Gluconacetobacter diazotrophicus PAl 5 uid59075

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|209542253|ref|YP_002274482.1| DSBA oxidoreductase [Gluconacetobacter diazotrophicus PAl 5]
    MPVTRRTLIATAPALLAPGLAPRAARAADTDPRMSVRAAGNPAAKVHVEEWFSLTCTHCARFAGEVFPEIRTRLIETGKV
    YYIFRDFPLDQLALAAAMIARTLPPERYEPFVLSLLSSQDRWAFARDVNPQDELQKMAALAGMPADLFQKTIADDTLRQA
    IMDEENRAQAQYKIEGTPTFRFNDKVQVGQEMTYDDFAQKVASLA

    >gi|209542313|ref|YP_002274542.1| glutaredoxin 3 [Gluconacetobacter diazotrophicus PAl 5]
    MPRIEIYTQPGCPYCVRALRLLEQKGTAFTEIRALLGTAERAEARERSGGRTTVPQIFIDGRHIGGCDDIMALDRAGKLD
    PLLHAA

    >gi|209542350|ref|YP_002274579.1| dihydrolipoamide dehydrogenase [Gluconacetobacter diazotrophicus PAl 5]
    MSKTEFDIVVIGGGPGGYVAAIRAAQLGLSTAVVEANHLGGICLNWGCIPTKALLRSSEINHLLHNLGEFGFAADNVRFD
    LDKVVKRSRKVAGQLSAGVAHLLKKNKVPVFDGFGKLAGTSGGRRKIEVTKDGKPVATLSAANVILATGARARVLPGLEP
    DGKLIWSYREAMVPTEMPKRLLVVGSGAIGIEFASFYRNMGAEVTVVEVLDRILPVEDEEISALAHKAFVKQGFTLLTGA
    KIGPIRKNGDSVSLSVEAGGKTHDITVDRVISAVGIVGNVENIGLEGTAIQVDRTHIKVDAYCRTGEPGVYAIGDIAGPP
    WLAHKASHEGVMCVEAIAGRHVHPIDPRNIPGCTYCRPQVASVGMTEAAAKAAGHTVRVGRFPFIGNGKAIAMGEPEGLV
    KTVFDAKTGELLGAHMIGAEVTEMIQGYVIARTSELTDAELKETVFPHPTISEAMHEAVLAAYDGALHI

    >gi|209542371|ref|YP_002274600.1| glutaredoxin-like protein [Gluconacetobacter diazotrophicus PAl 5]
    MADTITQRIQNDIDTNPVMLYMKGTAQFPQCGFSAKVVKILNHLGVPFQAANVLEDAELRQGVKDFTNWPTVPQLYVKGE
    FIGGCDIVSEMFQTGELEKLFVEKGIVTASA

    >gi|209542377|ref|YP_002274606.1| Rhodanese domain protein [Gluconacetobacter diazotrophicus PAl 5]
    MHPLISPAQLQERLAAPDLVVLDATMALPGETFDPARCFAQAHIPGARRFDIELFSDPDSPLPHMIPTQARFEHLARGLG
    LSDGAHVVFYDQGNAASAARGWWLAGLFGLDRVQVLDGGLPAWQRAGGPVEQGEEGPAAAGGFRAAPRFARVSGLGDMRA
    HVGRGDRLILDARAQARFAGTAAEPRPGLASGHMPGARNLPFGTLLDANRAFLPPAALRDRFAHVGVTDGRPVVTT
    CGSG
    VSAAVLSLGLAICGRTGDSLYDGSWAEWGSTPGAPVETGEGTSP

    >gi|209542480|ref|YP_002274709.1| glutathione peroxidase [Gluconacetobacter diazotrophicus PAl 5]
    MTTAYDFTLPSLDGGTIDLGALRGKPILIVNTASKCGFTPQFEGLQALWSFYRGNGLTIIGVPSNDFGNQEPGTSTEIAT
    FCARNYSVTFPMAARSHVRGADTLPLFRWIAQQGGLMARPRWNFYKYLIGRDGRLANWFVSLTSPESHRMRVAIERAILD
    T

    >gi|209542616|ref|YP_002274845.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Gluconacetobacter diazotrophicus PAl 5]
    MTYDFDLFVIGAGSGGVRCARIAAGHGARVAVAENRHWGGTCVNLGCVPKKLMVQASEYNDLARDSHGFGWNIAPGHHDW
    AALIAAKDHEISRLNGIYVSLLEKAGVTLFTGTARFEDAHTLVIGPGALAPDAPVRRVTAERIVIATGSAPDMPSLPGIE
    HAISSDAAFHLESRPQRVCMVGGGYIGIEFAGIFRGLGSEVDLVYRQDLPLRGFDQDMRHGIHDAIAARGIRQHTGRSPV
    SIQPVGDAYEVRLDDGSHVIADCVFFATGRSPNVGALGLDHAGVDTVAGGRIVVDGTGETNVEGIYAIGDVTNRLNLTPV
    AIAEGHSLADRLFGTGHHPRSWSLATTPKAVFFSPPLATVGLTEEEAARDGIVDIYLARFTPMRHTLTGRARKTIMKLVV
    DQATQKVVGAHMIGDDAPEMMQGLAIAVTAGLTKADFDRTVGIHPTSAEEFVTMRTRTRVTDRQAD

    >gi|209542627|ref|YP_002274856.1| iron-sulfur cluster assembly accessory protein [Gluconacetobacter diazotrophicus PAl 5]
    MDTASTPTPDTRFRVSPQAVTRLEEIVAAEPAPEGAAAPGLRVSVLAGGCNGFQYSFALDGERRADDVLIPAGQSHVVVD
    PSSMDLLDGAELHFNDSLMGAHFTIRNPNATSSCGCGTSFSID

    >gi|209542695|ref|YP_002274924.1| DSBA oxidoreductase [Gluconacetobacter diazotrophicus PAl 5]
    MPYFAPVRPPARRAARRRAALSGVAAAILLGLSTTGARAGDGGTFTADQRKEIVAIVRDALKTDPTILTDAIAALRAGAE
    AQEQATTRDALAANRAALGTPAPTDAILGAPHARMTIVEFYDPR
    CPYCRKVLPDLDRLVHDDPDVRIVEKVVAVLGPASL
    LTAQAIAAAALQGGQDAYFRMQRAIMADSQKPDAARIRTLAAQAGLDPDRLATDMAGSAVASTLRANSTLATAIHLEGTP
    TFVFDGRYVIPGAVDLDELKAAIAKVRRG

    >gi|209543040|ref|YP_002275269.1| Peroxidase [Gluconacetobacter diazotrophicus PAl 5]
    MTIHLGEIAPDFEQETTFGPIRFHDWLGDSWGILFSHPKDFTPVCTTELGAVAKLAPEWAKRNTKVIGLSVDPVGSHSEW
    ESDIARSQGASVNFPIIADADGTVAALYDMIHPSADPKVTVRTVFIIDPSKKVRLTLTYPPSAGRNFDEVLRVLDSLQLT
    DAHKVTTPANWTNGDEVIIAPSVGDEQARSLFPAGWKTVLPYLRLVPQPR

    >gi|209543068|ref|YP_002275297.1| Rieske (2Fe-2S) domain protein [Gluconacetobacter diazotrophicus PAl 5]
    MTQDSPYRRDAPWHDVAALEDLDPAIARRVEVEGHPVLLLRRENGQVRALAAECPHKGAPLEKSVVCGDRLVCPWHKAIF
    SVEDGRLLEPLALDPLASYPTEIRDGRVLVSLGARPLSSGTEGPAQSVLIVGAGAAGVAAAVSLREFGFAGSVTMVDSQD
    AAPYDRTALTKAVLAGKADGDMPPLLRPDGFWTDHGIDRVVGLVVALDAPSRAITLADGRVLAADHVLLAPGSTPRPLDV
    PGADLPGVFTLRQTVDAQRMLAA
    CPPNGRVVISGGNFIGMEAAASLTSRGMQVTIIAPDDIPFAKMFGREVGARLRRLHE
    ENGVVYSGGRRIVGMEGDQRVERVSLDDGTSLEDEIVLVGVGVQPATGFAAALAAPDGGIDVDDRMQALPGISVAGDCAR
    ITHGDSRVRIEHWRSAQVQGRQAARTITGRSGPSRFLPWFWTQQFGSKIEYAGYHEPFDDVTIEGDLDALHFVARLARNG
    RCVGLVTAGRPDVTAHAVLSGRLE

    >gi|209543111|ref|YP_002275340.1| DSBA oxidoreductase [Gluconacetobacter diazotrophicus PAl 5]
    MKLEIWSDYACPYCYIGKRFLESALAEFEHAREVEIVFRAFELDPTSGPAVTTTTLDRIMRKYGKSRSDAQAMIDHITSM
    GERCGLDMRYASVRYTNTFDAHRLTKFAEQHGHGADMTERLFRAYFTDNSPLADHDILVGLAQDVGLDGDAVRATLTGSD
    FAEDVRRDETRASQAGVHGVPFFVFDGAYALSGAQPKAQLLAALRQSWNEARKTVSENPTTGMTCDSTGCVIPPSTSGSP


    >gi|209543411|ref|YP_002275640.1| peroxiredoxin [Gluconacetobacter diazotrophicus PAl 5]
    MTTINSELKSFSTDAFHNGKFVKVSDQDVRGKWAVFFFYPADFTFVCPTELEDMADHYATFQDLGVEIYAVSTDKHFTHK
    AWHDTSPAIGKIRYVMLADPTGAISRNFGVLVEDAGVANRGTFLIDPQGRVQYMEITAEGVGRTAESLIDKIKAAQYIAA
    HPGEVCPAKWKEDGATLTPSLDLIGKI

    >gi|209543412|ref|YP_002275641.1| alkyl hydroperoxide reductase, F subunit [Gluconacetobacter diazotrophicus PAl 5]
    MLQDTIKSQLKDHFANLAHPIVLEASLDDSAPARDMAALLHEIAALSGKIRVSTNGAASRRPSFAIRREDAAGGVTFAAI
    PMGHEFTSLVLALLQVGGHAPKLPDDITAQVGSLSGTYRFETYVSLS
    CQNCPDVVQALNAMSVLNPNISNVTIDGALYQR
    EVEEKNIMSVPQVFLNGQPFGSGRMGVAEILAKLDADAPKRAAERLKDLAPFDILVVGAGPAGSAAAVYAARKGLRTGLV
    AERFGGQVMDTAGIENFISARETEGPKLAAALEAHVRQYDVEVISAQRVRELHAAAQPGALHHVVLESGASLRARTIILA
    TGARWRPLNVPGEEEYRTRGVAY
    CPHCDGPFFKGKPVAVAGGGNSGVEAAIDLAGISSHVTLLERDPALRADRVLQDKLR
    SLPNVTVMTNAVITKVEGNGTKMTGLTVQDGEAARHLDVDGVFVQIGLLPNTDWLRGTVERTAFGEIIVDGRGATSVPGI
    FAAGDATTTPYKQIVIAIGDGAKAALAAFDHLIRLPG

    >gi|209543462|ref|YP_002275691.1| thioredoxin [Gluconacetobacter diazotrophicus PAl 5]
    MSENTVAVSDATFESDVLKAEGPVLVDFWAEWCGPCKMIAPALDEIGAEFKGKLTVAKVNIDDNPGTPNKYAVRGIPTLI
    LFKNGQPAATKVGALPKSQLKEWVKSSL

    >gi|209543467|ref|YP_002275696.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Gluconacetobacter diazotrophicus PAl 5]
    MTDAPTLTTDVAIIGAGPAGLFAAFECGMLKLDSLLIDALDCVGGQCAALYPEKPIYDIPGHPAIAGAALIEGLEQQIAP
    FDVPRLLGRRVERLSGHRGAFTLGTDRGETIHARAVIIAAGAGAFGPNRPPLAGLDGFEATGAVQYYVRRRADFAGTRIV
    IAGGGDSAIDWALALKDEAEKIWLVHRRDRFRAAPESLRQLDEAVAAGRIEKIVPYQLHGLRGTDGALEGVEVATLDGDT
    RILPADRLLPFFGLSTDLGPIAHWGMDSIRSTIPVVPSSCETTLPGVFAVGDVAAYPGKLKLILQGFSEGAMAAHAIHPI
    VRPDTALHFEYSTSKGVPDRI

    >gi|209543589|ref|YP_002275818.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Gluconacetobacter diazotrophicus PAl 5]
    MLTVGNKFPEFNLTSVPGGPEGLKGNFVQISDKSDAGKWKLVFFWPKDFTFVCPTEIVAFGKMAGEFKDRDTVVYGVSID
    SEFVHLNWRLHHDDLKGLQIPMLADIKRELSEACGVLSPEAGVAYRATFLVDPEGIIRHVSVNDLSVGRNPQEILRILDA
    LQSDELCPCNWKQGDDFLKV

    >gi|209543701|ref|YP_002275930.1| transcriptional regulator, AraC family [Gluconacetobacter diazotrophicus PAl 5]
    MVEMTDMTERDPRWARIVARDRRADGLFWYSVRTTGVYCRPSCPSRMAKPGNVRLHDTLGAARAAGFRPCRRCNPDGASP
    QDIGQALVVQACRLIAARDDMPSIADLARAVELSPSHFHRLFRAETGLTPHAYAAAHRAGRIRAELPRADSVTEAIFDAG
    YGSSGRFYAQAADLLGMTPARYRAGGAGERIRFAVGQCSLGAILVASSARGVVAILIDDDPNTLVRDLQARFPRAELIGG
    DEEYERHVALVVGFVEAPGIGLDLPLDIRGTAFQHRVWSALRDIPAGQTVTYADIARRIGQPQAVRAVAGACAANRIAVA
    IP
    CHRVVRNDGALSGYRWGVDRKRILIDRERTAAPVPSARPEGRSS

    >gi|209543725|ref|YP_002275954.1| iron-sulfur cluster assembly accessory protein [Gluconacetobacter diazotrophicus PAl 5]
    MIEMTPSACEAVRAAIAGAATPVEGIRIMVESGGCSGFKYMMGLVAAPEPSDVVVDIDGVKVFVDAESGPHLQGTKVDFV
    VTLEQSGFSFDNPNAASKCSCGKSFN

    >gi|209543829|ref|YP_002276058.1| OsmC family protein [Gluconacetobacter diazotrophicus PAl 5]
    MSVNVLYRTSARATGGRDGRSATLDGALDVKLTTPKELGGPGGDGNNPEQLFATGYAACFLGAMKFVASRGDTTKVPADA
    TVTSTVGIGPRSEGGFGLEIALAIALPGVERAAAEDLVAKAHQV
    CPYSNATRGNVDVKLSVV

    >gi|209543850|ref|YP_002276079.1| peptide methionine sulfoxide reductase [Gluconacetobacter diazotrophicus PAl 5]
    MTRSGFFGVSLVALTTFGAACHTAMGEPGPRILPAPVLTEPAPATHHASAVFAGGCFWGVQSVFEHVRGVTATRAGFDGG
    ARDTADYETVSSGDTGHAESVEVDFDPTQVSYGTLMRIFFSVALDPTQVNRQFPDDGTQYRSVLYTRSAQQLQEAHAYIA
    QLDAAHVFARPIATQVAPDHGFYPAEADHQNFAARYPDHPYIATYDAPRIEALHALFASSWRPQPVLTLADDGGSGLSP

    >gi|209543851|ref|YP_002276080.1| methionine-R-sulfoxide reductase [Gluconacetobacter diazotrophicus PAl 5]
    MTSRRQFFLAAVAMAVFGRARAAEHYPVTHTDAEWHRLLTPAQYTVLREAGTEMPYSSPLLTEHRPGRFACAGCDTAAFD
    ARTKFESGTGWPSFDSALPHAVQERGDDSLGMERTEVRCATCGSHLGHVFDDGPQPTGLRY
    CMNGVALSFHTA

    >gi|209544087|ref|YP_002276316.1| methylated-DNA/protein-cysteine methyltransferase [Gluconacetobacter diazotrophicus PAl 5]
    MPQLSMHSPIGDLTLTEEDGAIIALDWGWGRDQDENPLLRHACDRLDAYFDGAPDPFADLVLAPHGTAYQRTVWQAVRAI
    PLGQTRTYRQIAQIAGGSPRSVGNANSVNPIPILIP
    CHRVVSVQGLGGYSGDGGLTDKLYLLGLERAPIPAHAHETA

    >gi|209544148|ref|YP_002276377.1| UBA/THIF-type NAD/FAD binding protein [Gluconacetobacter diazotrophicus PAl 5]
    MIPDFSEAEIQRYARHILLPEIGGTGQAALRAASVLIVGAGGLGSPLGLYLAAAGVGRIGLVDDDVVDLSNLQRQIAHTT
    GRIGQRKVESAAEAMRAVNPLVRVEPHATRLDAGNARALVGGYDLVCDGSDNFRTRYLVADACALERRTLVSAAVLRFEG
    QISTFRPHRGGPCYRCLYPAPPQDGAVPS
    CAEAGVFGAVTGVMGTLQATEALKEILEIGESLDGRLLVWDALAARFHTVR
    LAPDPDCALCGPHASIHDLSAHGAADVR

    >gi|209544261|ref|YP_002276490.1| alkylhydroperoxidase like protein, AhpD family [Gluconacetobacter diazotrophicus PAl 5]
    MIDWSAYRRYLGQTMPKLAALTPGTVEGLTTLEEAAVTTGRLDAKTRELIALAVAVTTRCDGCIAVHSRAAVDAGATKEE
    IAEALGVAVALNAGAAAVYSTRVIDAVQKAAEAG

    >gi|209544265|ref|YP_002276494.1| dihydrolipoamide dehydrogenase [Gluconacetobacter diazotrophicus PAl 5]
    MTIEIKVPTLGESVTTATIGKWLKQPGDSVAADEPVVELETDKVSVEVAAPAAGRLGAHAVAEGEEVAVGALLTSVEEGA
    AGAAPKAAAPAAAKPAPKAEAKPAAAPAPAATPAAAPPAETDYDVIVIGAGPGGYVCAIRAAQLGFKVACVEKRATLGGT
    CLNVGCIPSKALLQSSENYHAAAHDYAGHGIVLDSVKLDLARMMARKGEVVEANVKGVEFLFKKNKVTWLKGTGKLEGTG
    RITVDGKPVTAKHIVIASGSDSAGLPGVEVDEKVIVTSTGALELSAVPKKMVVIGGGVIGLELGSVWHRLGAEVTVVEFL
    DRLVPGTDGEIAKQFQRILTKQGLQFKLGHKVTKADKTGKGVTLTVEPAAGGTAETLEADIVLLAIGRNAYSKGLGVEEA
    GVALDKRGRIITDGHFATSVPGVYAIGDVIAGPMLAHKAEEEGVAIAEILAGQAGHVNYDAIPGVVYTWPEVATVGRTEE
    DLKSSGVTYKVGKFPFTANGRARAIGMTDGFVKVLAEATTDRVLGVHIIGPGAGEMIAEATLAMEFGASSEDIARTCHAH
    PTLSEALKEAALDVEKRAIHI

    >gi|209544268|ref|YP_002276497.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Gluconacetobacter diazotrophicus PAl 5]
    MLRTLLLRRCVRLGMALPLAIALSFMAVTSLSPARAALPPGSMAPLFDAPASLGGKQFHFALADALRHGPVVLYFYPAAF
    TRG
    CTIEAHDFADAMDQFKALGATVIGISMDKIETLDRFSVSECRSRFPVASDPAGRIASSYDSKMPLLHYASRTSYVIA
    PDGHILSAYSAMAPAGHITGSLAALRAWKAHGA

    >gi|209544304|ref|YP_002276533.1| hypothetical protein Gdia_2160 [Gluconacetobacter diazotrophicus PAl 5]
    MVLSWRLPPFLRLSLLFLAPLVFLLALPSGRAGAAESAALTTTRDSATLVTDTDRYRPGMPLHVGLRLRLQPGWHTYWIN
    PGDAGEAPTLAVQAGGGAAGASGTIAWPVPRRLPDGPLMSYGYTGEVLLPAELRPTGPGDGPMVLQATAEWLVCAAVCVP
    EQGRFTLTLPPGDPAPSDQAPLFARAAAARPVASPFAAMIASDGVLAITGAGLSSDTVRDAWFMPTISGAIDQDAAQALS
    VHDGGLTLALKPGDAFHAAPTLDGVLVLKDAAGQERGLSVSARPGAVPTVTPGAVPGPAHSGAARMLLLAFAGGLILNLM
    PCVFPVLVMKAMALTRLAGGGASARLAGAGAYAGGVIGAFVMLGGVILALRAAGAVAGWGFQFQSAAFVAAMCWLLFAVA
    LNLLGVFGMGNGIAALGGVGVSRTGYLGDAMTGVLAVLVATPCTAPFMGAAIAGALAASPVVAMAVFVAMGAGLAAPYLL
    LAGVPGLARHLPRPGAWMDILRQGLAFPVLGTCVWLMWVLALQAGAGAIAVLGIGLVLIGLAAWLTGLAQGMAMRDGPAR
    RIRLCRAVALAALALAMALLPGLGGTVSGGAARLAADGSEPFSASRLATLRAQGRPVFVDMTAAW
    CISCLVNERVALSSA
    PVQAAFHDRHVVYMKGDWTNRNAAISAFLDAHGRAGVPFYLYYPPGSGDGRALPQILTTGLVLDALKG

    >gi|209544395|ref|YP_002276624.1| Thioredoxin domain [Gluconacetobacter diazotrophicus PAl 5]
    MDYIIGQSRGGQRATGGLVDEAGVPAAPSGMAGAPAGPGGNGAMIVDGTQDTFMQDVLEASRTLPVLVDFWATWCGPCRQ
    LTPVLEKIVRSAGGRVKLVKIDVDANRALAQQLTQVGLPLQSIPLVAAFWQGQILDLFQGAQPESEIKRFVEGLLKAAGG
    GSMPAADLIVAARAALEAGSAEEAAGLYAQTLEIEPENAAAWGGLVRALIVMGDEDAAEAALADVPARIADHAEITGARA
    ALDLKREGRKAAEASEGLRRRLAANPADHEARYELAAALNAAGHRQEAADELLTIMRQDRAWNDDAARLQLIRLFESWGH
    DDPATLQARRRMSALLFS

    >gi|209544457|ref|YP_002276686.1| uncharacterized peroxidase-related enzyme [Gluconacetobacter diazotrophicus PAl 5]
    MMSDARHTRRAQGVGEPAEFTFAELDWTPWLDPLPESELTERHRDGLVDAARAKSPYFMLLARDPDILGARTRSDKDIFY
    NTDGGLPRRERELAAVAVSRFNGCIF
    CASVHARFSELQGGDHETIAALLRDGTLPADAPAPWLLTAETAERLSATPVEFS
    AVHVAALREAGFDDAAILDLINSASFFNWANRLMLSLGFPSGKTGSDRDA

    >gi|209544664|ref|YP_002276893.1| arsenate reductase [Gluconacetobacter diazotrophicus PAl 5]
    MCVTIYHNPACGTSRTVLGLIRDAGIAPTIIEYLKTPPSRDELAGLIARMGVPVRDVLRRRGTPHDELGLDDAGLSDDRL
    LDAIMAHPILINRPIVVTPLGVRLCRPAERVLDILPPRQGA

    >gi|209544824|ref|YP_002277053.1| Peroxiredoxin [Gluconacetobacter diazotrophicus PAl 5]
    MGGPSIVRIGDAAPDFQARTTQGPVRLSDYRGRWLVLFSHPADFTPVCTSEFVALARAADRFAALDCALLGLSVDSLHAH
    LAWIDAIRARFGVTIPFPVIEDPTMAVGRAYGMLDAAARDSATVRATYFIDPAGIVRATTSYPVSTGRSVAEMLRLVAAL
    QRAAVGDVLTPEGWEPGADIVLPTIATADDMAAAGPSWFCRITPDPQA

    >gi|209544867|ref|YP_002277096.1| peptide methionine sulfoxide reductase [Gluconacetobacter diazotrophicus PAl 5]
    MTRSGLLGISLIAMGALGTACHAADAPLATRLPPPAAAEAPATTHRATAVFAGGCFWGVQSVFQHIRGVTATRAGYDGGT
    KDTAEYETVSGGDTGHAESVAVEYDPTQVGYGTLMQIFFSVALDPTQVNRQFPDVGSQYRSALFTRTPEQATAARAYIRQ
    LNAAHVFARPIATQIVPDHGFYPAEEYHQNFAARHPEDSYIATYDAPRIEALKMVYGAQYRDDPILTLAAPGGP

    >gi|209544868|ref|YP_002277097.1| methionine-R-sulfoxide reductase [Gluconacetobacter diazotrophicus PAl 5]
    MTSRRQFCLASAAFLLAARPGRAAPPYAVSHSDAEWRRLLTPAQYDVLRRAGTEMPWSSPLLGEHRPGRFACAGCDTAAF
    DAGTKFESGTGWPSFYRALPHAVQERADHSLGRDRTEVLCATCGGHLGHVFDDGPPPTGLRY
    CMNGVALSFHPA

    >gi|209545048|ref|YP_002277277.1| periplasmic protein thiol/disulphide oxidoreductase DsbE [Gluconacetobacter diazotrophicus PAl 5]
    MTGTVPHPPNLARRRLLMAAPLAAAGVAGVAFWRMLSGMSQGSFDPHDIHAPVLNRPVPDFKLPDQTPGQGFGTADLRAL
    QAPVLVNFFASW
    CIPCVAEMPELNALKDRLPIWGIAYKDKPDDAAGFVKRAGNPYARIAGDLSGMTAIDWGVSGVPESFL
    VGPGGVIRWHSAAALDADTVRGTLLPLAASLHS

    >gi|209545063|ref|YP_002277292.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Gluconacetobacter diazotrophicus PAl 5]
    MPDSTTPTFPAPGAPVPDFDMPASRGRHVRLADMRGRPFILYFYPKASTPGCTTEACGFQEALAALGGTGIPVIGVSRDS
    MKAIDTFADKQGLDFPLASDATGTVTEAYGVWVEKSQYGRKYMGIERATFLVDAEGRLVRTWRNVKVPGHVAEVMTAAAT
    L

    >gi|209545140|ref|YP_002277369.1| methionine-R-sulfoxide reductase [Gluconacetobacter diazotrophicus PAl 5]
    MTQVKTPTVCGVLTPEQVRVMREHGTERPGSSPLNHEKRTGLYRCAACGTPLFRSDTKYDSGSGWPSYYDALPGAVEEQV
    DTSHGMVRVEIHCASCKGHLGHLFPDGPPPTGQRY
    CINGVALEFVPA

    >gi|209545249|ref|YP_002277478.1| OsmC family protein [Gluconacetobacter diazotrophicus PAl 5]
    MTIKKYGTAQWQGGLKDGKGTVSTESGALSAHPYGFNTRFGDVKGTNPEELVGAAHAACFAMALSNILGEAGLTASALDA
    KSVVSLDKQPNGFAVTAAHLTLTATIPGTTDAQFQELAAKAKAG
    CPISKLLKAEITLEATLKS

    >gi|209545319|ref|YP_002277548.1| thioredoxin reductase [Gluconacetobacter diazotrophicus PAl 5]
    MARRIWHAPVAEKGAADPARLVSSALDGHIPCIVITSTPESMTQTHTTDLLVIGAGPAGYTAAIYAARANLKPILVAGLQ
    PGGQLMITTDVENYPGFARGIQGPELMEQMAAQAAHVGTQIIHDIITECTLKGHGGAGEPFRLVGDSGDVYLARSVVIAT
    GAQAKWLGIPGEAQYQGSGVSA
    CATCDGFFYRGRTVAVIGGGNTAVEEALYLTHHAEHVILIHRRDSLRAEKILQDRLFA
    HPKITVKWNCVVDEIVATGTPPVVTGLNLRDISSGTNEHLAVDGVFVAIGHAPNTAVFKDQVETDDEGYIVTNPGGTRTS
    VPGVFAAGDVQDRIYRQAVTAAGTGCMAALEAERYLAGMSH

    >gi|209545350|ref|YP_002277579.1| arsenate reductase and related [Gluconacetobacter diazotrophicus PAl 5]
    MARSVTIYGIKACDTMKKARAWLETHGVACVFHDYKSQGITREVLEGWVRQVGWEILLNRSGTTFRNLPDADKADLDAAR
    AIDLMLAQPSMIKRPVLDVDGALTVGFKPELYAVRLN

    >gi|209545352|ref|YP_002277581.1| heavy metal translocating P-type ATPase [Gluconacetobacter diazotrophicus PAl 5]
    MTSGQTITLPPSTSPPGALAPITVPIEGMSCAACAARIEKVLGRLPGVTASVNFATATATVERQGAPPPDAPGLGEIVGA
    IRKAGFDVPARHVVLAIDGMT
    CVACATRIETVLNRLPGVDAHVNFASGRADIDYVPGLSDPDALVRQVEKAGYGAALPHD
    VASGATGSEAADDAARHRAAWQRQVRLFALSVVLTLPLLAGMVAMLAGLHDMLPVGLQWVLATLVQFVCGRSFYRHAWNA
    VRGGGANMDVLVVMGTSVAWLASTATVALGLPGPLYFESGATVITLVLLGRLMEARARNRTREGVESLIRLQPQVAHVEI
    DGAIQDRPVTSLRVGDIFAIRPGESIPVDGTILDGRSDIDESMLTGESVPVGKGPGDPVSGATINRDGVLRVRARRVGAD
    TTLSRIVRMVQQAQGTKDPVQHLVDRVSAVFVPAVLAVAAVTFAIGWAVSGHPAGALGGTIAVLVIACPCALGLATPTAI
    MVGTGLGARAGLLFRNAEALERLHTVTTLIMDKTGTLTLGRPGVTDIVPAPGVAADTLLSAALALERNSEHPLARAIVDH
    AVSRDIEAAPVRDVRAIPGRGVQAQDADDSGATLRLGSPRFLAESGCGGDEPTVQRLEQDGRTVIGVARGSTLLGHIALA
    DQIRPDAAAGLAALRARGIRLVMLTGDNPRTAAAVASRLGLDETIAGVLPEDKAHEVERRRGAGRIVGMVGDGINDAPAL
    AAADIGIAMGSGSDIALDTADVVLMRSELRGLVDAMDLSRATLAKVRQNLFFAFIYNVLGIPLAAAGWLNPALAGGAMAM
    SSVSVVSNALRLNRWKPGSDALRSRPRTSNT

    >gi|209545373|ref|YP_002277602.1| Thioredoxin domain [Gluconacetobacter diazotrophicus PAl 5]
    MPFHRVLPRILPLAALLGLIATPALVTPALADMPPVPKVGQETPRPVAAPYGAPEGAQAQVDAAFRTAQASGRNVLIDFG
    GNW
    CPDCRMLAGVLALPSVAPWVAQRFVTVTVNVGRINTNLDIAQHYGVTIHAVPTVLIVTPQGRLLNPDGALALGDARR
    MSAQAVVDLLAGWDARDH

    >gi|209545428|ref|YP_002277657.1| iron-sulfur cluster assembly accessory protein [Gluconacetobacter diazotrophicus PAl 5]
    MTLPTEHTATPSRPARPLPPLMALTDRAADRLRVLYETAHAGQKLRIAVSTKGCSGHAYDMNFVDAAGPGDEVVTDKGVT
    VLVDRKATLFLIGTTMDYETRQLESGFTFSNPNEKGRCGCGESFHV

    >gi|209545494|ref|YP_002277723.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Gluconacetobacter diazotrophicus PAl 5]
    MPQILTKRVLTEPVDRRALLANGGTLLAAWLGCNSILAPRATAEEGPAPVALPTRAGHPPRALPDLAFTDEGGATHRLAD
    WRGRIVVLNLWATW
    CQPCVAEMPALSVLARQVAPAGDIAVLPVSVDHGGAATVRRFYHAHGIAGLPVLCDPDMRVPTALH
    EDGVPVSLVIDRGGREILRISGPVLWDAPDLPARLRHLAAGG

    >gi|209545653|ref|YP_002277882.1| peptide methionine sulfoxide reductase [Gluconacetobacter diazotrophicus PAl 5]
    MDDMTRAPRTEVAYLGGGCFWCVEAMLRELAGITDVAPGYAGGTLAAPTYEQVCSGRTGHAEIVRVTFDPAILSYADLVR
    IFFTIHDPTTLNRQGPDSGTQYRSVIFTATPEQAATARAVRDEIAASKLWADPIVTEILPLEQFYEAEDYHHNYFAKHPE
    RGYCAAVISPKVSKVRRSFQDRLALG

    >gi|209543590|ref|YP_002275819.1| alkylhydroperoxidase, AhpD family [Gluconacetobacter diazotrophicus PAl 5]
    MSIETLKERLPDYAKDLKLNLSSLANDITLSPQQLAGTFVASAIASRNADVTRAIVAEYESVLSPQALTAAKAAAAIMGL
    NNIYYRFVHMVEGDYAHMPARLRMNVIGRPGVEKLDFELWSLAVSAINGCGM
    CVESHEKVVREGGLSAEQVQTAVRVAAT
    VHAVAATLDGAAALGDHPAAG