAIVQPKEEFYLVLDSID
    NIEELLERTAKIGYEKQVKAVITLSSEVSKKSDDFDLEDFKKNQENYTIVDIRNNGEVAEGKIFEDAIAVPLHELRENST
    EIPSHKPVVVH
    CAGGYRSAAGSSILDNKFENTKVYDLSDAIKEFK

    >gi|120435333|ref|YP_861019.1| YeeE/YedE domain-containing protein [Gramella forsetii KT0803]
    MDLILQPWPWYVAGPLIALIMFLLIFMGKQFGMSSNLRTICTMCGADEKASFFDFNWREQKWNLIVIVGAAIGGFIAMNL
    LTPDAAVAINPETVTTLQGLGFESAGKAYLPDELYSLEALTDWKALSILIIGGLLIGFGARWAGG
    CTSGHAISGLSNLQL
    PSLIAVTGFFIGGLVMVHLLFPLIF

    >gi|120435342|ref|YP_861028.1| thioredoxin reductase [Gramella forsetii KT0803]
    MSDTIERVKCLIIGSGPAGYTAAIYAARADMKPLMYTGMEPGGQLTTTTEVDNFPGYPQGIDGPKMMMELQEQAERFGTE
    VRIGMITEVDFSKEVGGIHKACVDNNKWIEAESVIISTGATAKYLGLPSEQKLRGGGVSA
    CAVCDGFFYKGQDVAIVGGG
    DTAAEEATYLSNICNKVTMLVRKDYMKASKAMQHRVENTKNIDLRYNTEVDEILGEQVVEGLRMVNNQTGDKEEIDITGF
    FVAIGHKPNTDIFKGWLDMDDTGYVITQAKSTRTNIPGVFASGDVQDKIYRQAVTAAGTGCMAALDAERYLAEIETEEDI
    QKPQTRPETV

    >gi|120435376|ref|YP_861062.1| OsmC-like protein [Gramella forsetii KT0803]
    MKKLEVSFKNSDSRELKGVLELPTNSQPSNFILFAHCFTCNKNFHAPSNISKNLASKGYGVLRFDFTGLGDSEGEFEDTN
    FSSNVGDLLAAAEFLKKEYKAPVMIVGHSLGGAAALFASQKLDSVKCMVTINAPSNLSHVQKHFESSSEEILNKGFADVK
    IGGRSFKIKKQFIDDLKKNQDASALKEIRKALLVMHSPQDEIVSINHAEELYKSAWHPKSFISIDGADHMLSTKADSEYV
    GTVISAWASKYIKEPKAPELKTDHEVMANLGATGFTTQIIAGNHHLVADEPIKVGGSDLGPNPYELVSSGLAA
    CTSMTIQ
    MYARRKKWKIDNVETHVSYSKKHASDCEECENDMAKIDSFEREISIEGNLDEKQLKRLMEIADKCPVHKTLSAKAQIATR
    LIDS

    >gi|120435426|ref|YP_861112.1| hypothetical protein GFO_1071 [Gramella forsetii KT0803]
    MKKLLLVFLFIGPLVFSQQKGMQEKSFFSEKLYMHLSDYNRKADLAYRFNDYEKGKELFENFIGDHLEGSYMDDFKFRSL
    KNKEVNLYDYTKPVFLITYASW
    CIPSKGEIPAINKLASEYKGKIDFVILFWDKKDKVKELSKKFSSDISVVYVDESKNQG
    AYVVKQLKHSLGLPTCFLLNENKQIMDIRRSVFPAFQTEDEKAYRENYIALEASISKNLIKEYDEVYAENFQVE

    >gi|120435482|ref|YP_861168.1| mercuric reductase [Gramella forsetii KT0803]
    MKEYDVFIIGSGMSGMTIANKCASKGLSVAITDELPYGGTCALRGCDPKKVIIGATEVCDFAARLKTKGIDKVPEVNWAD
    IMAFKQSFVDAMPPKIEKGYDKKGIDTYHSSARFISENTLKIGDTEIKANKIVIATGAKPRELKFEGGELALLSADFLNL
    EKLPESLLFIGGGYIAFEFAHIAARCGSKVTILHRGAKPLKNFEQDIVKHLVTATTDLGIELILNTEVNSINKKDQKFYV
    EGKSNHGSKIFEADAVFNAAGRPPSIFDLDLEKANIAYSEKGIKVNSFLQSSSNPDIYAAGDAADTAGLPLTPVAVLEGH
    TVASNIIKGNKKEINYPPMPTIVFTLPTLASVGLKENEAEEKGYAIKVNHQDASEWFNAKRLNIDQYVFKTIIDKEKQTL
    LGAHLIGPQSEEIINIFALAIKTEIPINDLRKMIFAYPTLASDIPHML

    >gi|120435483|ref|YP_861169.1| mercuric transporter MerT [Gramella forsetii KT0803]
    MKNSNKSNSPAYLSLITAITASLCCITPLLAILAGSSGLATMFSWLDPFRPYLIGLTIGILVFAWYLKLRPKTQKEIECA
    CDEEEKTSFWQSKNFLFIITIFTALMLAFPYYSDIFYTTTKKEIMVVAENNIEKKVIEIEGMTCSGCEAHVESEVNKLPG
    IISVKASYENSNTIVEYDKSLVEEVEIYGAINKTGYKAIPKNKE

    >gi|120435539|ref|YP_861225.1| copper-translocating P-type ATPase [Gramella forsetii KT0803]
    MKHTYKITGMTCNGCRSHVEKSLSKVNGVTQVSVDLKKEEAVIETKEHIPLERFERALEGSNYNIMMPGKTDQSAGQLMK
    HSYKITGMTCNRCRSHVEETLNTVSGVVNAAVNLEKGDAEISMKEHIKVDVFEKALQEHGGNYHIMLPGEKQAKHKHQSE
    DKTPIGKGTGTWYCPMHCEGEKTYDKPGDCPVCGMDLVEQMDLSSPSSGGDEYTCPMHPEIIKDESGDCPICGMDLVPKE
    PQSSAEEKGYKTLLKKFWIAVAFTLPIFLIAMSEMIPDNPLYDLADMKIWNWIQFGLSLPVVFYATWMFFERAYRSIKTW
    NLNMFTLIGIGAGVAWIFSVFGMLFPNFFPDQFKTEMGTVHVYFEAATVILTLVLMGQVLEARAHSRTNSAIKELLRLAP
    NKAVRVVDGVEETISVDKIQKGDVLRVKPGDKIPVDGTIKKGKSSIDESMITGEPIPVDKQEGDKVNSGTINGNQSFTMT
    AEKVGNETLLAQIIKMVNDASRSRAPIQKLADRISAYFVPIVVIISVVTFAVWAIYGPDPAYVYALVNAIAVLIIACPCA
    LGLATPMSVMVGVGKGAKNGVLIKNARALEEMNKIDVLIIDKTGTITEGKPSVEKVVSVSSEYSEKELTRLIASVNAQSE
    HPLANATVNYAKAEKIKYGEASEFNSVTGKGVTANFEGKQLALGNEKLMQAKNAEISEEINNQVTAEQEKGKTVSYLAID
    SSIVGFVTISDKIKRTSREALSELQNEGIKVIMLTGDNEKTASAVAKELNLADFKAGMIPQNKMEEVKKLQAEGKKVAMA
    GDGINDAPALAQADIGIAMGTGTDVAIESAEVTLVKGDLKGVLKAIKLSEKVMRNIKENLFFALIYNTLGVPIAAGVLYP
    FFGLLLSPMIAALAMSFSSVSVIANALRLRGAKLL

    >gi|120435557|ref|YP_861243.1| dihydrolipoamide dehydrogenase [Gramella forsetii KT0803]
    MEKFDVTIIGSGPGGYVGAIRCAQLGLKVAIVERYSTLGGTCLNVGCIPSKAWLEASEHNYKLKHQFEKFGINVKEANVD
    ILKMNQRVQDVVQEIINGVDYLMKKNKVAVYEGHGTIKDKNTIVIKGEDKTETIATDKIIIATGSKPASLPNIKIDKKRI
    ISSTEALALREIPKHLMVVGGGVIGVEIGSVFARLGSKVSIVEYFDSLIATMDGALGHQLHRSLRKQGIEFYLKHKVTNA
    TATDNKVVLKAENLSDKEEMSLDGDYCLMAIGRKPYTANLGLENIEVEINEKGQIIVDENLETNVKGIYAIGDVIRGAML
    AHKASEEGVFVAETIVGQKPYINYSLIPNIVYTQPEVAGVGLTEEELKKANKNIKIGSFPYKANARAKISMDTDGFIKVI
    ADKQTDEILGVHMIGPRIADSYTEAVVAMEFRASAEDIARMSHGHPTFSETFKEACLAATDDRALHI

    >gi|120435622|ref|YP_861308.1| rhodanese-like domain-containing protein [Gramella forsetii KT0803]
    MKNLNAKEFADKIENDNNAIILDVRTPKEWKDGIIPNAKLINLFEPVTFQREVSNLEKDRNYYIYCRSGNRSGQACQIMD
    TKGFNTNNLAGGIMQWDEKLSKPVF

    >gi|120435624|ref|YP_861310.1| metallo-beta-lactamase/rhodanese-like domain-containing protein [Gramella forsetii KT0803]
    MKITQFKDDALSHFSYALLSEGQMAVIDPSRNPIPYYKYAEEENAKIVAVLETHPHADFVSSHLQIHKETGATIYISEKV
    GVSYPHQAFDEGDSIEIGNTSIKPIFTPGHSPDSLTFHAFLNDENVLFTGDTLFIGDVGRPDLREKAGNTKAKRKELAQM
    MYYSIQNKFNELPDDTKVYPAHGAGSLCGKNMSDANSSTLGNERMGNWAFKEQTEDEFIAEILKDQPFIPSYFGFNVDLN
    RKGAENVQSAKFRVPLKLNVENIEDEFLVVDTRNEQLYKKGHLPYSINIMARSESDKFETWLGAIIEPEEQFYLVLESID
    KLEEILERVAKIGYEKQLKGIFTLSEEVSGSSEKFDIQSFDKNKEDYTIVDIRNTSEVSEGKIFENAYHIPLNDLRNNIG
    DLPKDKPMVVH
    CAGGYRSAAGSSILENEINEVPVFDLSEDVKKYSS

    >gi|120435625|ref|YP_861311.1| YeeE/YedE domain-containing protein [Gramella forsetii KT0803]
    MEWIYEPWPWYVSGPLIAATMFVLLYTGKQFGMSSNLRTMCSVGGAGQAAEFFRFDWKKERWNLMVVLGAVLGGFFASTY
    LSNNTVEINTQLADKLSNEYGINSAGEAYMPPEIFAMENLGDPVVLFVLITGGFMVGFGARYAGG
    CTSGHAISGLSNLQI
    PSLIAVIGFFIGGLIMIHLFYPLIF

    >gi|120435632|ref|YP_861318.1| thioredoxin domain-containing protein [Gramella forsetii KT0803]
    MNKTKNKRNKKWLEYLIFGAIALVLYATGLHTEVIGFAQRGLLETGLMNPDVTETREMAQASTSGPESMEKISEDPKANM
    NVQLRDPEGNIVSLSEFKGKVIFMNFWATW
    CPPCVAEMPAIDKLYEEMGDEVAFVMLSRDQNFDTAVAFKEKKDYGLPIY
    ELAGPLPTMYQSSALPTTFVIDAEGNLALTHKGMADYNTDEFKKFLNSLK

    >gi|120435633|ref|YP_861319.1| thiol:disulfide interchange protein DsbD 1 [Gramella forsetii KT0803]
    MTMFRFIIAFIMLAVGTNTYGQLMEAPEWNAEILEDTYIPGDTVTARFTAKIAENWYMYSSDFSKNLGPTVTEFHFEDKP
    EFKVVGEVNPVGAKRKYDELYEGEYTYFTHEAVFDQRILIKKVDPVIKAEASYQICSDVNGQCIPFTSEISVTSFKESPS
    EKNNDGEVFKMEAFQNEFQSNTKSEEGFSFLLVFFFISFGAGLAALLTPCVFPMIPMTVTYFTKSNASRANGINQALLYG
    FSIILIYTLIGTVFSLLFGADFANFLSTHWFPNLFFFFIFLLFALSFFGLFEIRLPNSFVNKMDAHSNKGGVLGIFFMAF
    TLVLVGFSCTGPIAGTILLQAANGETLKPLIGMLGFSLAFALPFTLFAIFPHWLKSLPKSGGWLNTVKVILGFIELALAL
    KFLSIVDQVYHWNLLDRDIYLALWIVIFAFLGFYLLGKIKFPHEKKTENTSVYRVISAILVFTFVVYLIPGLFGAPLKPL
    AGYLPPMSSQNFEMQASVSQIGNVSDNSIANCGTPKYDELLELPHNIQGYFDYEQALECAQKQNKPLFIDFTGHG
    CVNCR
    EMEATVWSDPRVLKRLKNDYVVVALYVDEKTELPESEWYVSAHDQKVKKTIGKQNLDFMIQKLNANAQPYYTLVDNKGSL
    LSAPKGYDLNVENFVEFLDNGIQEFQGRQGNNMASSRIIQRQNE

    >gi|120435671|ref|YP_861357.1| heavy metal transport/detoxification domain-containing protein [Gramella forsetii KT0803]
    MKRIALIMVVAVFGTISSDAQITKVDQEVFGMDCAPCAYGLERGLKKMDGLEKVRVSLNDGKAYLELSENNSLSLKQIQE
    EVKKNGFSAKKAEVVIEGKLIEKNNNFQLHTETETYSLSGDLVSELKPGKMKLKGIVQDEEDDDLPSHWKINIIWIF

    >gi|120435675|ref|YP_861361.1| hypothetical protein GFO_1320 [Gramella forsetii KT0803]
    MKRQIEIFTANCPVCDPVVKMVKEMSCDSCEITTYNLVEQCEDKTCIDKVQEYGVKRIPSVAVDGKLLECCTNNGISKEK
    LIEAGIGKAS

    >gi|120435678|ref|YP_861364.1| glutathione reductase [Gramella forsetii KT0803]
    MKKYDVFVIGSGMSGMTVANKCASKGLKVGITDELPYGGTCALRGCDPKKVIIGATEVRDFAQRLKGNGIDTVPEVNWED
    IMAFKESFVDAMPPKIEKGYKNKDIDTYHTSAKFLSDNTLQVGDEVIEADKFVIATGAKPRVLDFEGGNLALSSTDFLNL
    KKLPKSLLFIGGGYIAFEFAHIAARAGADVTILHRGEFPLENFDRDIVQHLVDATRKLGIKLVLETEVSKIEKKEDHYVV
    TGKSNGKETTYKTASVFNSAGRPPAIFDLDLEKAGISFSKKGITVNEYLQSTSNPNIYAAGDSADSRGLPLTPVAVMEGH
    IVASNIIKGNKKKVNYPPMPSVVFTLPILASVGLTEAEAKSKQIEYQVNYNHAESWFNAKRLNVKEYAYKTIINKENQTI
    LGAHLIGPNAEETINLFAMAIKTKMKINELRTMIFTYPTLSSDIPHML

    >gi|120435679|ref|YP_861365.1| heavy metal transport/detoxification domain-containing protein [Gramella forsetii KT0803]
    MKSSNKSNSTAFVSMLTAVTASVCCITPLLAILAGSSGLVTTFSWIEPFRPYLIALTIGILGLAWYLKLKPKTQEEIDCA
    CDEEEKPSFWQSKNFLFMVTVFAGLMLAFPYYSNIFYSQPSKDIVYVSQSNIIKHTFEVEGMT
    CAGCEAHVESEVNNLDG
    ILSVKASYANSNTVVEYDKTKVDLTAIRKAINTTGYKVIDTENKKEK

    >gi|120435696|ref|YP_861382.1| electron transport protein [Gramella forsetii KT0803]
    MKLKKHFKIFLMLVFLGGGLISCKSKEEKLPILGSTEPINNGKDTIYHKIPDFSFTDQNGKTITAKTFENKIYVADFFFT
    S
    CTTICPVMGKEMQRLYEKYKGNEKIAFLSHSIDPAHDSVPVLKEYSEDLGVDNHQWHFVTGEQEAIFNMAQNHYMISAM
    RDSTLPDGVLHSGAFILVDSQKRIRGYYDGTSKKEVDKLISDISILLQHN

    >gi|120435702|ref|YP_861388.1| metallo-beta-lactamase/rhodanese-like domain-containing protein [Gramella forsetii KT0803]
    MYFIHSMAFRFEPILAEGIAQVSYFICDESAGGAAIIDPRPDADIYLQKARQYGVTFTHVFETHIHADFMSGARQLKARC
    KGSAKIFVSIEGDATYDFAYEPVREGDEFEFGQVKMMAKHTPGHTPEHLSYLLYESHKEDPWGIVTGDSLFVDSLGRPDL
    LGDEKTDELTQALFNTMREVFCKLRDEVIVYPCHAAGSACGPDIGNRLHTTIGYEKKHNPFMQMETIEEFKKAVQDSAPP
    VPTHYPKMKKLNAKGPKTFGHLPPVRSLSVEDFEKEMKNPDTIIIDTRDMLAFGGGHIEGAFNIGQRPILSVWAGWLIDT
    EAPILLVLPEDKDLEQVVTLLWRTGHTNFKGYLAGNMRSWQESGKRIKKLPQLSVHELSQNNGQYQPLDVRRDKEWQNGY
    IPDARHIFLGELSDKISTLNKKQKFAVY
    CASGYRASIAASLLQKNGFQNVNSIPGSFKAWKAADLSIENKSQYQKK

    >gi|120435759|ref|YP_861445.1| thioredoxin-like protein [Gramella forsetii KT0803]
    MKEIIENSLKNAMEYSQYQLLFKQLVEKGRTTGEETDEKINYTKLNFSRSKRLDKTIKLSEKEKQCFKNIRENQTWLVIT
    EPW
    CGDAAQSLPFFNKIAQISEKIALKIVLRDENPNLMDAFLTKGSRSIPKLIILNKEKEILNVWGPRSSAATKLVQDYL
    EEHGKIDDIVKTNLQLWYNQDKGKAILTELQELALYEKRTASI

    >gi|120435786|ref|YP_861472.1| heavy metal-transporting P-type ATPase-most likely copper-transporting [Gramella forsetii KT0803]
    MESCFHCGDDCLEEIIAFDDKSFCCSGCKTVFEILNTNDLSYYYELEKAPGISPKIREGKYDYLENSEIIERLLEFDHDN
    TQIVSFSIPSIH
    CSSCIWILENLNKLHKGIKSSQVDFPKKTIRLSFSSEEMSLKNLVLLLVRIGYEPNISLDNYDANESS
    VDRSLIYKLGVAGFAFGNIMFLSFPEYFEINEFWLEQFKHLFRWLMFIFSLPVVFYSGRDYFISAFKGLRSGILNIDVPI
    ALGISVLFIRSTVEIPLDLGTGFFDSLSGLVFFLLLGKFFQQKTYSFLSFERDYKSYFPIAITRVISKEGKQLEEQIQVY
    KIEKGDRIIIRNEELIPMDAILIKGDAKIDYSFVTGEAEPVSKISGDKLYAGGRQQGGIIELEALRPVKQSYLTELWSDE
    VFSKDKNSVFQNLTNQISKRFTYAVLCIAILSTTFWMFYDPSKAWNVFTAVLIIACPCAIALAAPFTLGNMLRIFGKNHL
    YLKDANIIEKTAEIDTVVFDKTGTITTNDRSRIEYEGLELTSEEKQLLGGSLRASNHPLSRSLYNILDKHNISTPESFTE
    HTGQGLETTYKNLHLKVGSPAFVDQAARHFTELQQKKKVERTSVYISTNNQYKGCFTFHNSYRNGLSDIFKELSVNRKII
    ILSGDNDGERARLQEIVPQGTNMFFNQKPGDKLQYIKDLQSQGRKVMMVGDGLNDAGALAQSDVGIVISEDINVFSPACD
    GILDAKRFKDLGSFFDLSGKAIKVIQLSFLLSLFYNLIGLGFAVTGNLMPVVAAILMPLSSISIVVFTTLVTQIITKDLK
    IKRRT

    >gi|120435815|ref|YP_861501.1| peptide methionine sulfoxide reductase [Gramella forsetii KT0803]
    MKELKLKKATLAGGCFWCTEAVFQRLEGVEEVSSGFTGGEIKNPAYREIITGRTGHAEAIEIQFNPEKISFEELLLVFFA
    THDPTTLNKQQNDVGTQYRSAVFYHDEDQKIKAEEVIALLEKEGMFENPIVTEVSEASEFYVAEAEHQDFYNQHRQQPYC
    QFIIDPKIKKLNKLFSDKLK

    >gi|120435897|ref|YP_861583.1| OsmC-like protein [Gramella forsetii KT0803]
    MKRKGSAVWEGSLKEGKGKISLESGVLKDAQYSFKTRFENGKGTNPEELVGAAHAGCFSMQLSAFLTEDGFEPDKVETTS
    EITFEDGEITKSHLILNAVVPGIDKDKFDKIANKAKES
    CPLSKLLKAEITLEYDLK

    >gi|120435939|ref|YP_861625.1| peptide methionine sulfoxide reductase [Gramella forsetii KT0803]
    MADLEKIGLGGGCHWCTEAVFQALRGVVKVEQGYVSSYHENISFSEGIIVHFLPSEISLDILIEIHLRTHKSTSSHSMRQ
    KYRSAVYTFSQEQSEKSSQILKKLQSKFEKHIITEVLSFQKFRASREEIQNYYRNDPEKPFCKKFIDPKLEFLKNKFSKN
    LKPSSTQFVRDILNNFPIGYSEVWYLGKRYGVSKTEFNNGNSTKLYAEELGGKIFISLNFYKTQNSMLLKPCEMPVDKVL
    HFLGHFKMLE

    >gi|120436031|ref|YP_861717.1| E3 component of pyruvate dehydrogenase complex [Gramella forsetii KT0803]
    MSKNEKKELIIIGAGPGGYAAAFRAADLGLKVTLIDPEANPGGVCLYRGCIPSKALLHIAKVKQEAMQAAEWGIEFESPK
    IDLKKLQKWKDSVVEKLTDGLGQLSKSKKIDYIKGTAEFISDKKIKVNPVEEDPYELEFENLILSTGSVNVSLPGIEIDH
    KKVIDSKDALDLNKIPKSMLVIGGGYIGLELGSVYAALGSKVSVAEMTSGFLPGADRDLVNVFEKEHPFEALYFDTKVEK
    ASVTKNKVKATLKGKDDKTKEKTFDQILVAVGRKPNTKTLALNMANIEPDENGFLKVNRQRQTKKKNIYAIGDLTGEPLL
    AHKATYEGKVAVETIAGEKGAAYDPKSIPAIVFTNPQMAWCGLTQEEAKKNNIEIKVLKFPWSASGRAVAVGNPNGVTRL
    IVDKKTGRILGGGVAGKNAGSLISEISLAIEMAATAEDIALSIHPHPTLSETIMEAAEIFSGSPTHISKNSSE

    >gi|120436094|ref|YP_861780.1| carboxymuconolactone decarboxylase family protein [Gramella forsetii KT0803]
    MYNDNNLKKLSTLEKKSSKAMEAYKAFDKAALEDGSIPKKYKELMAVAVALTTQCPYCIEIHKKAAIDAGASEEELAEAT
    FVVAALRAGGAVTHGTHLMEK

    >gi|120436134|ref|YP_861820.1| peroxiredoxin Bcp [Gramella forsetii KT0803]
    MTTLKEGDKAPDFKAEDQDGNEIKLSDYKGKKLVLFFYPKASTPGCTAEACNLSDNYDAMKKKGYEILGVSADSKKRQQN
    FKNKYDFKYPLLADEEKEVINAYGVWGPKKFMGKEYDGIHRTTFIINEEAKIEEVIKKVKTKAHAEQILEN

    >gi|120436149|ref|YP_861835.1| hypothetical protein GFO_1798 [Gramella forsetii KT0803]
    MKNLKPRQEVPELIVKTTKGLKWNLRDNKPDNFTMVIFYRGIHCPVCKKYLEELNTKIEDFKDKGINVICVSSNNEELAQ
    KTVEEWDIENLNIGYNFSVEDGRKWDLFVSEGIKDSEPEVFVEPALFLIKPDNTLYSASIQSMPFARPKFDELLKSISFV
    LKEDYPARGEA

    >gi|120436154|ref|YP_861840.1| arsenate reductase [Gramella forsetii KT0803]
    MLKIYHNSRCTKSREGLEILKNSGKEFEIKEYLKEPLEESELESLVKKLKITPMQLVRKNEKIWKEEYKNRDLSDREIIT
    AMVKNPKLIERPIVETEKEAVIGRPPSDIEKLL

    >gi|120436213|ref|YP_861899.1| peptide methionine sulfoxide reductase [Gramella forsetii KT0803]
    MKKLFLFTVLATFLMSCNGNAQKTSKKSSKDYEVSKTESEWKEELTSEEFDVLRKAATERPFSSELNDIKKPGTFVCAAC
    GNELYKTEHKFMSGTGWPSFDRPIEGGVAYGSDSKLGYQRDEVHCARCGGHLGHVFNDGPKETTGKRH
    CINGIAMDFNPE
    NE

    >gi|120436214|ref|YP_861900.1| peptide methionine sulfoxide reductase [Gramella forsetii KT0803]
    MQWTLILKTNKMKKYKVEKSEAEWKKELSPEQFRVLREKGTEAPNSGKYNLHFDEGEYKCAACGDKLFESNSKFESGCGW
    PSFDDAIEGKVEYIQDKTFGMIRTEILCSNCGSHLGHIFDDGPTDTGQRY
    CVNSASIEFNK

    >gi|120436216|ref|YP_861902.1| dihydrolipoamide dehydrogenase [Gramella forsetii KT0803]
    MSKYDIIVLGSGPGGYVTAIRASQLGFKTAIVEKESLGGVCLNWGCIPTKALLKSAEVFDYLKHAEDYGLKLEKADKDFG
    AVVKRSRDVADGMSKGVQFLMKKNKIDVLEGFGKLKSGKKVEVTDSKDKKTEYQADNVIIATGARSRELPNLKQDGKTVI
    GYREAMTLKKQPKSMIVVGSGAIGVEFAHFYNAMGTEVTVVEYLPNVVPLEDEEVSKQFERSIKKAGIKVMTNSSVESVE
    KSGGKVKAKVKTKKGEETLEADIVLSAVGIKSNIENIGLEDLNIKTEKDKIVVNDFYQTNVSGIYAIGDVVHGPALAHVA
    SAEGILCVEKIKGMDVEPLDYGNIPGCTYATPEIASVGMTEKQAKEAGYELKIGKFPFSASGKASASGKKDGFVKVIFDA
    KYGEWLGCHMIGAGVTDMIAEAVLGRKLETTGHEVLKAVHPHPTMSEAVMEAVAAAYDEVIHL

    >gi|120436398|ref|YP_862084.1| AhpC/TSA family protein [Gramella forsetii KT0803]
    MKKISILFVALALVLVGCEEDKGYFLSGNISGLEDGKQVYIAEYDASTNSTKALDTTTVQEGKFEIDMGEQDLPKLSFLR
    FEGVNGNVIFISENQKINFEINKDSLRNTRIKGGKENKALSEYLDHLNELNRKMGSMQQDMRQAMTSRDTAKLSSMRKTQ
    LELRDNDENFKKELFNRNKDSYLSVMLLTDMLKMRSLSSAEVREMYAEVSDRIKETPMAQNLKEALEQSKAAEIGSKAPE
    FSGPTPDGGELALSESLGKVTIVDFWAAW
    CKPCRVENPNLVRTYNKYKDQGLNIISVSLDRPGQKERWLKAIEEDKLEQW
    NHVSNLQFWNDPIAKKYKVTAIPAMFVLDENGVIVAKNLRGDALANKIGELIQ

    >gi|120436511|ref|YP_862197.1| dihydrolipoamide dehydrogenase [Gramella forsetii KT0803]
    MSTYDVAVIGSGPGGYVAAIRCAQLGMKTAIIEKYSTLGGTCLNVGCIPSKALLDSSHHYDDAIKHFEDHGIEIPGEVKL
    NLEKMMERKSSVVSQTCDGVKFLMDKNKIDVIEGVGSFKDKTHINIEKDGETQTIEAKKTIIATGSKPANLPFIELDKER
    VITSTEALTLKEVPKHMIVIGGGVIGLELGQVYRRLGAEVTVVEFMDRIIPTMDSALSKELQKVLKKQGVKFHTSTKVKS
    VERNGDEITIKADDKKDKEIELKGDYCLVSVGRRPFTDGLNAEAAGVKLDDKGRVKVNDHLQTNVENIYAIGDVVRGAML
    AHKAEEEGSMVAELMAGQKPHIDYNLIPGVVYTWPEVASVGKTEEQLKEEGVKYKEGKFPMRALGRSRASGDIDGLVKIL
    ADEKTDEVLGVHMIGARTADLIAEAVTAMEFRASAEDIARMSHAHPTYAEAVKEAALAATENRALHI

    >gi|120436523|ref|YP_862209.1| peroxiredoxin [Gramella forsetii KT0803]
    MALVGRKFPNLSVDAMNEMGDTFKLNILEEAQKNNKKVLLFWYPKDFTFVCPTELHAFQNAMEEFEKRNVMVVGASCDTP
    EVHFAWLNTPKDNGGIEGVKYPILADSNRNLSSRLDILDIMSETYDDETGAITLEGDNVTYRATYLIDEEGTVFHEGVNH
    MPLGRNVNEFLRLIDAYTHVQEKGEVCPANWEEGKEAMNADREGVASYLSLN

    >gi|120436524|ref|YP_862210.1| thioredoxin [Gramella forsetii KT0803]
    MIKELDQDNLSEVINGNDTVVVQYMAGWCGNCRLMKPKFKKLASENENAQFIFVDAEKFPESRKLATVDNLPTFATFKNG
    SFKNQVQTNKFDQLKSLVDEVTSN

    >gi|120436526|ref|YP_862212.1| thiol peroxidase [Gramella forsetii KT0803]
    MAKVELGGERVTTYGNLPELNEKAPHFELTKSDLSVGTLEDFKGKRVILNIFPSIDTGVCATSVRNFNKKASELKNTVVL
    CISRDLPFAQKRFVNDEGLENVTNLSDFRDRNFGKDYGVEMIDGAFEGLLSRAVLVLDENGRVIHSQQIEKIEDEPDYLA
    ALKTLL

    >gi|120436560|ref|YP_862246.1| hypothetical protein GFO_2214 [Gramella forsetii KT0803]
    MNQSLPQTQSRFKMISYDAASPEVRDIYDDTKKTLQLPFVLNWFKCQGDNALLLQGNWSKLKNTLMEGQVPNVLKQLIIY
    NVSKERGCNY
    CSHAHGIFADSMSSMISEEEGFKATQHLNSPSMPVSYKTAVQVVTKAALNHSDISDEDFQKLEEAGFTHK
    EIQELMAQADLVNMLNTIADVSGIRIDNELLETPE

    >gi|120436706|ref|YP_862392.1| peroxiredoxin [Gramella forsetii KT0803]
    MKIGDEVPDLELKNQNGEKFRFSELKGKKAFVVYFYPKDFTPGCTKEACSFRDSYEDFKELGAEVIGISGDSSKSHSKFI
    DRYKLPYIFLSDKDKKARNVFGVKPSLLGLLPGRETFVFDKNGKLLHRFNSMSAGRHMPEALAVLKKNQN

    >gi|120436840|ref|YP_862526.1| thiol-disulfide oxidoreductase [Gramella forsetii KT0803]
    MKLFKNQWSNIIIIVIILAMVIPQTRKPIQIFVNKLISFAPSVNDEDDRAKISNYNWVLENKRGKRVEFSEFQNEVVIIN
    FWATW
    CPPCIAEMPSFQELYEDYGDKVTFIFVSGEQHETTDNYMKRKRFTLPSYKMLTKAPEPMDGRTLPTTYVLSKDGS
    IVIDKVGSADWNSDSFRKTLDKLLIE

    >gi|120436863|ref|YP_862549.1| secreted protein containing DUF1573 [Gramella forsetii KT0803]
    MKKTILMFAAVGAMLFTGCKDNASDKVKAENVEASAERDAQETQYPEITFNESEFDFGNIAKGTNVEHVFKFENTGNAPL
    VITNASSS
    CGCTVPEYHKNETIAPGETGEMLVKFNGSGNGQVTKTVTVSANTETGKEQIKIKAFVEADENAS

    >gi|120436872|ref|YP_862558.1| thioredoxin domain-containing protein [Gramella forsetii KT0803]
    MSRTASNMLKLGTKAPNFKLMDTITDHLITLDEVKGERGTLIMFICNHCPFVKHVNEEIVRIANEYRQLGFGFAGIMSND
    VKNYPEDNPEKMKEHAAKHQYSFPYLFDGTQEIAKAYDAACTPDFFLFDDQLQLIYRGQLDDSRPGNGIHPNGRDLREAM
    DAILNNRKVTEEQKPSIGCNIKWKD

    >gi|120436873|ref|YP_862559.1| peroxiredoxin [Gramella forsetii KT0803]
    MSELKLGDKAPNFDAETSDGKINFHDYLGDSWGILFSHPADYTPVCTTELGTVANYKAKFKERDVKVIALSVDGLKSHEG
    WIKDINETQNTTVNFPIIADEDRKVSDLYGMIHPKADDTLTVRSVFVIAPDKSIKMTLTYPASTGRNFDELLRVIDSLQL
    TAYNKVATPANWKQGEDVVISPSVSNEEADKMFPKGYKVVKPYLRTTSQPELKK

    >gi|120437001|ref|YP_862687.1| thiosulfate sulfurtransferase [Gramella forsetii KT0803]
    MKELSQEEWQKQIQNDKDAVLLDVRTEEEVEEGYIPKSKNIDIYKGQGFIDEVEKLDKSKHYYIYCRSGKRSSQACTLLD
    QMDFAETYNLIGGFSEWEGEKKTD

    >gi|120437047|ref|YP_862733.1| peptide methionine sulfoxide reductase [Gramella forsetii KT0803]
    MKFLLLNFVSLVLLACGNQAKDSNITKPEIANAEPVEVSTQDGMKKAYFASGCFWCVEAIYESVEGVSESISGYAGGHTK
    NPTYEGSNTGKTGHAEAVEVIYDPEVVSFKTLVEVYYGSQDPTQVNGQGPDRGSQYRSLIFYQNADQKKIIEEVKAEVAK
    NYDKAIAAEILPFQKFWVAEDYHQNYEKNNPQNPYIQNVSIPRLNRFKAKFPDILKEDAH

    >gi|120437260|ref|YP_862946.1| secreted protein containing DUF1573 [Gramella forsetii KT0803]
    MKKLIAIAIFVFVGLASAQAQKTAKIEFKSETIDYGEIMKGSDGVRVFEFTNTGDAPLVIEDVKSSCGCTVPKKPEEPIM
    PGKTGEIEVKYDTKRVGPIRKTVTVYSNAAEPTKALKIKGLVKDEAGDTK

    >gi|120437263|ref|YP_862949.1| copper-translocating P-type ATPase [Gramella forsetii KT0803]
    MKHNYKISGMTCNGCRAHVEKTLSEVDGVLNASVNLEKAAAEIEMREHIKIEKFEEALQKNGGNYHIAMPEDAENSAEKP
    MQHTYQITGMTCNGCRSHVEKILNDVNGVVKASVNLEKEEAEISMKEHIEIEKFENALQKDGGNYHIMKPGEKRSKSAGH
    SNKKKKNPEKGTGTWYCPMHCEGDKTYDKPGDCPVCGMDLVEEVSATPKSTEYTCPMHPEIVEDGPGDCPICGMDLVPME
    PEASAEEKSYKKLLRKFWIAVGFTLPIFLIAMSEMIPDNPLYDLAGMKVWNWVQFGLSLPVVFYATWMFFERAYRSIKTW
    NLNMFTLIGIGAGVAWIFSVFGLVFPDFFPPQFKTEMGTVHVYFEAATVILTLVLMGQVLEARAHSRTNSAIKELLKLAP
    NTAVRVVDGDEETISVDKIQQGDILRVKPGDKIPVDGTIKKGKSSIDEAMITGEPIPVDKKEGDKVSSGTINGNQSFTMT
    AEKVGDETLLAQIIKMVNEASRSQAPIQKLADRISAYFVPVVVAISVITFIVWAIYGPDPAYVYALVNAIAVLIIACPCA
    LGLATPMSVMVGVGKGAKNGVLIKNARALEEMNQIDTLIIDKTGTITEGKPSVEKVVSVSSEYSEDEITRLIASVNAQSE
    HPLATATVKYAKAENIEYGEASDFNSVTGKGVEAKFEEKQLALGNDKLMKVENAEISEEINKKVTAEQEQGKTVSYLAVN
    SKIVGFVTISDKIKETSREALHELQKEGIKVVMLTGDNEKTAAAVAKELGLADFKAGMVPQDKMEEVKRLQGEGKKVAMA
    GDGINDAPALAQANIGIAMGTGTDVAIESAEVTLVKGDLKGVLKAIRLSEKVMRNIKENLFFALIYNTVGVPIAAGVLYP
    FFGLLLSPMIAALAMSFSSVSVIGNALRLRSAKLN

    >gi|120437297|ref|YP_862983.1| hypothetical protein GFO_2969 [Gramella forsetii KT0803]
    MKKLFLFTFLLVAVGSLQAQEIKWMSMNEALEAQKKNPKKIFVDAYTTWCGPCKMLDKNTFSNKDLAAYVNKHYYAVKFN
    AEGEEVVNFNDKVFKNPNYDPKRKGRNAVHQFALAMGVNAYPTMVFFDENAKFLTPVKGYLTPQKLEIFLKIFATDDYKK
    VKTDEEWKKYQEEFKGTFSS

    >gi|120437348|ref|YP_863034.1| thiol:disulfide interchange protein DsbD 2 [Gramella forsetii KT0803]
    MLNNLLKKGLFFLVILTGFFGQAQIHDPVEWEAEVNKISEDEYELIMSAFIEDHWHLYSQHLPEGGALPTVFIYEEVGDK
    YELLGDTEESEPITEYDNVFEMDLSYFNNNAFFTQKIKLTDTSLGIINAKVEYQVCDDEACIFQTENFEFVINEEARGEV
    VTHENNSTKAIPENTGEVELANPDEKRSFWGIFIVAFLSGFAALLTPCVFPMIPMTVSFFTKQSKSRAAGIKNATFYGIS
    IVVIYVLLGTLVTVIFGADALNALSTNVWFNTIFFVLLVIFAISFMGAFEIVLPSSWGTKIDSKADKGGLVGIFFMALAL
    AIVSFSCTGPIVGTLLVEAASKGGIAPIIGMLGFSLAIALPFGLFAAFPGWLNSLPRSGGWLNTVKVTLGFLELALAFKF
    LSNADLVLQLHILEREIFLAIWIAIFGMLALYLFGKIQLPHDSKVEHISVGRLMTGLVVLIFTIYLIPGLWGAPLKLISG
    FPPPLQYSESPDGIGNSKVGTVFSEGEGLPDGAEYGPHDIVSFHDYEDGLAYAKEKDLPILVDFTGHA
    CVNCRKMEERVW
    SEPQILQTLKEELVLISLYVDDKRKLPENEQYVSETTGKEIESIGNKWSDFQITRYKANAQPYYVLLDHEEEMLIAPSGY
    EPDADEYYSWLKKGIKNFNKDSSSSGQSLGGNSGDIFSKD

    >gi|120437351|ref|YP_863037.1| thioredoxin [Gramella forsetii KT0803]
    MAVEITDANFEEQVLKSDKPVVVDFWAAWCGPCRMVGPIIDEISTEYEGKAVVGKLDVDANQEFAAKYGVRNIPTVLVFQ
    NGEVVGRQVGVAPKQTYADAIDQLL

    >gi|120437461|ref|YP_863147.1| HesB/IscA family iron-sulfur cluster assembly scaffold protein [Gramella forsetii KT0803]
    MIKVSEEAKTKISTLMTEGGFNPEADYVRVGVKSGGCSGLSYELNFDKSQAEGDKIFEDNSVKIVVDKRSVLYLAGTILE
    YSGGLNGKGFVFNNPNAQRTCGCGESFSL

    >gi|120437481|ref|YP_863167.1| glutathione reductase [Gramella forsetii KT0803]
    MGIEEFDVFIIGTGTAGKSVAEECIAEGLKVAIADNREFGGTCANRGCDPKKVLVGLTEILDRAEKMKGHGITKMPEFSW
    KDLMKFKETFTSAVPAATEKDMKALGIKMYHQSPKFLDENTLSVEGKTVKAKKIVIATGNKALELPIPGRDLPIISDDFL
    ELEELPESIIFIGAGYIGMEFAHIAARCGANVTVVEGESRALGNFDEAMVKHLQKASEEIGIKFVFDSEVTEVEKLQTNY
    RVIANQNGKQIELKAKLVLNTAGRVPSIDDLDLENGNVDFSKKGIIVNEHLQSPTNKNVYACGDVSDSEGLPLTPLSSQE
    ARIVAGNILDKDRDKTVDYPPQPSVVFTLPNLASVGLNEKEAKEKGYDFKVEQKLVPKWFNAKRINDDYYAYKTLIDKET
    GLVLGAHLLGPDAGEMINMFVMAMCGKLNCETLKGMIFSYPSWGSDIKAMV

    >gi|120437531|ref|YP_863217.1| hypothetical protein GFO_3207 [Gramella forsetii KT0803]
    MKNLLFIILIFILQPMQAQRTEIAWIGFEDLEDSLKVKAKPVVLYFYTDWCVYCKKMDKNAFRDPEVISTVNQDFYAVKM
    NAESTEPVDFEGQTFINEQAKVQRNGVHQIPQMLATREDKPISFPVVMVLDKNFRVEKRSFEYLTSEKMRLLIKG

    >gi|120437558|ref|YP_863244.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Gramella forsetii KT0803]
    MKKARIKTPLGIAELCGNSDGLISVKVMDAGSVTSEIPSELKTAATQLASYFKGELNEFSLKLNPQGTDFQKKVWKQLEK
    IPYGTTTSYLQLSRELGDKKAIRAVAAANGKNPLWIIVP
    CHRVIGSDGSLTGYAGGLYRKKWLLDLENPPKQQSLF

    >gi|120437569|ref|YP_863255.1| rhodanese-like domain-containing protein [Gramella forsetii KT0803]
    MQLYNKLSAKEREALLEEAGEDRLTLSFYAYAKIGNPELFRNHLYIAWDQIDVLGRIYVAHEGINAQLSVPAKRFNEFKA
    FIDEIYFLENVRLNIAIEHDIKSFLKLKVKVRTKIVADGLNDETFDVTNKGVHVDASKFNELINDPNTVLVDMRNHYESE
    IGHFQGAITPDVDTFRDSLDIIEEDLKEHKEDKNLVMY
    CTGGIRCEKASAYYKHRGFKNVYQLEGGIIEYTRQVEKQQLE
    NKFIGKNFVFDHRRSERISEDVIAQCHQCGKPCDTHVNCANEACHLLFIQCEECAEKMNICCSDNCKEIAALPYEEQKAL
    RKGKGASNKIFKKGRSEVLRFKQ

    >gi|120437714|ref|YP_863400.1| thioredoxin [Gramella forsetii KT0803]
    MKSSFNDIIKSETPVLIDFYADWCGPCKSLAPILKQVKKELGDKVKIVKIDVDKNQPLAAKYQVRGVPTMIIFKNGEQMW
    RQSGVLPKEEIKNKITSI

    >gi|120437762|ref|YP_863448.1| ArsC family protein [Gramella forsetii KT0803]
    MKKVYYLSTCDTCKRILNELEVPDSFIKQDIKSEKITEEQLDEMEQLSGSYESLFSKRAKLYKEKDLKNEDLDEGRFKNL
    ILEHHTFLKRPVIINNDKIFIGNSKKTVAEAKESIHG

    >gi|120437920|ref|YP_863606.1| carboxymuconolactone decarboxylase family protein [Gramella forsetii KT0803]
    MSKNYYDAADLRKFGEITEWSEELGTKFFDYYGKVFEEGALSAREKSLIALAVSHVVKCPYCIDAYTKDGLQRGITKEEM
    MEAVHAGAAIESGATLVHGVQMMNKYKKLSM

    >gi|120437921|ref|YP_863607.1| radical SAM superfamily protein [Gramella forsetii KT0803]
    MLTKSLKARKDDLSSPKNQLKFLNNGIFKEGELPRFKDKIAETGNFPLKPKKLEILQLNLGYMCNQVCSHCHVDAGPDRK
    EIMTKETMEQCLEVIKTTGAHTLDLTGGAPEMNPNFRWFVEEASKAGIKDFIVRSNLTIILANKKYHDLPQFFKKHNVHV
    ASSLPFYKREKTDKQRGSGVFDKSIKALQMLNEVGYAQEGTGLKLDLVYNPSGAFLPTDQEAMEHDFKVALKEDFNIDFN
    SLFAITNLPISRFLEYLIASENYEDYMYALVEAYNPTAVENVMCTNTISISWDGWLYDCDFNQMLELKVDSKVQHISEYN
    EDLLNDREIIISQHCYGCTAGAGSS
    CQGTVTE

    >gi|120437927|ref|YP_863613.1| rhodanese-like domain-containing protein [Gramella forsetii KT0803]
    MKNLLIILFIISGCLIASAQDKPLDKLLSRYNSGKVSYISVEELKMKYLNDAVVILDAREKIEYDVSHLPEAIFVGYSNF
    SEDEVSKRFKDKSASIVVY
    CSIGIRSENIAEKLQKAGYTNVSNLYGGIFEWKNTGFKVFSNGKETNKVHAFSKNWAKYLE
    KGEKIY

    >gi|120437930|ref|YP_863616.1| SAM-binding motif-containing protein [Gramella forsetii KT0803]
    MSYLETTKDVYRDAALTPDVGLCCTTNPVWELPGLKIPKIMQEMNYGCGTTVHARDLTNDPRILYVGVGGGMELLQFAYF
    SRQKSGVVGIDVVDEMLEASRKNFKVAEEMNPWFKSEFVDLKKGDATDLPVEDNSIDVAAQNCLFNIFKTEELTKALKEM
    YRVLKPHGKLVMSDPTCEQEMNDELRNDERLRAL
    CLSGSLSIKDYVKALTDAGFGTIEIRARKPYRILDPKNYPTEELVY
    IESIEVAAIKDPMPEDGPCIFTGKAAIYYGQEDLFDDKKGHILLKNQPLAI
    CDKTANALADLGRDDIYISESTFHYDGGG
    CC

    >gi|120437524|ref|YP_863210.1| electron transport protein [Gramella forsetii KT0803]
    MLKFFARYKTFAIVFFILSLIIVYIIYTLKVPEEKLPIFQPDMVNAELVDTTVQYVRKYHKIADFKLVNQNGDTITEEFY
    KDKIYIADFFFTT
    CLTICPVMTDHMIKIQEKIKDDDEVLLLSHTVFPVTDSVPVLKKYAEEKGVIDEKWNLVTGDKKEIY
    DLARKSYLATKSTGDGGPYDMIHTENFVLVDKNKQIRGFYDGTDSEAIKTLMHDLKVLKGEDH

    >gi|120434698|ref|YP_860385.1| OsmC-like protein [Gramella forsetii KT0803]
    MKISLKRINDNYLFETVNERGNIVLLDNKSDAEPKGSSPMDLILRGIAGCSSIDVVMILKKQQHELEDLQVEVEGFREDG
    AIPNVFNKIHLNFIFKGEVPAAKVERAVKLSMDKY
    CSVSKMLEKAATISYSIELNSEKIL