Gluconobacter oxydans 621H uid58239

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|58038357|ref|YP_190326.1| hypothetical protein GOX2606 [Gluconobacter oxydans 621H]
    MRSFIPMLMLGLPAVALGASTCPAAEPIRAAGGPPPSRPVPVMPEMGPTLPAADIAASPALARLASQGAQLYRLKSEHGL
    EAVFARSGTQFRVFYLTPDHLAEIGGVMWDATGHNITRDQVSSIPGAIPTVQWNPSGSGPGSRPGAASATTAPPAVDPVE
    RVKAVAFGLEGQDTAPRVYMFIDPL
    CPFSTRAYAALKPAVASGRLQLAIVPVSINDHENKGASTPAAQQMLSAKPHDMAA
    LWNQIDDLGHAVPGHATSDTAGASLMLNLSAAHSIGLRGTPTFVWKDRNGTPHVEAGLPDDLDAFLASLHA

    >gi|58038531|ref|YP_190495.1| glutaredoxin [Gluconobacter oxydans 621H]
    MSKVEIYTQPGCPYCVHAVSLLRSKGIEFQEINAPHGSAEREESIRRSGRRTVPQTFVDGKGLGGCDDLMALDRAGRLDA
    LLGKV

    >gi|58038557|ref|YP_190521.1| thiosulfate sulfurtransferase [Gluconobacter oxydans 621H]
    MTISPLVDAATLISEVGRFIPLDASVLLPGQKGDPAAAFAQRHLPDAQRFDIDVFADPDSPLPHTVPGAARFARLMGALG
    VSEDVPVVFYDGRGSVGACRGWWLARLFGHRNARILDGGLEAWLKAGGPVEEGAASAKEPVLFRTRPRYGLLAGSGDVRL
    ALEREGSFVLDARSAGRFAATVPEPRPGVRSGHMPGAMSMDWTRLVDKSGCFLPAPELKQILGAAAGRSVIAT
    CGSGLTA
    ATIVAAVAIAGYGDAALYDGSWAEWGSDPDAPVVTGEG

    >gi|58038617|ref|YP_190581.1| thioredoxin reductase [Gluconobacter oxydans 621H]
    MPEIHHTDLLVVGAGPAGYTAAIYAARASLKPILVTGMQPGGQLTITTDVENYPGFATPVQGPWLMEQMRAQAEHVGTQL
    VYDLIVQADLKNGPGPDGYFRLVGDSGDEFRARTVVIATGAQAKWLGLESEKRLQRGGVSA
    CATCDGFFYRGKTVAVIGG
    GNTAVEEALYLTHHADKVHLIHRRDSLRAERILQERLFSNPKVEVHWNQVVEEILGTGEPEVVCGVALKDTQTGALSRLD
    VDGVFVAIGHTPNAGPFRHEVACDSDGYILTESDGTGTSVKGVFAAGDIQDRIFRQAVTAAGTGCMAALEAERYLSGIPA
    MTKT

    >gi|58038669|ref|YP_190633.1| putative protein disulfide isomerase [Gluconobacter oxydans 621H]
    MKAFFMRRSLLAAAGLGLALTATLPAHAASTEMTPTPAPQLTETSAPPVATPYPDTTVAHDQVAQAFALAQKTHRKVLLD
    FGGNW
    CPDCKMLSGIFALPDAAHWLDSQFVVVPVNVGRINTNLDLAARYGVTIKAVPTVIIVTPDGHALNGDGSTALGNA
    RSMSPQAVLDLISSWNKRG

    >gi|58038710|ref|YP_190674.1| hypothetical protein GOX0235 [Gluconobacter oxydans 621H]
    MYDMKNLSRISHLEANASKGMDAFWQFDRAAFEEGEVSALTKQLAAVAVALTTQCPYCIELHVKAAREAGATDAQLSEIA
    LVAAAIRAGGAITHATHMFDAK

    >gi|58038803|ref|YP_190767.1| transcriptional regulator [Gluconobacter oxydans 621H]
    MTQSCGPNGQTGGGCGVGLTPEQRRILHEHGTERPGSSPLNDEKRAGIYACAACGRPLFASETKYDSGSGWPSFFQALPD
    GVETTQDSRYGMVRTEVHCANCKGHLGHVFPDGPPPTGLRY
    CMNGLALDFRPAEGEKA

    >gi|58038988|ref|YP_190952.1| hypothetical protein GOX0518 [Gluconobacter oxydans 621H]
    MAASVTIYGIPNCDTMRKARAWLTDHAVAFTFHDYRRDGVDRSRLEGWVARLGWEKLLNRSGTTFRKLAPALREGLDAER
    AIELMLEQPAMIRRPVLEGPGLLLVGFRPDEYVAALSDFSAQDPAP

    >gi|58039044|ref|YP_191008.1| putative peroxiredoxin [Gluconobacter oxydans 621H]
    MNVSTPAESPLPFLRIGDRAPDFSARTTHGEFIMSALRGHWVLLFAHPADFTPVCTSEFIALARSAEEFQKRDCVLLGIS
    ADSLPAHLAWVEAINTQFGIQIPFPIIEDPSLAVARAYGMLDSAAQDSATVRSIFVIDPSGTIRAILNYPATVGRSVPEL
    LRLLCALQEVDRAGALTPESWQPGQPTVAPPLQTQAAVEKAGAKWFFQPMTRERS

    >gi|58039095|ref|YP_191059.1| thioredoxin [Gluconobacter oxydans 621H]
    MSANTVAVSDSSFEADVLKSEGPVLVDFWAEWCGPCKMIAPALEEIGAEYQGRLKVAKVNIDSNPEAPTKYGVRSIPTLI
    VFKDGKPVAQQMGALPKSQLKAWIDQSL

    >gi|58039100|ref|YP_191064.1| thioredoxin reductase [Gluconobacter oxydans 621H]
    MPYPNLFKPIMKQVMTTAPQTLNTDVAIVGAGPTALFAAFECGMLKLSCVLIDALDSVGGQCAALYPEKPIYDIPAHPAI
    EGGALIEALEQQIAPFDVPRLLGSRVETLEGQRGAFTLKTARGDVITAKAVIIAAGAGAFGPNRPPLDGLEAYERTGAVQ
    YYVKKRADFTGKRVVVAGGGDSALDWALSLSEVAAQVYLLHRRDRFRGAPETLSRIEQQIAAGKIEKVVPYQLHALHGTD
    GVLSTVEVTTLEGTSRHIEADALLPFYGLSTDLGPIALWGLDTHRNTVPVTPATLESSTPGIFAIGDVATYPGKLKLILQ
    GFSEGAMAAHAIHAIVHPDTALHFEYSTSKGVPG

    >gi|58039131|ref|YP_191095.1| cation-transporting ATPase [Gluconobacter oxydans 621H]
    MSETISFPVGGMTCAACAARIEKVLNRQDGVKATVNFASERAQVAFENASSSVESVVAAVRRAGFSVDEQSLDLSLSGMT
    CAACAARIEKILNRQPSVQASVNFAAERAHINYIPGVVEPAFLIGKIEKAGFGAARLNEGTREDPKAKRAAIWKRERNRF
    ILTLILSLPLFAEMIGMFFGRMIVPVPLQFLFATIVQFVCGAHLYRRAWNAVRGGSANMDVLVVLGTSIAWLFSAVVVVF
    GLHQHVYFEASASIITLISLGKLMETRAKNKTSAGIESLIQLQPQIAHVERDGVIVDRAVADMHVGDIFVVRPGESVPVD
    GEIIEGSSEINESMLTGESVPVLKEVGNEVFGGTMNANGALRVRATGVGADTALARIVKMVEQAQGSKANVQRLADKVSG
    IFVPAVIGIAVLTFLIGWAVTGSATWSLVSAVSVLVIACPCSLGLATPTAIMVGTGRGAQSGILFRNADALERAEKLKTI
    IVDKTGTLTQGRPTVAAVHPAVGVPVDTLLGVAHALEHNSEHPLARAIVDYAESHGGNAPAAVEDFQAVPGKGVIAQCGG
    QEARLGSPAFMQASGLDLSSLPVAALESEGNTVIAVAQDGQVLGIIALADELRADAVATVKALKARGIRVVMLTGDNERA
    ASVVARQVGVDDYLAGVLPEHKADGVAKYRAQGGLVGMVGDGINDAPALAAADVGFAIGAGSAVALDTADVVLMKSEMTG
    VLDAISLSNATLSKIRQNLFFAFIYNILGLPLAAFGMLNPIVAGAAMAMSSVSVVSNSLLLNRWKPISGKS

    >gi|58039136|ref|YP_191100.1| copper resistance protein CopZ [Gluconobacter oxydans 621H]
    MTETAHMTVEGMSCNGCSGKLQRALEAVNGVKAVDIVLDGGKVTVSYDPAQVSAAAFRDVVEDTGFDVVS

    >gi|58039187|ref|YP_191151.1| hypothetical protein GOX0718 [Gluconobacter oxydans 621H]
    MPARRCSPAGVIVRVASSHVRVGTFQYFAAQGDIEGVRILADHVIGRLYPDLAEAENPYLALLEAVTARQADLVARWMLV
    GFIHGVMNTDNMSIAGETIDFGPCAFLDAYNPAKVFSFIDQNGRYAYGNQPDMALWNLGRLAEALLPLLDSDREKAIEQA
    KDALMRFDDVFNDTYLGGWRRKLGLAQEENGDARLTERLLTAMHRGDADFTLTFRRLGDVVRTGQTDSLVALFGPGSGIE
    DWIGDWQARLGREERPVEACYTDMQATNPRIIPRNHRIEEMIRSAVAGDYAPFHRLVEALSHPFDDAADRFEVPPAPHEK
    VMNTF
    CGT

    >gi|58039228|ref|YP_191192.1| thioredoxin [Gluconobacter oxydans 621H]
    MSSTFDEHLIGQSSNKAPAGTAATIIDADQTNFMADVVEASREIPVLVDFWAPWCGPCKQLTPVLEKVIRAAGGRVRLVK
    VDVEANQALAAQLGQLGLPLQSIPLVVAFWKGQVLDLFQGAQPESEVRRFVESLLKLAGDVMPATEILAAARQALADGHA
    DQAAGLFSQLLEAEPESPEAWGGMIRALIALNEPEAAQDASAQVPAKLDSHPEITGARAALALHAEGAKAASELETLRQQ
    SAAAPDDFDLRLKLAAALNGAGERAEAANTLLDILRKERNWNDGAAKTELLRFFEAWGHTDPDTLAARRKLSSLLFS

    >gi|58039359|ref|YP_191323.1| hypothetical protein GOX0895 [Gluconobacter oxydans 621H]
    MSDTFEPIRIVALYHFTPFEDPAALRGPLLELCEKEGIKGILLLAREGINGTIAGTDEGMERVMAHIRALPGCADLESKD
    SRAPELPFRRMKVRLKKEIVTMGEPDIDPRQGVGRYVAPEDWNALISDPDTILIDTRNDYEVAIGTFKGAEDPKTKSFRE
    FPEWFRRRRQELEAKGRLPKIAMFCTGGIRCEKSTSFARAEGVDEVYHLKGGILKYLETVPEEESLWEGECFVFDQRVSV
    KHGLEIGTHDVCHACRRPLNEKDKASPLFVQGVSCPHCHNERTEEQRHRYAERERQEALAQARRAGHLGVRQK

    >gi|58039373|ref|YP_191337.1| Thiol:disulfide interchange protein DsbD [Gluconobacter oxydans 621H]
    MSALLLAGFLGLGSASALAAESAPVTSGNDTATLVTDRDAVGPDQHLRVGLRLQLKPGWHTYWINPGDAGDTPTLDVTAD
    GGATGKGGPIHWPVPVRISEGGLMSYAYVNEVTLPEDLVLKGSGGTTLHAHGEWLVCAQVCIPESGDFTLTLPASAQDAP
    EGAQAALFHKADAAMPVASPFAASVSADGVLTLSGKGLSAASVSQAWFLPQDGGVIDQVAAQPLHVSDGQLTLGLKFLKS
    AHRDRPLEGVVVLKDAAGQESPLQIEARPVGGAASAPVQDASAQGQASGAEVPTGAGWLRVLLFAFVGGLILNLMPCVFP
    VLAMKALSLAKMGGAGRGVQLQSALFYTIGVMGAFAALGIVMIGLRLAGSAAGWGFQFQSPGFVVAVCWLLFLMGLNLLG
    VFEVSAGRLGQVQTGSGRGGDMMTGLLAVIVATPCTAPFMGVAIAGALGGPPVMGVLVFLAMGLGLAFPYILVAGVPSVA
    SRMPKPGAWMGILKQVLAFPLFATCVWLLWVAAIQRGVTFVALTAGGVVLLGFAGWIYGVGQRRSMLEGGRGTVAFCRVV
    AALCVVVCGAALAQGLRAAPAPVSAGTAEAGVEPFSEARLAELRAQGKPVFIDMTASW
    CITCMVNERVALDVPSVQEAFR
    SRGIVFLKGDWTNRNAAIAAFLKAHGRDGVPFYMYYAPHQDGVVLPQILTPGIVTSTIGK

    >gi|58039530|ref|YP_191494.1| O6-methylguanine-DNA methyltransferase [Gluconobacter oxydans 621H]
    MPQLSCHSPFGALTISEDEGQIVALDWGWGRDQEETPLLLKARDLLERYFDGESVDFETLPYRPYGTPYRQKVWDALRRI
    PYGQTRTYADIAAEVGGSARSVGGAVGANPIPILIP
    CHRVVGRSGLGGYSGLGGVADKHALLHLEGAR

    >gi|58039560|ref|YP_191524.1| hypothetical protein GOX1099 [Gluconobacter oxydans 621H]
    MVSMVTFKVDGMSCNGCSGKLQSALSSVPGVSSAQVTLDPAQAAIQYDEQKVTPVALRHVVEDVGFDVIA

    >gi|58039580|ref|YP_191544.1| disulfide bond formation protein B [Gluconobacter oxydans 621H]
    MPLNRTYRPVSTSALGGLYVLAGLVALGVVWFAEHWLKLAPCELCLWERRPWWVLIGLGIVTIVLPKRYARYGIFFGLLC
    LMTSIGLAVLHAGVEHKFWPSPAPE
    CRAPVFHGGNFKDWMSAMPARPNKPCDSPDYLFGLPVSMTELGGLYAVVVFVVAL
    VGSFRMGRSRR

    >gi|58039776|ref|YP_191740.1| Alkyl hydroperoxide reductase subunit C [Gluconobacter oxydans 621H]
    MVRINSPLKPFSTDAFRNGEFLTVTDSDVRGKWSVFFFYPADFTFVCPTELEDLADNQAAFDKLGVEIYSVSTDKHFTHK
    AWHDTSPAIGKIKYTMLGDPTGTIARNFDVLIEEAGLADRGTFLIDPEGKIQYIEITAGGVGRSAAELLDKIQAAQYVAT
    HPGEVCPAKWKEGGETLKPSLDLVGKI

    >gi|58039777|ref|YP_191741.1| Alkyl hydroperoxide reductase subunit F [Gluconobacter oxydans 621H]
    MLQDDLKTQMRAYMEYLRDAVVLEATLGTDDRSNEVRGLLEDIASLSPKVTFSDKGHGTRIPSFVIRRPGTDVQVCFAGL
    PMGHEFTSLVLALLQVSGHPPKIEADVVAQIRALDGDYHFETYFSQS
    CQNCPDVVQALNAMSVLNPKIHHTAIDGADFQD
    EVERLGIRSVPQVYLNGEPFASGRMEVADILAKLDTASVARSAEKLNDMAPFDVLVLGAGPAGDAAAIYAARKGLRTGLV
    AERFGGQVMDTAGIENFISVPETDGPKLSAALEAHVRQYDVQIIASQLAAKLIPAAETGGLHQIVLESGAVLRSKTVIIA
    TGARWRHLGVPGEDEYRTKGVAY
    CPHCDGPFYKGRPVVVTGGGNSGVEAAIDLAGIVSHVTLLQRGAHLKADKVLQDRLL
    SLPNVTVLTNALTTKIEGDGKEVTGLTYSDGDGGLHQIKTDGVFVQIGLLPNTEWLKGTLKLSPYGEIVIDDHCGTSVPG
    VFAAGDATTVPYKQIVIAMGEGAKASLSAFDYLIRLPVAAKAN

    >gi|58039863|ref|YP_191827.1| putative peroxiredoxin [Gluconobacter oxydans 621H]
    MRRFFATTAFCAVSLAGALTTAPAHAALETGTHAPDFSASASLGGHEFTYHLADALKTGPVVLYFYPAAFTKGCTIEAHE
    FADAIPDFKAQGATVIGISMDPIDKLNRFSVSECRSVFPVAADPTGKITLSYAAKMPLLHMASRTSYVIAQDGHIAMSYA
    SMSPDEHVSRALAAVKALKQHP

    >gi|58039901|ref|YP_191865.1| glutaredoxin 2 [Gluconobacter oxydans 621H]
    MSTPHILYIYEHCPFCTKARMIFGLKNIPYEQRILLNDDVDGPVRMVGRKVVPILEENGTFMPESMDIVAHIDAIGTPVL
    TGETRPEIAAWLKKAGTPLYRLFLPRAAAAPLPEFATTSARAGFIRRKEPSVGSFSALLEEKTDELTQLNAMLKELAPLI
    RSPEAVNGELSTDDIHLYAHLHSMSLIRGVVYPAEVEAYRQAMAARSGVGLFDDIAV

    >gi|58039967|ref|YP_191931.1| Outer membrane protein [Gluconobacter oxydans 621H]
    MRHPLLATASAVVAGMAFFVGGQALAAPATSFTPAQRAEIVGIMRDALQNDPSILTDAIRAIREKAEEQKQDSTLAAVKA
    HQSELQTAPDFAIRGNPHGRITVVEFYDPR
    CSYCRSMMGEVDSFLSRHPDVRLVEKVVPVLGTNSVLDTRAIFAASAQGK
    YEAMRRALMADTTKPSMERIVELAQANGIDTKKLTADMSSPQTVALINTNLDQGRAVGLDGTPTFIFGTAAVAPGALEAD
    QMDAFLERARKA

    >gi|58040056|ref|YP_192020.1| hypothetical protein GOX1623 [Gluconobacter oxydans 621H]
    MTPASPRVSIRYCTQCNWLLRSGWMAQELLSTFGQALGEVALIPDTGGRFEIHVNETLIWERKRDGGFPGPNELPRVLWR
    RFLSELSG

    >gi|58040082|ref|YP_192046.1| Thiol:disulfide interchange protein DsbE precursor [Gluconobacter oxydans 621H]
    MNATRRGILTAVPIIGAGVLGVGFWRMLSDMRSGAFDPRAIKNPNVGKPIPSFAMPGLPGLGDGFTDAELRAQHRPVLVN
    FFASW
    CIPCVAEMPGLRAISRNMPIWGIAYEDKPENAAGFVQRDGSPYARVASDRHGRVAIDWGVTGVPESFLVAPGGRI
    IWHGSAALDPQIYEAEIRPRLAGL

    >gi|58040094|ref|YP_192058.1| bacterioferritin comigratory protein [Gluconobacter oxydans 621H]
    MPVMTASSPRTDLQPGDRAPDFTLSASGGRTVSSAELKGKPYLLYFYPKADTPGCTTQACGLQDVLPKFEVAGLTIIGVS
    PDPVAKIEKFATKYGLQFPLASDEDHAVAEAYGTWVEKSMYGRTYMGMERSSFLVDGQGIIRNVWRKVKSATHAALVAEA
    FRDLSSGA

    >gi|58040182|ref|YP_192146.1| HesB family protein [Gluconobacter oxydans 621H]
    MSDTVPFSISASAAARINEIIAAQPEPEGLALRVAVLAGGCNGFQYQFRLERDQAADDVVIERDGAKVFVDTTSLDLLEN
    AELEFVDKLMGAHFTVTNPNAASSCGCGTSFSLA

    >gi|58040195|ref|YP_192159.1| glutathione reductase [Gluconobacter oxydans 621H]
    MSLKRPLPSAEVSKARKAGMMQDFDLFVIGAGSGGVRCARIAAQNGARVAIAERRHWGGTCVNLGCVPKKLMVYAAEYGR
    EIADAPSYGWDVKPVAHDWSTLISAKDREIERLNRIYVSMLEKAGVTLFTGDASFVDAHTVEIGPSELAPDASVQRVRAK
    NIVIATGSTPTRLNIPGAEHAIVSDDAFHLADRPERVAVIGSGYIGIEFAGIFAGLGSKVDLVFRQQLPLRGFDHEMRAH
    LSELLPLNGIKAHPGRSPERIEKVADGYRLHLEGGDVIETDCVFMATGRHPNLAPLKLGNAGVATWDGRIPAKPDDATTN
    VAGIYAIGDVTDTYNLTPTAIAEGHILAERLFGEPGREWSFATTPKAVFFSQPLATVGLSEEEAVQSHDVDIYTSSFTPM
    RQTLSGRKGKTLMKLVVDAKSKIVLGAHMIGPDAPEIIQGLAIAITAKLTKRDFDRTIGLHPTSAEEFVTMRSLTRHVPR
    KAG

    >gi|58040307|ref|YP_192271.1| glutathione peroxidase [Gluconobacter oxydans 621H]
    MTCAYDFSLPGLSGDTIDLSAYRGRPLLIVNTASKCGFTPQYEDLQHLWSRYGRDYPEGLMIIGVPSNDFGQQEPGSSED
    IKNFCHRNYGVSFPMTARQHVRGPETTPLFRWLDKQGGFLARPRWNFYKYLTDRDGNLANWFTPLAKPASNRVEEAVRKV
    LLDH

    >gi|58040384|ref|YP_192348.1| putative thiol:disulfide interchange protein I [Gluconobacter oxydans 621H]
    MIRKQIDRRTLLGGAASLAAAASLCNCGLGNSARAADGVQPMLPSLKPGAPRLEPVNFQLVGPGGTALSLSTMRGRPFVL
    HLWATW
    CPPCRLELPALNTFIEKTGSTVPVIPVAVASPMPKVMVFLAQGNLPHIAPWTLGQHEFSQWFTSGEPSLPMTCV
    IDAQGRMRASVEGEMAWAAPESRASLEKILSDLQASKPA

    >gi|58040385|ref|YP_192349.1| putative thiol:disulfide interchange protein II [Gluconobacter oxydans 621H]
    MQGAFAQRRRDRWTGRLPVRLPRCAGFLPRRVPEPRCDRPAAMKERISNMTFPLTRRHLLGGAGALLVSGRAIAATAAKE
    EAGKGLPFEPNSFGKLATPKVLSPLSVQNEQGQDVPLSHWYGNPFILHFWATW
    CPPCIRELPSVNATAKALDADGPQIVA
    VAVRGSTIPKVRAFYDSHGIDTLPVLVDPVSGVMMETADQAALVQSIRQVRPADLKELTPDVMSLHGVPRSLILNGKGEV
    VAESIGNMDWSADAVRHTVRALAG

    >gi|58040420|ref|YP_192384.1| osmotically inducible protein C [Gluconobacter oxydans 621H]
    MTIKKTASAHWTGGLKDGKGTISTQSGALQNQPYGFNTRFEDKPGTNPEELLGAAHAGCFTMALSMMLEQAGFKAESLET
    KATVSLDKSGEGFAITQSHLTLRGKVPGASEAQFLEIANKAKEG
    CPLSQVIKAKITLDATFEG

    >gi|58040432|ref|YP_192396.1| putative thiol:disulfide interchange protein [Gluconobacter oxydans 621H]
    MTRLSLSRRFFVSAAPALAVAGTAAGTARAVAAGSTGARLSPRIIGNPNAKVLVQEWFSLTCTHCAHFATEEFPKIKEQL
    IDTGKIRYQFHDFCGDRVGLTAAMVARSLPEERYVPFLEALFSSQMQWAFAAGGDPMQRLQQMSALAGVSAAQFDAISKD
    NVFAEALFDQVKKDSDTYNIQGTPYFRFNNTHYDQDPETYEKFADLVAKAS

    >gi|58040433|ref|YP_192397.1| putative thiol:disulfide interchange protein [Gluconobacter oxydans 621H]
    MKAAWNSGFWMRMPGISVPCACGFRKAGKTSRFPLSRRRKMTGALDGGPGSSFEYHIVSSGAPPMSADQPLGRRTLLASG
    MALVASAVVSFARADDLPTSDPRMGPRVIGSPDAKVIVDEWFSLT
    CSHCAHFAQEIFPQIRKNLIDTGKIRYRFHDFPLD
    QVALLASMVSRSLPAERYEPFVTDLLDHQDEWAFAQNIDPIAELKKRAALFGVSAAEFDKINADNALRESIINRQDRDGA
    FLQIQGTPYFRINDVPAPDVVGSYDDFAKAVAKAS

    >gi|58040656|ref|YP_192620.1| thiamin biosynthesis protein ThiF [Gluconobacter oxydans 621H]
    MGRRDAGICAMNRYSRQVSLFPQGEADQKRLLDAHVLVVGAGGLGATVLPALAGAGCGRITVVDHDRVDESNLHRQTLFR
    MEDIGRPKVSCAAERLEGLNPDCRIIPVARRLEPASARCLLPGSSVVVDAADSVAVTYMLSDLCLEAGVPLVSASVLGQS
    GYVGGFCGGAPGYRAVFPDIPAGFPT
    CSEAGVLGPAVAALGAIQAQMTLSILLQMQPSPLGQMISLDMKHWRSSSFRFDD
    APPPEEEGPFILGLEEITEADRVFDLRERDETGLPSVDWAVRGPIEHPEMLDVKTGRTVFICASGLRAWRAAKRFSGQSG
    VDAFIATTGR

    >gi|58040673|ref|YP_192637.1| molybdopterin biosynthesis MoeB protein [Gluconobacter oxydans 621H]
    MKVSNYHHFMDMNFSDHELERYSRHILLPQVGAIGQARLRGASVLVVGAGGLGAPLLQQLAASGIGRIGIMDDDRVDLSN
    LQRQVLYGTDDIGAFKVEAAAKRLKALNPLVTVSPHPVRARGTTLDALVSQYDLVCDGTDNVATRLAVSDACVRHGRSLV
    SGAVQGFSGQLAVFRPQKGGPCYRCLFPEAAQTEAPN
    CGMSGVLGAATGVMGSLMAVEVMREVIELEGTDQTRVSLWDAL
    SGTMESFVLKRDPACQIHHDERVPG

    >gi|58040674|ref|YP_192638.1| hypothetical protein GOX2248 [Gluconobacter oxydans 621H]
    MTQPMFLTLADDSWQRAHYALVVAAGGLSLGRDVTIFAGGRSVLALTPDWKGLAGVISDSELETRGIAGFGELREAVLDL
    GATVMA
    CEAGLRMAGLSEKDLLDGVTVRGIVSFLELAGDNPVLAL

    >gi|58040717|ref|YP_192681.1| dihydrolipoamide dehydrogenase [Gluconobacter oxydans 621H]
    MCDTFDLIVVGGGPGGYVAALRASQLGMSVALVESTHFGGVCLNWGCIPTKALLRSSEIHHLLHELGTFGLSADNISFDL
    SKIVGRSRSIARRMGGGIAHLLKKTKVTTFDGRAKLAGRSGEAHQVAITKDGAAVATIKAPHVILATGARGRQLPGLETD
    GTLIWGAREAMTPKELPKRLLVIGSGAIGIEFASFYRNMGSEVTIAEVADRILIAEDPEISAAARKAFEKQGMKIITSAK
    VGPLNKGENEVSTTIESPTGKVDLTVDRVICAVGIVGNVEDLGLEGTKVQVERTHIVTDGFCRTGEPGIYAIGDVAGAPW
    LAHKASHEGILCVEKIAGRSPQPLHPLNIPGCTYSRPQIASVGLSEEKAIAAGHKVKVGRFPFIANGKAVAMGETDGMVK
    TVFDATSGELLGAHMIGAEVTEMIQGYVITRTGELTEAELVETVFPHPTISETMHEATLAAFDGPLHI

    >gi|58040731|ref|YP_192695.1| glutaredoxin [Gluconobacter oxydans 621H]
    MSETVFQHIQNLIDANPVMLFMKGDKLFPQCGFSARVVQILTHLGVPFETCNILESAELRQGIKDFSQWPTVPQLYIKGE
    FVGGCDIVTDMYQSGELETLLTEKGITTANA

    >gi|58040915|ref|YP_192879.1| peptide methionine sulfoxide reductase [Gluconobacter oxydans 621H]
    MTTQQSSILLGAGCFWCVEAVFSGLRGIISAEPGYAGGSVDNPSYEAVCTGRTGHAEVVKVVFDPAEIGLEDVLRVFFTT
    HDPTQLNRQGNDVGTQYRSVIFGDATQQETARRVRAEIESEGIWPDPIVTSIEGPAHFWPAEEKHHDYFARNPQTAYCAA
    VVAPKVAKARKLYRDRLKQPD