Gordonia bronchialis DSM 43247

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|262200196|ref|YP_003271404.1| peptide methionine sulfoxide reductase [Gordonia bronchialis DSM 43247]
    MSWLDQLLSARAHKQELVERHSALPGREVAMPLAAENIELHHPMRGEPDPDSDDPLRGGIGHFDGHGAVILGGGCFWGVE
    EIFWQVPGVYTTAVGYAGGYTPNPTYEEVCSARTGHTEAVLVVFDPAVIDLTGILKIFWETHDPTQEMRQGNDVGTQYRS
    AVYTTSDEDARLARDTAEKYATVLQEAGLGPVATEITPLAQAGDGRFYYAEDYHQQYLAKNPLGYRCHAATGIAYPVA

    >gi|262200200|ref|YP_003271408.1| Rhodanese domain-containing protein [Gordonia bronchialis DSM 43247]
    MSMSDIESIAVSELPNDFTGVTDAVMLDVREDDEWSAGHIRGAVHIPLAQVPARIDEIDLDADLYVVCHSSGRSMRVLQY
    LAQRGVDGTCVGGGMLAWVEHGKPVETGPAAEGDDNG

    >gi|262200226|ref|YP_003271434.1| peroxidase-like enzyme [Gordonia bronchialis DSM 43247]
    MTSTTPLRISRLRVPTDDELSPSVAAVFAQTEKQPGFIPNWLRGFALDEGHFERLNAYLFPLVQGDPAVPSSLTRREREI
    LATVVSVRNGCAY
    CHALHVHELAEFLGDAWLAHRISLDHREVPELSDREQALIELALTVTDEPGGVSDAEIDALRGFGLS
    DADIFETVQITSVFNATNRISLALGLLPDPEIFDGDHAGAHT

    >gi|262200227|ref|YP_003271435.1| peroxidase-like enzyme [Gordonia bronchialis DSM 43247]
    MCLNWTSCPTNCGRNWSPSATSSATSPTGRAFSLGGAHAARFNDYILGLLDPNGGLLPYVDREILATVTSAENKCSYCRL
    NHAGHLGAALGDNKLGTRIAIDFREVRELSPRHRILARFASKLSLHPGEVDDADIDELRDLGLSDEEIFEAVHVISAFAA
    ANRFSIFLQVTPDDQFFN

    >gi|262200487|ref|YP_003271695.1| peroxiredoxin, Ohr subfamily [Gordonia bronchialis DSM 43247]
    MAIEPAYRISSKASGGGRDGEVVSETGQIDLDLQPPKELGGSGEGSNPEELFSAGYAACFLGALRATSKQAGSPVPDEST
    VKVTIGIGKDPADGGFGLTADIEVYIPGVDEAKAQELADGAHAF
    CPYSKATRGNIAQTVSVSV

    >gi|262200523|ref|YP_003271731.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Gordonia bronchialis DSM 43247]
    MVALIVAIWPRGDDPAPSQSGSPVASGPRATDAPVSDDELAAARRDAAINPCPATGGVPGPDAVLAGITVPCLATGAPID
    VGAATAGRPLVINIWATW
    CLPCRKELPYFEEFAQRAGDRVTVLGVHAAEGASSPVLVLKFLAENGIHLPSVLDTKGAVSA
    ALGAPPVFPSTILVRPDGTVAKVLPILFHSPDQIAAAVAENLGVTV

    >gi|262200578|ref|YP_003271786.1| glutaredoxin-like protein NrdH [Gordonia bronchialis DSM 43247]
    MSITVYTRPSCGPCRATKAALDKARLEYDVVDISQDDAARDYVMALGYLQAPVVVAGDQHWSGFRPERIRKLAAVA

    >gi|262200747|ref|YP_003271955.1| dihydrolipoamide dehydrogenase [Gordonia bronchialis DSM 43247]
    MAEHFQTVVLGAGPGGYVAAIRSAQLGMKTAVIEEKYWGGVCLNVGCIPSKALLRNAELAHIFNHQAKTFGITGEVAFDF
    GAAFDRSRKVSEGIVKGVHFLMKKNKITEIDGYGKFKDAKTIVVGDREITFDNVIIDTGSTVKLLPGVELSDNVVTYETQ
    ILTRELPESIVIVGAGAIGMEFGYVLANYGVDVTIVEFLDRVLPNEDADSSKAVAKEYKKLGVKMMTSTKVQSVTDNGDS
    VTVTYKDAKDNDGELTVDKVLMSVGFAPRVEGFGLENTGVELTDRGAIAIDDFMRTNVEGIYAIGDVTAKLQLAHVAEAQ
    GVVAAETMAGAETMTLGDYRFMPRATFCQPQVASFGLTEAQAKDEGYNVKATTFPFSANGKAQGLGETTGFAKLITNADT
    DELLGGHLVGDNVSEMLPEMTLAHKWDLTAKELARNVHTHPTMSEALQETFHGAIGHMINL

    >gi|262200799|ref|YP_003272007.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Gordonia bronchialis DSM 43247]
    MNSDTCDVTSCEVAIVGGGPAGLAAATALARSLRSVVVVDAGEPRNAPAAGAHNVLGHEGIAPRDLLAAGRAELAAYGGI
    LRTDRVRTVTRDDDGFALSLASGEQLHARRLILATGLVDELPDIPGVAALWGTDVLH
    CPYCHGWEVRGKRIAVIATNAMV
    AHQALLFRQLSEHVSVIAHAMPSLPEADAARLAARGIDIVDAAVDHLDVVVDNDGTARLGGVVLADGSTLAADAVVVAPR
    FVARTDLYEQLGGTASPHPMGGTFIETGVMGQTAVPGVWAAGNTADLAAMVTVSMGAGVQAGAAVNADLVAQDADALVTA
    MTTR

    >gi|262200837|ref|YP_003272045.1| hypothetical protein Gbro_0839 [Gordonia bronchialis DSM 43247]
    MTGPQITITYCTQCNWLLRASWMAGELLNTFGTELGSVTLVPGTGGVFHIDVDGTQVWERKRDGGFPDVVTLKKLVRDVA
    LPDWNIGHADRADES

    >gi|262200843|ref|YP_003272051.1| Peroxiredoxin [Gordonia bronchialis DSM 43247]
    MSPERGPVLLVNLPLALCDVSNVKDIPVTALDGSALNLTDFTGPLLVVNVASKCGLTPQYTGLEELAKTYGDRGLTVVGM
    PCNQFMGQEPGTAEEIATFCSTSYGVTFPLLEKADVNGDDRHPLYAELTKATDDSGEAGDVQWNFEKFLVNADGEVVNRF
    RPRTEPTDPAVVSAIESVL

    >gi|262201031|ref|YP_003272239.1| Redoxin domain-containing protein [Gordonia bronchialis DSM 43247]
    MAVLALLLAVVVAVTGACGTGDDAVAQGDTFQFVSPGGKTVITYDPADRKPIGPVSGENLLGGAPLSITDPRYANKVVVI
    NAWASW
    CGPCRSEYDDLEQVYDRYRTQGVDFLGINLRDDRQSAEDFVTDRHVGYPSIYDYPGATVGDLGIPLPVLPVTVI
    LDREHRPAVVFIKSITAEELGAQVARVVAEDGSARP

    >gi|262201502|ref|YP_003272710.1| arsenate reductase [Gordonia bronchialis DSM 43247]
    MDATIYHNPKCSTSRKALQKLREHGVEPTIVKYLDEPFTRTQLEKLFAAAGLTPSQAVRKREALYKELDLASASDEQILD
    AMVAHPILVERPFVVTDKGTRLTRPMENLDEIL

    >gi|262201596|ref|YP_003272804.1| hypothetical protein Gbro_1641 [Gordonia bronchialis DSM 43247]
    MNESRPIPDGATPDGARNLLSASSSPYLRQHADNPVHWQEWGADALAQARRRDVPILLSVGYAACHWCHVMAHESFEDAD
    TAAQMNADFVCIKVDREERPDIDAIYMSATVAMTRQGGWPMTCFLTPAGEPFYCGTYFPPSPRPGMPSFRQVMAAVTEAW
    TQRRTEIDAMASKVREHVEANASALPPGTLAVDEKLLAHAVTAVLGDEDRAAGGFGGAPKFPPSALLEGLIRHTEVTGDQ
    AALAAARRTCDVMARGGIHDQLGGGFARYAVDNDWVIPHFEKMLYDNAQLLRVYAHLARRTGDLLARRVTGEIVDFLDRD
    LRVAGGFASSLDADTEGVEGSTYVWTPEQLTAVLGDDDGRWAAELFAVTADGTFEHGTSTLQLRTDPDDAQRFDSVRARL
    RVARASRAQPARDDKVVTAWNAMAITALAEAGAGLGEPAWIDHAVWCAEQILDTHVVDGAVRRSSLGGTIGVPAGGLDDH
    AALATALLTLFTVTGDTDWRTAGLGILDRAIDVFADRDEAGSWYDAAGDGLIARPRDPVDGATPAGASLMAEALLLASGL
    AGVDDAARYTELLDATLARGAVLLAKLARSAGHWLAVAQARVAGPMQIAVAQASRSDGKLARAARELAAGGTIVVVGEQD
    SQPLLDSRGPVDGRDAAYVCRGNVCGLPVTALDQLADAVLTAPSSTGSRPPDPPDE

    >gi|262201615|ref|YP_003272823.1| alkylhydroperoxidase like protein [Gordonia bronchialis DSM 43247]
    MSPRPKVPTRMWIPADNPEVYKALVALQRASSTGLPAELGELVKIRASQINGCAYCLHMHTSDALTMDIDPRKLMMVATW
    REATGIFDERERAALGLTESLTRVADDGVPDEVFATAREYFDDHELGQLVASIAMINTWNRIAIAGGYPAGLDERRSRDV


    >gi|262201735|ref|YP_003272943.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Gordonia bronchialis DSM 43247]
    MTKIVIIGGGPAGYEAALAAAAYGADTTVIDSDGIGGACVLWDCVPSKTFIASTGIRTEVRRAVDLGINLSTDDALVTLP
    QIHQRVRDLAFAQSADIRSRLISEGVTLVSGSAQLEPTQVGVSTHRVLATLSDGTTQSFDGDVVLIATGASPRILPGAQP
    DGERILTWRQLYDLEDLPEHLIVIGSGVTGAEFVHAYTELGVKVTLISSRDRVLPHEDEDAALVLEEALAERGVELVKHA
    RADKVERQGDSVTAHLADGSTVTGSHVLMTVGSVPNTTDLGLDRAGVETDKGGYIRVDRVSRTSVTGIYAAGDCTGLFPL
    ASVAAMQGRIAMYHALGEGVSPIKLKTVASAIFTRPEIATVGVSQKAIDAGEYPARTVMLPLATNPRAKMSGLRRGFVKI
    FCRPATGVVIGGVVVAPNASELILPIALAVQNKLTVGDLAQTFSVYPSLSGSVTEAARQLVRHDDLD

    >gi|262201776|ref|YP_003272984.1| Rhodanese domain-containing protein [Gordonia bronchialis DSM 43247]
    MSVETDPNPAFAEYAHPERLVSTQWLSAHLGAKGLKIVESDEDVLLYDIGHIPTAQKIDWHLHLNDPVTRDYINGEQFAE
    LMRSKGIERDDTIVIYGDKSNWWAAYALWVFTLFGHEDVRLLDGGRDAWMAEDRDTSFDVPEYPRSDYPVVERDDSRIRV
    FAADVLAALGTEPLVDVRSPQEYTGERTHMPDYPEEGALRGGHIPTAISIPWAKAAAPDSRFRSRAELDEVYGDLDADTP
    TIAY
    CRIGERSSHTWFVLTHLLGFTDVRNYDGSWTEWGNAVRVPIAVGTEPGSPPGSNSGSAQR

    >gi|262201893|ref|YP_003273101.1| Thioredoxin domain-containing protein [Gordonia bronchialis DSM 43247]
    MSGAVDLAGLKARAEAQRAQAGGGPGGVPSSPPVPDRPQSTPASAPGTAAAGAAVIDVTDASFEDDVLNRSTAQLVLVDL
    WAEW
    CGPCKQLSPVLEKLANASGGRWVLAKVDVDANQRVAQAFRVQSIPMVVAIVHGQPVAAFNGVRSEAEITAWIDEIL
    AQVGDSLTGVPGPAAEPEPEDPRMVAAEEKMNAGDFDGALADYRAIAESEPDNTEAASAARNLEFVLRAQAHDPAIVQTA
    APGDVDAQLAAADVLLLSQQPEEAFDRIIGVVKATSGDDRTRARTRLLELFELFDPAEPFVVAARRKLASALY

    >gi|262201935|ref|YP_003273143.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Gordonia bronchialis DSM 43247]
    MAATNRLSVGDNAPQFTLPDAHETPVSLSDYAGRKVIVYFYPAASTPGCTKQACDFRDNLAELEDSGIAVVGISPDRPVK
    LQKFAEAQGLTFPLLSDPDKKVLTEWGAFGEKKLYGKTVTGVIRSTFLVDEDGTIALAQYNVRATGHVLKLRRDLSV

    >gi|262201976|ref|YP_003273184.1| DSBA oxidoreductase [Gordonia bronchialis DSM 43247]
    MSDRVDFWFDPLCPWCWITSRWILEAEQVRDIDVNFHIMSLAVLNEGKDIPEEYREGLKHAWRPVRVLAAAAAANGDEIL
    APLYTAMGTRIHNEGNKDFDDVIAGSLAELGLDAGLAAAADGDEFDDAIRTSHHAGMDKVGDDVGTPTIHVNGVAFFGPV
    LSRIPRGETAGTVWDGAVALSSYPHFYELKRTRTEDPAFD

    >gi|262202064|ref|YP_003273272.1| mycothione reductase [Gordonia bronchialis DSM 43247]
    MSETQIVDLAIIGSGSGNSIPDDRFAGTSIAIFEEGVYGGTCLNVGCIPTKMFVYAAEVAEIARHSARLGVHAHVDSVDW
    PAIVDRVFGRIDPLSAGGKEYREDRCDNITVYSAHVEFDGRDEQGRYRLVTADDVVLAREVVLAAGSRATVPSAIADSDV
    TYHTNNDVMRLSALPEHLVIVGSGYIAAEFAHVFGALGSRVSIVARGGRLLRKLDDDVSVRFTELAGDRWDLHLNAQVSG
    AADRPGGGVCLALDDGTELEADALLVATGREPNGDRLNLDSVGIELDAEGRVVCDAHGRTAARGVWTLGDVSSPYQLKHV
    ANHEERVVQENLLKGWDATDLVSFDHRYVPAAVFTHPQIAYVGMTEAQARDTGRDITVKVQAYGDVAYGWAMEDTSGFCK
    IIAERGTGELLGCHIIGPQAPTVIQPVIQAMHFGLRATDMARGQYWIHPAMPEVLENALLGLEI

    >gi|262202162|ref|YP_003273370.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Gordonia bronchialis DSM 43247]
    MALLTIGDQFPAYNLTAVIGGDLSKVNASQPDDYFTTVSSDDHPGKWRIIFFWPKDFTFVCPTEIAAFGKLNDEFADRDA
    QVLGASVDNEFVHFQWRAQHEDLKTLPFPMLSDLKRELASAAGVLNADGVADRATFIVDPNNEIQFVSVTAGSVGRNVDE
    VLRVLDALQSDELCACNWRKGDPTIDAGELLTASV

    >gi|262202200|ref|YP_003273408.1| methionine-R-sulfoxide reductase [Gordonia bronchialis DSM 43247]
    MGNMTSDNRAELADLTDEQWKERLTPAEYRVLRQAGTEAPFTGEYTDTTTIGVYRCRACDAELFRSEQKFESHCGWPSFF
    SPLAGDAVVERADDSMGMRRTEVLCANCGSHLGHVFAGEGYDTPTDLRY
    CINSISLTLEPAGPPDA

    >gi|262202383|ref|YP_003273591.1| tRNA (adenine-N(1)-)-methyltransferase [Gordonia bronchialis DSM 43247]
    MPTSGPFAIGDRVQLTDAKGRKFTVHLEAGKLFHTHRGAIAHDDLIGAPEGSIVAATSGTQYLALRPLLVDYVLSMPRGA
    QVIYPKDAAQIVVEGDVFPGARVLEAGAGSGALTCSLLRAVGESGEVVSYEIRSDHAEHAVRNVETFFGGRPDNWNLVVE
    DLARLPTDERFDRVVLDMLAPWEPLDVVRTVLKPGGVVTIYVATVTQLSRIVEALREQE
    CWTEPRAWESLVREWSAVGLA
    VRPEHKMQGHTAFLVTARRLADGTTTLRPQRRPSKG

    >gi|262202516|ref|YP_003273724.1| heavy metal translocating P-type ATPase [Gordonia bronchialis DSM 43247]
    MTTSAPIHPPAATAEQTGAVDVELAVSGMTCASCAARIERTLNKLDGVSASVNYATEKAHVSAPAGVDPHLLIETIEQAG
    YHAALPATPTKGAAPDDDPSDDDGELVALRHRLIGAVVLSVPVIALAMVPTLQFTYWQWASLTLAAPVIVWAAWPFHRAA
    LLNLRHGAATMDTLISVGTTAALLWSLYALFFGTAGQPGMTHGFTLTVSASDGAGNIYLEVAAGVTMFVLAGRYFEKRSK
    RQAGAALRALLELGAKDVTVIRDGHQHRIPIGELAVDDEFIVRPGEKIASDGVVVSGTSAVDASMVTGESMPVQVAPADT
    VTGGTVNAGGHLRVRATRVGADTQLAQMAAMVERAQTGKAHAQRLADRISSVFVPVVIAVAIAVLGAWIGAGYPLQAAFT
    AAVAVLIIACPCALGLATPTALLVGTGRGAQLGIVIKGPEVLESTRTVDTVVLDKTGTVTTGQMTLVQVTTAPSTTREDV
    LALAGAVENASEHPVAAAIAAGAAAEVGPLDEVDDFRNFEGRGVRGLVQGRVVTVGRPTLLAEHGIAVDDPHLNEAQTAA
    EEAGQTAVLVAWDGRAHAVLAVADAIKPTSAHAIARLAALGMTPILLTGDNQTVADAVAAEVGIDTVIANVLPANKAAVI
    TDLQSDGKVVAMIGDGVNDAAALAHADLGLAMGTGTDAAMHAADITLVRGDLNAAADAIALARTTLKTIKMNLFWAFAYN
    VAAIPLAALGLLNPMLAGAAMALSSVFVVSNSLRLRAFTSPPHSSSTTPSTNPSTYTPQGYKVTV

    >gi|262202518|ref|YP_003273726.1| Heavy metal transport/detoxification protein [Gordonia bronchialis DSM 43247]
    MSTSTVIVSGMTCGHCASSVREEVGALAGVTDVEVDVASGQVTISSSAPIEPDAIRVAVEEAGYHLAQ

    >gi|262202534|ref|YP_003273742.1| heavy metal translocating P-type ATPase [Gordonia bronchialis DSM 43247]
    MTQTIDCADRRVRQIQLDIEGMTCGACANRIERKLNKIDGVRASVNYATHRATIDIGSDIDVGEAISTVDRAGYTATPHV
    PHLSRIDPDTAHAEGLLRRLIIAVVLFIPLADVSVVLSVIPELRFPGWQILLIVLAAPIVTYCAWPFYRTALRTGAATME
    TLVSIGVLAASGLSLYSMFATPSTAPTEPGVWAAIAASDSIYLEVAAGVTVFVLAGRYFEARARARAAESMRSLAALRAT
    DAHILLADGTEMSLPTEELKVGHTVIVRSGQTIPTDGDVVDGRASVDASMMTGENAPIVAEPGARSAVVGGTVCLEGTLV
    VSATAVGDDTRLAEMIRLVDQAQLTKARAQRVADRVATLFVPAVVALSAVTAAAWLSTGGSLEHALSAAVAVLVIACPCA
    LGLATPMALMVAAGRGAQLGIFLKGHQALELSGRIDTVLLDKTGTITTGVPCIHDIVVSTDISAREALRLAASLEQHSEH
    PIARALTSAAQDTPLEDCLEFSAEVGRGVRGIINGTEVSLGSPTWVTDRATVSEELVRSYRDFERAGHTAVCLAIGQVAV
    AVIAVTDEVKPSAHTAVTALRRRGVRTLLVTGDNHGAAHAVADEVGITEVVAEVLPAAKADIVNTLRRGGACVAMVGDGI
    NDGPALATADLGVAMGRGTDIAIGAADIVLMRSNLLGVVQALDLARATQRTIRVNLVWAFGYNIAALPVAAAGLLNPLIA
    GAAMGLSSLFVVTNSLRLRRFGADRSTERRPARA

    >gi|262202540|ref|YP_003273748.1| Redoxin domain-containing protein [Gordonia bronchialis DSM 43247]
    MQQGIRLSAARAAVLALICVVPWVASGCAGDDAVAQGGTFQFVSPGGLTVITYDPPASRQSIAQVSGPDVVTDQNIGLDD
    FAGKVVVINVWGSW
    CGPCRGEADDLEYVYEQTKASGVEFLGINLRDNRQAARDFIVDRKVAFPSIYDFAGVTLAALTTPT
    SVVPTTIVLDREHRPAAVFLKAITADELGTTVKRVVAEPTAQQQ

    >gi|262202544|ref|YP_003273752.1| DSBA oxidoreductase [Gordonia bronchialis DSM 43247]
    MSRNVRMSLAAVFVFCLALTVVFVVSRAGESEQSGDQASMTARPDSPRLSAPAESKATFVEFLDFECEGCGAAYPAVEQL
    RQTYGDQVTFVVRYFPLPGHFNADRAARAVAAAAEQGQFEPMYRKMFDTQRSWGEQRVPLDDLFFSYARELGLNMERFAA
    AYDSQATRELIDRDVADGKALGVTGTPTFFINDERIKPEGYDDLSSALESAIRQ

    >gi|262202564|ref|YP_003273772.1| mercuric reductase [Gordonia bronchialis DSM 43247]
    MATTQSRPDLAIVGSGSAAFAAAIAAVGHGRSVVMIERDTVGGTCVNVGCVPSKTLLAAAEARHAAAAADRFPGLGAAAV
    PLDFPGLIAGKDALVAQLRANKYIELAGEYGWEIVSGTAVFDGTSAAPGLRVGANDGGTRVIEAGHYLIATGATPWIPPI
    DGLVEAGYLTSTTAMDLKRLPESLIVIGGNTVGLEQAQLFARLGTRVTVIEALGRLAPGEEPEISAAIEAVFADEHIAVL
    TAATVEKVLAGGGHKLVSVRTRAGVSELRAEHVLVATGRRPNTAGLGLEAVGVGVDGRGAVIVDDRQRTGNARIWAAGDV
    AGGPQFVYVAAAQGTLVADNAFADADRVLDYATVPRLTFTSPAIAAVGLTEAEAVTAGYRCRCRTLALSSVARALVNRDT
    RGLAKIVADADTGRILGVHALAEGAGDLITAAGYAMTAGMTVDRLAHSWAPYLTMAEALKLTAQTFTTDVTKLSCCAG

    >gi|262202577|ref|YP_003273785.1| DSBA oxidoreductase [Gordonia bronchialis DSM 43247]
    MSRNVKMSLAAVFVFCLALTVVFVVSRAGEGEQSGDHASMTARPDSPRLSAPSESKATFVEFLDFECEGCGAAYPAVEQL
    RQTYGDQVTFVVRYFPLPGHFNADRAARAVAAAAEQGQFEPMYRKMFVTQRSWGEQRVPLDDLFFSYAQELGLNMERFAA
    AYDSQATRELIDRDVADGKALGVTGTPTFFINDERITPEGYDNLSSALESAIRQ

    >gi|262202584|ref|YP_003273792.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Gordonia bronchialis DSM 43247]
    MQQGIRLSAARAAILALICVVPWVASGCAGDDAVAQGGTFQFVSPGGLTVITYDPPTSRQSIAQVSGPDVVTDQTIGLDD
    FAGKVVVINVWGSW
    CGPCRGEADDLEYVYEQTKASGVEFLGINLRDNRQAARDFIVDRKVAFPSIYDFAGVTLAALTTPT
    SVVPTTIVLDREHRPAAVFLKAITADELGTTVKRVVAEPTAQQQ

    >gi|262202956|ref|YP_003274164.1| iron-sulfur cluster assembly accessory protein [Gordonia bronchialis DSM 43247]
    MTVQNESGAATSTGVILTDAAASKAKALLDQEGRDDLSLRIAVQPGGCAGLRYQLFFDDRSLDGDVISDFGGVSLAVDRM
    SAPYVQGATIDFVDTIEKQGFTIDNPNATGSCACGDSFN

    >gi|262203007|ref|YP_003274215.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Gordonia bronchialis DSM 43247]
    MSDSASPSAPDRAAVGSSAPGFELRDQNHQVVSLDKLRADRAVLIVFFPLAFTGTCQGELGYIRDHLPRFDNDAVTTVAV
    SVGPSPTHKVWSSAQGFLFPILSDFWPHGEVARAYGVFNEQQGIANRGTFVVDRDGTVVFSDMVGPGEVREADLWDKALA
    ALD

    >gi|262203180|ref|YP_003274388.1| glutaredoxin-like protein NrdH [Gordonia bronchialis DSM 43247]
    MAITVYTKPACVQCNATYKALDKLGLSYEVVDISEDAEARDYVMALGYLQAPVVVVGDEHWSGFRPDRIKALAAQVA

    >gi|262203279|ref|YP_003274487.1| methylated-DNA/protein-cysteinemethyltransferase [Gordonia bronchialis DSM 43247]
    MTATELDDTATGSDTRARTADWVTLSTPDGPFTVIADDAGRVLASGWTDDPGYLAVLVSPSLRPATLRAGRDLSAITDAV
    TAYYDGDHEAPDAVEVVQRSGPFLERAWEALRTVRPGEPVTYTALAALAGGPLAVRAAASSCARNAAALFVP
    CHRVLRSD
    GTLGGFRYGLEIKQSLLNREALDREA

    >gi|262203287|ref|YP_003274495.1| Rhodanese domain-containing protein [Gordonia bronchialis DSM 43247]
    MSTPKIVLFYVFVPLPDPEAIRLWQLSVCSSLGVRGRIIVSRHGINSTVGGDIGQVKRYVRATREYPGFADADIKWSDGT
    GDDFPRLSVRVRPEIVTFGVPDEVKVDDDGVVDGGTKLTPAQVHELVERRDDVVFFDGRNEIEARVGRFAGAVTPPAQTT
    RDFVPLLDSGAYDHLKDRPVVTY
    CTGGVRCEVLSSLMRLRGFREVYQLDGGIVRYGQEYGDDGLWEGSLYVFDNRMSVDF
    SDHAKVIGTCSECGEPTSHIANHPDHVGRELAVICPDCYAR

    >gi|262203375|ref|YP_003274583.1| glutaredoxin-like protein [Gordonia bronchialis DSM 43247]
    MSNVIDDEAGARTSDTGELTMYTTSWCGFCARLKTGLKQNGISWQEIDIELNPDAAEFVGSVNGGNHVVPTVLYADGTTA
    TNPSIADVKAKLGV

    >gi|262203388|ref|YP_003274596.1| UBA/THIF-type NAD/FAD-binding protein [Gordonia bronchialis DSM 43247]
    MSSQSGSLPPLVEPAAELSNDEVARYSRHLIIPDVGMDGQKRLKNARVLVIGAGGLGSPTLLYLAAAGVGTIGIVEFDVV
    EESNLQRQVIHGQSDIGRPKAESARDSIREINPYVTVNIHDQRLEPEGAIELFSQYDLILDGTDNFATRYLVNDAAVLAH
    KPYVWGSIYRFEGQASVFWEDAPDGRGINYRDLYPQAPPPGMVPS
    CAEGGVLGILCASIGSIMGTEAIKLICGIGEPLLG
    RLMVYDALDMTYRTIRIRKDPEGERIAGLIDYEEFCGVVSDEAASAAVGSTLTAVELKEKLDAGENLALIDVREPVEWDI
    VHIDGATLIPKGDILAGAGLAEIPQDRPTVLY
    CKTGVRSAEALAALKRAGFADAKHLQGGVTAWANQVDKELPVY

    >gi|262203453|ref|YP_003274661.1| selenide, water dikinase [Gordonia bronchialis DSM 43247]
    MTITREVRPRLTGYAHGGGCACKIPPGELEAAVAGLTGQTGDHILVGLDDGDDAAAVRIRDDLAVLSTADFFTPVVDDAY
    DWGRIAAANALSDIYAMGGDPVVAINLVGWPRDVLPMELMTEVLRGGLDVGTAAGCPVIGGHSIDDPEPKYGMAVTGTAH
    PDRLIRNDAGQAGLPITLTKPIGVGLLNNRHKQTGDVFEAAIELMTTLNRDASSAALAAGVRAGTDVTGFGLLGHLHKLC
    RASEIGAVIERSAVPTVEGALDALRDGYVSGGTRRNLDWVRPHLESSPGVTDDDLLLLADAQTSGGLLLIGEVPGYPVIG
    ETVVGQGISVR

    >gi|262203796|ref|YP_003275004.1| Thiosulfate sulfurtransferase [Gordonia bronchialis DSM 43247]
    MARSDVLVSADWAEQNLNTDGVVFVEVDEDTSAYDGGHIAGAVKLDWKTDLQDPVRRDFVDAEQFSKLLSERGIANDDTV
    VLYGGNNNWFAAYAYWYFKLYGHNDVKLLDGGRKKWELDGRPLSTDAVSRPATSYKAGEPDNTIRAFRDEVVADIGVKNL
    VDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSKAANEDGTFKSDEELKELYTEAGLDGSKDTIAY
    CRIGERSS
    HTWFVLKELLGQQNVKNYDGSWTEYGSLIGVPIELGEGK

    >gi|262203827|ref|YP_003275035.1| alkylhydroperoxidase like protein [Gordonia bronchialis DSM 43247]
    MRVVDRTRGFVRAFGSARRHRSDLVGWLGRRPQVLVGTGVYESALLFSNALDPKLKELAELKTAGLVGCEFCLDIGSALA
    RSSGVTEAQMRDLPVFADSAAYDDLEKLVLAFAAAMTATPAVADDLARIRDELAQHLSKKQITELAATIAWENQRARLNQ
    GLGVRPTGMSDGAACALPETRPAVG

    >gi|262203954|ref|YP_003275162.1| hypothetical protein Gbro_4105 [Gordonia bronchialis DSM 43247]
    MADDIRFYFDPVCPFAWMTSKWVRQVQAQRDYSVDWRFISLRLLNAHIDYASHFPPEYEAGHTAGLLLLRAATSIRREHG
    RAPLGPLYQAFGTRIFEQHNGTYLVDGTDFRGTEGFLGPILDELGLPRQHIAALDDESLDTEIQAETDEALALTGRDVGT
    PIIHFEPPEGVAFFGPVISRLPDDEHAAQLWDHVIGLARFPGFAELKRSLREKPQLKAFGVDADETGEQEDWHGGSRRTK
    H

    >gi|262203964|ref|YP_003275172.1| Peroxiredoxin [Gordonia bronchialis DSM 43247]
    MPRRVGSAVSVPSGTGLGTTNGALVTTAYDFTATDIDGNPVDLERYRGHPLLIVNTASKCGFTPQYEGLEKIHREYADKG
    LVVLGFPCDQFAHQEPGDEEEIKNFCSLTYDVTFPMFAKVDVNGGDAHPLYQWLRQQKSGLLGSRVKWNFTKFLVDKSGA
    VVGRFAPTVKPEKMTGDIDKVL

    >gi|262203969|ref|YP_003275177.1| methylated-DNA/protein-cysteinemethyltransferase [Gordonia bronchialis DSM 43247]
    MTDDRHAIIDTTLCSIALAASGENLVGLAFELDGHYSAGATIGPVVDSAHDPLLRAAHTQLTEYLTGDRRDFDLPLATHG
    DAFSEQVWALLREIPYGETTTYGAIATALGNPRFAQRVGQVVGRNPIGIIIP
    CHRVIGADGTLTGFGGGLDRKRRLLDLE
    EPAERRAERLF

    >gi|262203992|ref|YP_003275200.1| DSBA oxidoreductase [Gordonia bronchialis DSM 43247]
    MSVTVDIWTDINCPFCYLGKKRFLDALDGFDHRDDVHVMHRSFELDPTLGPEDTGSVEQHIAGKYGISVEQARANEDRIG
    AQAAEIGLPYQTRGRDFGSSFDMHRLLHHALAAGRQDELLDALYDANFGTPEPLFGDRERLVAVAVAAGLDETDVRRVLA
    DPDVHAEAVRRDEQQAAALGVTGVPFFVIGGKYAVSGAQPTEVFGRALQMAWADQPTLVDVSADDATTCGPDGCEIPAAR
    S

    >gi|262203993|ref|YP_003275201.1| Rhodanese domain-containing protein [Gordonia bronchialis DSM 43247]
    MADVLVTATDLAELMLSPTPPVILDVRWQLGDDDGRQHYRDGHLPGAIYVDLDSELAAPPAGAAGGRHPLPAVDDLQAAA
    RRWGIDDDVTVVVYDDYGNLAAARAWWLLRWAGITDVRMLDGGLGAWRAAGLRTAQGDGGIARAGSVTLRPGQLPVADID
    EVADSTAVLLDVRAAERYRGEVEPVDPRAGHIPGARNAPTTANLDADGYFRPAGELRKLFSEVGVDEGSDVIAY
    CGSGIN
    AAHAVAALEIAGVRARLFPGSFSQWSSDPDRPVETSTETPPAG

    >gi|262204047|ref|YP_003275255.1| peptide methionine sulfoxide reductase [Gordonia bronchialis DSM 43247]
    MTTDTGQITRRPGTETAVLAGGCFWGMEDLIRRQPGVLDTRVGYTGGTNEHATYRNHPGHAEAVEIVFDPAVTSYRDILA
    FFFQIHDPSTRDRQGNDVGSSYRSAIFPLDDEQERIARDTIADVDASGLWPGKAVTTIEPAGPFWEAEPEHQDYLLRYPN
    GYTCHFPRPGWVLPKRQSV

    >gi|262204048|ref|YP_003275256.1| methionine-R-sulfoxide reductase [Gordonia bronchialis DSM 43247]
    MSNEYRKTTEAVSRLTDDQYRVTQRDGTEPAFANEYWDNHEPGLYVDVVSGQPLFSSTDKFDSGTGWPSFTRPVEPDAVT
    TKTDRTLWMKRTEVRSSGADSHLGHVFDDGPREAGGQRY
    CMNSAALRFIPLTELEAEGYGAYRDLITGHTTDTQEDAS

    >gi|262204070|ref|YP_003275278.1| Heavy metal transport/detoxification protein [Gordonia bronchialis DSM 43247]
    MSTSTVIVSGMTCGHCAASVREEVGALAGVTDVDVDVASGRVTISSSAPIEADAIRGAIEEAGYHLAQ

    >gi|262204072|ref|YP_003275280.1| heavy metal translocating P-type ATPase [Gordonia bronchialis DSM 43247]
    MTTSAPIHPPAATAEQTGAVDIELAVSGMTCASCAARIERTLNKLDGVSASVNYATEKAHVSAPAGVDPHLLIETIEQAG
    YHAALPATPTKGAAPDDDPSDDDGELVALRHRLIGAVVLSVPVIALAMVPALQFTYWQWASLTLAAPVIVWAAWPFHRAA
    LLNLRHGAATMDTLISVGTTAALLWSLYALFFGTAGQPGMTHGFTLTVSASDGAGNIYLEVAAGVTMFVLAGRYFEKRSK
    RRAGAALRALLELGAKDVTVIRDGHQHRIPIGELAIDDEFNVRPGEKIASDGVVVSGTSAVDASMVTGESMPVQVAPADT
    VTGGTVNAGGHLRVRATRVGADTQLAQMAAMVERAQTGKAHAQRLADRISSVFVPVVIAVAIAVLGAWIGAGYPLQAAFT
    AAVAVLIIACPCALGLATPTALLVGTGRGAQLGIVIKGPEVLESTRTVDTVVLDKTGTVTTGQMTLVQVTTAPSTTREDV
    LALAGAVENASEHPVAAAIAAGAAAEVGPLDEVDDFRNFEGRGVRGLVQGRVVTVGRPTLLAEHGIAVDDPHLNEAQTAA
    EEAGQTAVLVAWDGRAHAVLAVADAIKPTSAHAIARLAALGMTPILLTGDNQTVADAVAAEVGIDTVIANVLPADKAAVI
    TDLQSDGKVVAMIGDGVNDAAALAHADLGLAMGTGTDAAMHAADITLVRGDLNAAADAIALARTTLKTIKMNLFWAFAYN
    VAAIPLAALGLLNPMLAGAAMALSSVFVVSNSLRLRAFTSPPHSSSTVPPTNPSTYTPQGYKVAA

    >gi|262204258|ref|YP_003275466.1| thioredoxin [Gordonia bronchialis DSM 43247]
    MGSDKVKCPHCGKVNKVPAAGDGRPRCGNCHEPLPWIASAGDGDFAEVAEKSSVPVLVDLWATWCAPCRMVSPALEQLAT
    ERAGQIKLVKVDVDAAPQTAERFTVRAVPTLLVMDRGEVLARQAGAAPVPQLRTWLDQALSENAGKEAKP

    >gi|262204307|ref|YP_003275515.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Gordonia bronchialis DSM 43247]
    MDTYDVVVIGGGPAGENAADYAIRGSSRTAVLVEHELLGGECSYWACMPSKALLGPGAALARASGLPGAAERLAGTAPDV
    RAVLGWRDEVTGGRDDAGQASWARSANIEVIRGGARIVGEREIEVCDRRLRARHAVVVATGSTASIPPVSGLAQARPWTS
    RDATNLTEVPGRILVLGGGVVGCEAATWLTDLGSAVTMAVRGSRLLPNAEPFVSEQIADGLTARGVDVRFGTQIVAVERP
    DAADTGYGRRHGGPARITLDGPDGTAEVTVDEILVAAGRRPATAGLGLATVGLEDGAAIAVDDHLTVPGTDWLYAVGDVN
    GRNALTHMGKYQARVAGEVIAARAEGRAITGDRYAASADHHAVPQVVFTRPELGSVGRTERQARADGIDVLIAETDIAVA
    GSYLLGPDYRGHAKLVVDRDRGVVVGASFLGASTGELVHAATIALVGEVPVDRLWHSVPSYPTVSEVWLRLLEQIHPKLV


    >gi|262204364|ref|YP_003275572.1| heavy metal translocating P-type ATPase [Gordonia bronchialis DSM 43247]
    MSTESLAIDLDIDGMTCASCANRIERKLNKIDGVTASVNYATERAHVQVPDGVGTDELIDVVRAAGYDAAPVDDPRAVSP
    PVDDHGQRPDAELDALRQRLIVSAVLSIPVIALAMIPALQFTYWQWLSLTLAAPVVVWGAYPFHRAAWINLRHGATTMDT
    LVSIGTLAAFGWSLYALFLGTAGTPGLTHGFDFLPQRADGSSHIYLEAAAGVTTFLLAGRYFEKRSKRRAGDALRALMDL
    GAKEVSVRRDGRESRIPIGQLAVGDEFVVRPGEKIATDGMVIDGASAVDASMVTGESVPAEVTVGDDVVGATVNTSGRLV
    VRATAVGADTALAQMAAMVTAAQEGKADAQRLADRISAVFVPVVIAISVATLGFWMGVAAQAGMSGGDVTFAFTAAVAVL
    IIACPCALGLATPTALMVGTGRGAQLGILLKGPEVLESTRRVDVIVLDKTGTVTTGDMTVSEIISADGHDETEVLIAAAA
    VESASEHPIAAAIVTAAQDVPVPAVENFTSTQGVGVSGRVNGREIVVTAPDRAPGALDADLAEVVDRAQRRGGTVVVVSA
    DGKPLGAIVVEDRVKASSAAAIVEFRRLGLTPMLLTGDNEGAARHAAQQVGIDDVTAGVSPEGKLGVIKELQSQGHSVAM
    VGDGINDAAALAQADLGLAMGTGTDVAIAASDLTVVSGDLRVVGDAIRLARRTLGTIKGNLFWAFGYNVAAIPLAAAGLL
    NPMIAGAAMALSSVFVVGNSLRLRRFAPNR

    >gi|262204366|ref|YP_003275574.1| Heavy metal transport/detoxification protein [Gordonia bronchialis DSM 43247]
    MATQTTTDYTVTGMTCGHCVASVREEIGEIPGVTGVDVTLDTGAVRVTSDREIDRSQIAAAVAEAGYQLT

    >gi|262204453|ref|YP_003275661.1| Rhodanese domain-containing protein [Gordonia bronchialis DSM 43247]
    MKVRHYLRRPPTIPAADALELVAQGALVVDVRRDFEWNRVRIPSAVHLPLEVLPQRCVELPDDRLLIAFCTGGIRSAGVA
    NLLVENGFDAVNMSGGLIGWRAAGGSLTP

    >gi|262204651|ref|YP_003275859.1| thioredoxin reductase [Gordonia bronchialis DSM 43247]
    MSQTDTQQIHDLIIIGSGPAGYTAAVYAARADLAPIVFEGTQFGGALMTTTEVENFPGFQNGIQGPALMDEMREQALRFG
    ADLRMEDVDAVRLTGEVKEVEVAGEVYRARAVILAMGAAARYLGVEGEQSLLGRGVSA
    CATCDGFFFKDQDIAVIGGGDS
    AMEEATFLTKFARSVTLVHRRDEFRSSKIMLERAKANDKIRFITNATVRKVIGDGSVSGLELEDTRTGETRNLDVTGMFV
    AIGHDPRSELVRGQVDLDSEGYVQVQGRTTYTSIPGVFAAGDLVDHTYRQAITAAGSGCAASIDAERWLAEQGEAADLTV
    VADVTVDAGA

    >gi|262204652|ref|YP_003275860.1| thioredoxin [Gordonia bronchialis DSM 43247]
    MGANTVAVNDTTFKDTVLGSDKPVLVDFWATWCGPCRMVAPVLEEIAGDHADKLTIAKLDVDESPATARDFQIMSIPTMI
    LFENGQPTKTIVGAKGKAALLRELDAVVGTSA

    >gi|262118159|ref|YP_003275929.1| glutaredoxin-like protein NrdH [Gordonia bronchialis DSM 43247]
    MDITVYTKPACVQCNATYKALEKQGLEYSVVDISEDDDARDMVMALGYLQAPVVVAGDESWSGFRPDNIKRLAAKQASAA


    >gi|262202161|ref|YP_003273369.1| alkylhydroperoxidase like protein [Gordonia bronchialis DSM 43247]
    MSIDNLKEALPEYAKDLKLNLSSISRTTALTEEQLWGALLATAAATRNAKVLSEIADEAADTLSAQTYNAALGAASIMGM
    NNVFYRGRGFLDGRYDDLRPGLRMNIIGNPGVDKALFELWSFAVSSINGCGH
    CVAAHENTLREAGVDREAILEALKVASI
    VAGVAQALTTTEVLAGV