Gluconacetobacter diazotrophicus PAl 5 FAPERJ

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|162145980|ref|YP_001600438.1| putative polyketide synthase [Gluconacetobacter diazotrophicus PAl 5]
    MKLEIWSDYACPYCYIGKRFLEAALAQFEHASEVEIVFRAFELDPTSGPAVTTTTLDRIMRKYGKSRSDAQAMIDHITSM
    GERCGLDMRYASVRYTNTFDAHRLTKFAEQHGHGTDMTERLFRAYFTDNSPLADHDVLVGLAQDVGLDGDAVRATLTGSD
    FAEDVRRDEARASQASIHGVPFIILDGAYTLSGAQPKAQLLAALRQSWKEARKTASENPTTGMTCDSTGCVIPPSGSGTP


    >gi|162146016|ref|YP_001600474.1| thioredoxin protein [Gluconacetobacter diazotrophicus PAl 5]
    MWDRRGMTMLGLGFIRRRAAGRRLEQDKQAGSGSMDYIIGQSRGGQRATGGLVDEAGVPAAPSGMAGAPAGPGGNGAMIV
    DGTQDTFMQDVLEASRTLPVLVDFWATW
    CGPCRQLTPVLEKIVRSAGGRVKLVKIDVDANRALAQQLTQVGLPLQSIPLV
    AAFWQGQILDLFQGAQPESEIKRFVEGLLKAAGGGSMPAADLIVAARAALEAGSAEEAAGLYAQTLEIEPENAAAWGGLV
    RALIVMGDEDAAEAALADVPARIADHAEITGARAALDLKREGRKAAEASEGLRRRLAANPADHEARYELAAALNAAGHRQ
    EAADELLTIMRQDRAWNDDAARLQLIRLFESWGHDDPATLQARRRMSALLFS

    >gi|162146083|ref|YP_001600541.1| putative carboxymuconolactone decarboxylase [Gluconacetobacter diazotrophicus PAl 5]
    MSDARHTRRAQGVGEPAEFTFAELDWTPWLDPLPESELTERHRDGLVDAARAKSPYFMLLARDPDILGARTRSDKDIFYN
    TDGGLPRRERELAAVAVSRFNGCIF
    CASVHARFSELQGGDHETIAALLRDGTLPADAPAPWLLTAETAERLSATPVEFSA
    VHVAALREAGFDDAAILDLINSASFFNWANRLMLSLGFPSGKTGSDRDA

    >gi|162146271|ref|YP_001600730.1| putative hesB protein [Gluconacetobacter diazotrophicus PAl 5]
    MIEMTPSACEAVRAAIAGAATPVEGIRIMVESGGCSGFKYMMGLVAAPEPSDVVVDIDGVKVFVDAESGPHLQGTKVDFV
    VTLEQSGFSFDNPNAASKCSCGKSFN

    >gi|162146295|ref|YP_001600754.1| putative regulatory protein ada (regulatory protein of adaptative response) [Gluconacetobacter diazotrophicus PAl 5]
    MRDRFGRNAPMVEMTDMTERDPRWARIVARDRRADGLFWYSVRTTGVYCRPSCPSRMAKPGNVRLHDTLGAARAAGFRPC
    RRCNPDGASPQDIGQALVVQACRLIAARDDMPSIADLARAVELSPSHFHRLFRAETGLTPHAYAAAHRAGRIRAELPRAD
    SVTEAIFDAGYGSSGRFYAQAADLLGMTPARYRAGGAGERIRFAVGQCSLGAILVASSARGVVAILIDDDPNTLVRDLQA
    RFPRAELIGGDEEYERHVALVVGFVEAPGIGLDLPLDIRGTAFQHRVWSALRDIPAGQTVTYADIARRIGQPQAVRAVAG
    ACAANRIAVAIP
    CHRVVRNDGALSGYRWGVDRKRILIDRERTAAPVPSARPEGRSS

    >gi|162146401|ref|YP_001600860.1| peroxiredoxin protein [Gluconacetobacter diazotrophicus PAl 5]
    MLTVGNKFPEFNLTSVPGGPEGLKGNFVQISDKSDAGKWKLVFFWPKDFTFVCPTEIVAFGKMAGEFKDRDTVVYGVSID
    SEFVHLNWRLHHDDLKGLQIPMLADIKRELSEACGVLSPEAGVAYRATFLVDPEGIIRHVSVNDLSVGRNPQEILRILDA
    LQSDELCPCNWKQGDDFLKV

    >gi|162146535|ref|YP_001600994.1| thioredoxin reductase [Gluconacetobacter diazotrophicus PAl 5]
    MPFIAAAWKDGSGPMTDAPTLTTDVAIIGAGPAGLFAAFECGMLKLDSLLIDALDCVGGQCAALYPEKPIYDIPGHPAIA
    GAALIEGLEQQIAPFDVPRLLGRRVERLSGHRGAFTLGTDRGETIHARAVIIAAGAGAFGPNRPPLAGLDGFEATGAVQY
    YVRRRADFAGTRIVIAGGGDSAIDWALALKDEAEKIWLVHRRDRFRAAPESLRQLDEAVAAGRIEKIVPYQLHGLRGTDG
    ALEGVEVATLDGDTRILPADRLLPFFGLSTDLGPIAHWGMDSIRSTIPVVPSSCETTLPGVFAVGDVAAYPGKLKLILQG
    FSEGAMAAHAIHPIVRPDTALHFEYSTSKGVPDRI

    >gi|162146540|ref|YP_001600999.1| putative thioredoxin [Gluconacetobacter diazotrophicus PAl 5]
    MSENTVAVSDATFESDVLKAEGPVLVDFWAEWCGPCKMIAPALDEIGAEFKGKLTVAKVNIDDNPGTPNKYAVRGIPTLI
    LFKNGQPAATKVGALPKSQLKEWVKSSL

    >gi|162146595|ref|YP_001601054.1| putative alkyl hydroperoxide reductase subunit F [Gluconacetobacter diazotrophicus PAl 5]
    MRPGNRPTSLEYGILPMLQDTIKSQLKDHFANLAHPIVLEASLDDSAPARDMAALLHEIAALSGKIRVSTDGVASRRPSF
    VIRREDAAGSVAFAAIPMGHEFTSLVLALLQVGGHAPKLPDDVTAQIRSLSGTYRFETYVSLS
    CQNCPDVVQALNAMSVL
    NPNISNITIDGALYQREVEDKNIMSVPQVYLNGQPFGSGRMGVAEILAKLDADAPKRIAERLKDLAPFDILVVGAGPAGS
    AAAVYAARKGLRTGLIAERFGGQVMDTAGIENFISVRETEGPKLAAALEAHVRQYDVEVISAQRVRELHAAAQPGALHHV
    VLESGASLRARTIILATGAHWRHLNVPGEEEYRTRGVAY
    CPHCDGPFFKGKPVAVAGGGNSGVEAAIDLAGISSHVTLLE
    RDPALRADRLLQDKLRSLSNVSIMTNAVITKVEGNGTKMTGLTVQDGSGTARYLDVDGVFVQIGLLPNTDWLRGTIERTA
    FGEIIVDGRGMTSIPGIFAAGDATTTPYKQIVIAIGDGAKAALAAFDYLIRLPG

    >gi|162146596|ref|YP_001601055.1| putative alkyl hydroperoxide reductase subunit C [Gluconacetobacter diazotrophicus PAl 5]
    MVLPIIPIGTNDFRPREICRTPVLSSTHRRTELMTTINSELKSFSTDAFHNGEFIKVSDQDVRGKWAVFFFYPADFTFVC
    PTELEDMADHYATFQDLGVEIYAVSTDKHFTHKAWHDTSPAIGKIRYVMLGDPTGAISRNFGVLVEDAGVANRGTFLIDP
    QGRVQYMEITAEGVGRTAESLIDKIKAAQYIAAHPGEVCPAKWKEDGATLTPSLDLIGKI

    >gi|162147025|ref|YP_001601486.1| putative methylated-DNA--protein-cysteine methyltransferase [Gluconacetobacter diazotrophicus PAl 5]
    MTWDTTMPQLSMHSPIGDLTLTEEDGAIIALDWGWGRDQDENPLLRHACDRLDAYFDGAPDPFADLVLAPHGTAYQRTVW
    QAVRAIPLGQTRTYRQIAQIAGGSPRSVGNANSVNPIPILIP
    CHRVVSVQGLGGYSGDGGLTDKLYLLGLERAPIPAHAH
    ETA

    >gi|162147088|ref|YP_001601549.1| molybdopterin biosynthesis protein moeB [Gluconacetobacter diazotrophicus PAl 5]
    MIPDFSEAEIQRYARHILLPEIGGTGQAALRAASVLIVGAGGLGSPLGLYLAAAGVGRIGLVDDDVVDLSNLQRQIAHTT
    GRIGQRKVESAAEAMRAVNPLVRVEPHATRLDAGNARALVGGYDLVCDGSDNFRTRYLVADACALERRTLVSAAVLRFEG
    QISTFRPHRGGPCYRCLYPAPPQDGAVPS
    CAEAGVFGAVTGVMGTLQATEALKEILEIGESLDGRLLVWDALAARFHTVR
    LAPDPDCALCGPHASIHDLSAHGAADVR

    >gi|162147208|ref|YP_001601669.1| putative carboxymuconolactone decarboxylase protein [Gluconacetobacter diazotrophicus PAl 5]
    MIDWSAYRRYLGQTMPKLAALTPGTVEGLTTLEEAAVTTGRLDAKTRELIALAVAVTTRCDGCIAVHSRAAVDAGATKEE
    IAEALGVAVALNAGAAAVYSTRVIDAVQKAAEAG

    >gi|162147213|ref|YP_001601674.1| 2-oxoglutarate dehydrogenase E3 component [Gluconacetobacter diazotrophicus PAl 5]
    MTIEIKVPTLGESVTTATIGKWLKQPGDSVAADEPVVELETDKVSVEVAAPAAGRLGAHAVAEGEEVAVGALLTSVEEGA
    AGAAPKAAAPAAAKPAPKAEAKPAAAPAPAATPAAAPPAETDYDVIVIGAGPGGYVCAIRAAQLGFKVACVEKRATLGGT
    CLNVGCIPSKALLQSSENYHAAAHDYAGHGIVLDSVKLDLARMMARKGEVVEANVKGVEFLFKKNKVTWLKGTGKLEGTG
    RITVDGKPVTAKHIVIASGSDSAGLPGVEVDEKVIVTSTGALELSAVPKKMVVIGGGVIGLELGSVWHRLGAEVTVVEFL
    DRLVPGTDGEIAKQFQRILTKQGLQFKLGHKVTKADKTGKGVTLTVEPAAGGTAETLEADIVLLAIGRNAYSKGLGVEEA
    GVALDKRGRIITDGHFATSVPGVYAIGDVIAGPMLAHKAEEEGVAIAEILAGQAGHVNYDAIPGVVYTWPEVATVGRTEE
    DLKSSGVTYKVGKFPFTANGRARAIGMTDGFVKVLAEATTDRVLGVHIIGPGAGEMIAEATLAMEFGASSEDIARTCHAH
    PTLSEALKEAALDVEKRAIHI

    >gi|162147216|ref|YP_001601677.1| putative peroxiredoxin [Gluconacetobacter diazotrophicus PAl 5]
    MLRTLLLRRCVRLGMALPLAIALSFMAVTSLSPARAALPPGSMAPLFDAPASLGGKQFHFALADALRHGPVVLYFYPAAF
    TRG
    CTIEAHDFADAMDQFKALGATVIGISMDKIETLDRFSVSECRSRFPVASDPAGRIASSYDSKMPLLHYASRTSYVIA
    PDGHILSAYSAMAPAGHITGSLAALRAWKAHGA

    >gi|162147254|ref|YP_001601715.1| hypothetical protein GDI_1459 [Gluconacetobacter diazotrophicus PAl 5]
    MLFLAPLVFLLALPSGRAGAAESAALTTTRDSATLVTDTDRYRPGMPLHVGLRLRLQPGWHTYWINPGDAGEAPTLAVQA
    GGGAAGASGTIAWPVPRRLPDGPLMSYGYTGEVLLPAELRPTGPGDGPMVLQATAEWLVCAAVCVPEQGRFTLTLPPGDP
    APSDQAPLFARAAAARPVASPFAAMIASDGVLAITGAGLSSDTVRDAWFMPTISGAIDQDAAQALSVHDGGLTLALKPGD
    AFHAAPTLDGVLVLKDAAGQERGLSVSARPGAVPTVTPGAVPGPAHSGAARMLLLAFAGGLILNLMPCVFPVLVMKAMAL
    TRLAGGGASARLAGAGAYAGGVIGAFVMLGGVILALRAAGAVAGWGFQFQSAAFVAAMCWLLFAVALNLLGVFGMGNGIA
    ALGGVGVSRTGYLGDAMTGVLAVLVATPCTAPFMGAAIAGALAASPVVAMAVFVAMGAGLAAPYLLLAGVPGLARHLPRP
    GAWMDILRQGLAFPVLGTCVWLMWVLALQDGAGAIAVLGIGLVLIGLAAWLTGLAQGMAMRDGPARRIRLCRAVALAALA
    LAMALLPGLGGTVSGGAGVSAADGSDRFRPARLATLRAQDRPVFVDMTAAW
    CISCLVNERVALSSAPVQTAFHDRHVVYM
    KGDWTNRNAAISAFLDAHGRAGVPFYLYYPPGSGDGRALPQILTTGLVLDALKG

    >gi|162147548|ref|YP_001602009.1| peptide methionine sulfoxide reductase msrA [Gluconacetobacter diazotrophicus PAl 5]
    MEGRRIMDDMTRAPRTEVAYLGGGCFWCVEAMLRELAGITDVAPGYAGGTLAAPTYEQVCSGRTGHAEIVRVTFDPAILS
    YADLVRIFFTIHDPTTLNRQGPDSGTQYRSVIFTATPEQAATARAVRDEIAASKLWADPIVTEILPLEQFYEAEDYHHNY
    FAKHPERGYCAAVISPKVSKVRRSFQDRLALG

    >gi|162147622|ref|YP_001602083.1| thioredoxin protein [Gluconacetobacter diazotrophicus PAl 5]
    MPVTRRTLIATAPALLAPGLAPRAARAADTDPRMSVRAAGNPAAKVHVEEWFSLTCTHCARFAGEVFPEIRTRLIETGKV
    YYIFRDFPLDQLALAAAMIARTLPPERYEPFVLSLLSSQDRWAFARDVNPQDELQKMAALAGMPADLFQKTIADDTLRQA
    IMDEENRAQAQYKIEGTPTFRFNDKVQVGQEMTYDDFAQKVASLA

    >gi|162147688|ref|YP_001602149.1| glutaredoxin-3 [Gluconacetobacter diazotrophicus PAl 5]
    MITGRYSRIRMPRIEIYTQPGCPYCVRALRLLEQKGTAFTEIRALHGTAERAEARERSGGRTTVPQIFIDGRHIGGCDDI
    MALDRAGKLDPLLHAA

    >gi|162147726|ref|YP_001602187.1| putative dihydrolipoyl dehydrogenase [Gluconacetobacter diazotrophicus PAl 5]
    MSKTEFDIVVIGGGPGGYVAAIRAAQLGLSTAVVEANHLGGICLNWGCIPTKALLRSSEINHLLHNLGEFGFAADNVRFD
    LDKVVKRSRKVAGQLSAGVAHLLKKNKVPVFDGFGKLAGTSGGRRKIEVTKDGKPVATLSAANVILATGARARVLPGLEP
    DGKLIWSYREAMVPTEMPKRLLVVGSGAIGIEFASFYRNMGAEVTVVEVLDRILPVEDEEISALAHKAFVKQGFTLLTGA
    KIGPIRKNGDSVSLSVEAGGKTHDITVDRVISAVGIVGNVENIGLEGTAIQVDRTHIKVDAYCRTGEPGVYAIGDIAGPP
    WLAHKASHEGVMCVEAIAGRHVHPIDPRNIPGCTYCRPQVASVGMTEAAAKAAGHTVRVGRFPFIGNGKAIAMGEPEGLV
    KTVFDAKTGELLGAHMIGAEVTEMIQGYVIARTSELTDAELKETVFPHPTISEAMHEAVLAAYDGALHI

    >gi|162147746|ref|YP_001602207.1| putative monothiol glutaredoxin [Gluconacetobacter diazotrophicus PAl 5]
    MADTITQRIQNDIDTNPVMLYMKGTAQFPQCGFSAKVVKILNHLGVPFQAANVLEDPELRQGVKDFTNWPTVPQLYVKGE
    FIGGCDIVSEMFQTGELEKLFVEKGIVTASA

    >gi|162147752|ref|YP_001602213.1| 3-mercaptopyruvate sulfurtransferase [Gluconacetobacter diazotrophicus PAl 5]
    MTGAVPAAGDVPGPRNREGIPAMHPLISPAQLQERLAAPDLVVLDATMALPGETFDPARCFAQAHIPGARRFDIELFSDP
    DSPLPHMIPTQARFEHLARGLGLSDGAHVVFYDQGNAASAARGWWLAGLFGLDRVQVLDGGLPAWQRAGGPVEQGEEGPA
    AAGGFRAAPRFARVSGLGDMRAHVGRGDRLILDARAQARFAGTAAEPRPGLASGHMPGARNLPFGTLLDANRAFLPPAAL
    RDRFAHVGVTDGRPVVTT
    CGSGVSAAVLSLGLAICGRTGDSLYDGSWAEWGSTPGAPVETGEGTSP

    >gi|162147861|ref|YP_001602322.1| putative glutathione peroxidase [Gluconacetobacter diazotrophicus PAl 5]
    MTTAYDFTLPSLDGGTIDLGALRGKPILIVNTASKCGFTPQFEGLQALWSFYRGNGLTIIGVPSNDFGNQEPGTSTEIAT
    FCARNYSVTFPMAARSHVRGADTLPLFRWIAQQGGLMARPRWNFYKYLIGRDGRLANWFVSLTSPESHRMRVAIERAILD
    T

    >gi|162148000|ref|YP_001602461.1| glutathione reductase [Gluconacetobacter diazotrophicus PAl 5]
    MTYDFDLFVIGAGSGGVRCARIAAGHGARVAVAENRHWGGTCVNLGCVPKKLMVQASEYNDLARDSHGFGWNIAPGHHDW
    AALIAAKDHEISRLNGIYVSLLEKAGVTLFTGTARFEDAHTLVIGPGALAPDAPVRRVTAERIVIATGSAPDMPSLPGIE
    HAISSDAAFHLESRPQRVCMVGGGYIGIEFAGIFRGLGSEVDLVYRQDLPLRGFDQDMRHGIHDAIAARGIRQHTGRSPV
    SIQPVGDAYEVRLDDGSHVIADCVFFATGRSPNVGALGLDHAGVDTVAGGRIVVDGTGETNVEGIYAIGDVTNRLNLTPV
    AIAEGHSLADRLFGTGHHPRSWSLATTPKAVFFSPPLATVGLTEEEAARDGIVDIYLARFTPMRHTLTGRARKTIMKLVV
    DQATQKVVGAHMIGDDAPEMMQGLAIAVTAGLTKADFDRTVGIHPTSAEEFVTMRTRTRVTDRQAD

    >gi|162148011|ref|YP_001602472.1| putative iron-sulfur assembly protein [Gluconacetobacter diazotrophicus PAl 5]
    MLPARGWYPMDTASTPTPDTRFRVSPQAVTRLEEIVAAEPAPEGAAAPGLRVSVLAGGCNGFQYSFALDGERRADDVLIP
    AGQSHVVVDPASMDLLDGAELHFNDSLMGAHFTIRNPNATSSCGCGTSFSID

    >gi|162148081|ref|YP_001602542.1| putative oxidoreductase [Gluconacetobacter diazotrophicus PAl 5]
    MPYFAPVRPPARRAARRRAALSGVAAAILLGLSTTGARAGDGGTFTADQRKEIVAIVRDALKTDPTILTDAIAALRAGAE
    AQEQATTRDALAANRAALGTPAPTDAILGAPHARMTIVEFYDPR
    CPYCRKVLPDLDRLVHDDPDVRIVEKVVAVLGPASL
    LTAQAIAAAALQGGQDAYFRMQRAIMADSQKPDAARIRTLAAQAGLDPDRLATDMAGSAVASTLRANSTLATSIHLEGTP
    TFVFDGRYVIPGAVDLDELKAAIAKVRRG

    >gi|162148432|ref|YP_001602893.1| putative peroxiredoxin [Gluconacetobacter diazotrophicus PAl 5]
    MTIHLGEIAPDFEQETTFGPIRFHDWLGDSWGILFSHPKDFTPVCTTELGAVAKLAPEWAKRNTKVIGLSVDPVGSHSEW
    ESDIARSQGASVNFPIIADADGTVAALYDMIHPSADPKVTVRTVFIIDPSKKVRLTLTYPPSAGRNFDEVLRVLDSLQLT
    DAHKVTTPANWTNGDEVIIAPSVGDEQARSLFPAGWKTVLPYLRLVPQPR

    >gi|162148461|ref|YP_001602922.1| putative benzene 1,2-dioxygenase system ferredoxin--NAD(+) reductase subunit [Gluconacetobacter diazotrophicus PAl 5]
    MTQDSPYRRDAPWHDVAPLEDLDPAIARRVEVEGHPVLLLQRENGQVRALAAECPHKGAPLEKGVVCGDRLVCPWHKAIF
    SVEDGRLLEPLALDPLASYPTEIRDGRVLVSLGARPLSSGTEGPAQSVLIVGAGAAGVAAAVSLREFGFAGSVTMVDSQD
    AAPYDRTALTKAVLAGKADGDMPPLLRPDGFWTDHGIDRVVGLVVALDAPSRAITLADGRVLAADHVLLAPGSTPRPLDV
    PGADLPGVFTLRQTVDAQRMLAA
    CPPNGRVVISGGNFIGMEAAASLTSRGMQVTIIAPDDIPFAKMFGREVGARLRRLHE
    ENGVVYSGGRRIVGMEGDQRVERVSLDDGTSLEDEIVLVGVGVQPATGFAAALAAPDGGIDVDDRMQALPGISVAGDCAR
    ITHGDSRVRIEHWRSAQVQGRQAARTITGRSGPSRFLPWFWTQQFGSKIEYAGYHEPFDDVTIEGDLDALHFVARLARNG
    RCVGLVTAGRPDVTAHAVLSGRLE

    >gi|162148539|ref|YP_001603000.1| putative peptide methionine sulfoxide reductase msrB [Gluconacetobacter diazotrophicus PAl 5]
    MAAFGRARATEHYPVTHTDAEWHRLLTPAQYNVLREAGTEMPYSSPLLTEHRPGRFACAGCDTAAFDARTKFESGTGWPS
    FDSALPHAVQERGDDSLGMERTEVRCATCGSHLGHVFDDGPQPTGLRY
    CMNGVALSFHTA

    >gi|162148540|ref|YP_001603001.1| putative peptide methionine sulfoxide reductase msrA [Gluconacetobacter diazotrophicus PAl 5]
    MTRAGLFGVSLVALTTFGVACHTAMGEPGPRILPAPVLAEPAPATHHASTVFAGGCFWGVQSVFEHIRGVTATRAGFDGG
    ARDTADYETVSSGDTEHAESVEVDFDPTQVSYGTLMRIFFSVALDPTQVNRQFPDDGTQYRSVLYTRSAQQAREAHAYIA
    QLDAAHVFTRPIATQVAPDHGFYPAEADHQNFAARYPDHPYIATYDAPRIEALHALFASSWRAQPVLTLADDGGS

    >gi|162148548|ref|YP_001603009.1| putative alkyl hydroperoxide reductase [Gluconacetobacter diazotrophicus PAl 5]
    MSLQAKLDAFKADFEAGKPPYNVPHAVIEVMHRATAELIAAGAAEKALKAGDRAPDFTLNDPEGNPVSTADLLAQGPLVV
    SFYRGVW
    CPYCNMELQALEAALPSFRALGANLIAISPQTAVNSRKSVRQNALDFPILSDTHNDVAAKFRLRFALPDYLVE
    LYRNLKNDLPGFNGDDSWTLPMPGRFVIGQDGVILYAEVNPDYTRRPEPEDMLPALRKAANVTA

    >gi|162148555|ref|YP_001603016.1| putative 4-carboxymuconolactone decarboxylase [Gluconacetobacter diazotrophicus PAl 5]
    MTQFTAYTTDTAPEAARPIFEGVKGAFGFVPNLQSYMAESPELLAGYTALWDLFSKTTLTAHEQQVVYLTSNYENECRYC
    MAGHTTLAKMQKMEAAVIEALRAGKPLPDAKLEALHHFTTLVVRNRGQVADANVDAFINAGFTRRNVLEVVLGVATKVMS
    NYTNHIVHTPLDDFMKGNEWTKPTGNAS

    >gi|162148740|ref|YP_001603201.1| putative Thiol:disulfide interchange protein tlpA [Gluconacetobacter diazotrophicus PAl 5]
    MPQILTKRVLTEPVDRRALLANGGTLLAAWLGCNSILAPRAMAEEGPAPVALPTRAEHPPRALPDLAFTDEGGATHRPAD
    WRGRIVVLNVWATW
    CQPCVAEMPALSVLARQVAPAGDIAVLPVSVDHGGAATVRRFYHAHGIAGLPVLCDPDMRVPTALH
    EDGVPVSLVIDRGGREILRISGPVLWDAPDLPARLRHLAAGG

    >gi|162148824|ref|YP_001603285.1| putative iron-binding protein iscA [Gluconacetobacter diazotrophicus PAl 5]
    MTLPTEHTATPSRPARPLPPLMALTDRAADRLRVLYETAHAGQKLRIAVSTKGCSGHAYDMNFVDAAGPGDEVVTDKGVT
    VLVDRKATLFLIGTTMDYETRQLESGFTFSNPNEKGRCGCGESFHV

    >gi|162148877|ref|YP_001603338.1| putative thioredoxin protein [Gluconacetobacter diazotrophicus PAl 5]
    MPFHRVLPRILPLAALLGLIATPALVTPALADMPPVPKVGQETPRPVAAPYGAPEGAQAQVDAAFRTAQASGRNVLIDFG
    GNW
    CPDCRMLAGVLALPSVAPWVAQRFVTVTVNVGRINTNLDIAQHYGVTIHAVPTVLIVTPQGRLLNPDGALALGDARR
    MSAQAVVDLLAGWDARDH

    >gi|162148902|ref|YP_001603363.1| putative heavy metal transporter [Gluconacetobacter diazotrophicus PAl 5]
    MPPSTSPPGALAPITVPIEGMSCAACAARIEKVLGRLPGVTASVNFATATATVERQGAPPPDAPGLGEIVGAIRKAGFDV
    PARHVVLAIDGMT
    CVACATRIETVLNRLPGVDAHVNFASGRADIDYVPGLSDPDALVRQVEKAGYGAALPHDVASGATGS
    EAADDAARHRAAWQRQVRLFALSVVLTLPLLAGMVAMLAGLHDMLPVGLQWVLATLVQFVCGRSFYRHAWNAVRGGGANM
    DVLVVMGTSVAWLASTATVALGLPGPLYFESGATVITLVLLGRLMEARARNRTREGVESLIRLQPQVAHVEIDGAIQDRP
    VTSLRVGDIFAIRPGESIPVDGTILDGRSDIDESMLTGESVPVGKGPGDPVSGATINRDGVLRVRARRVGADTTLSRIVR
    MVQQAQGTKDPVQHLVDRVSAVFVPAVLAVAAVTFAIGWAVSGHPAGALGGTIAVLVIACPCALGLATPTAIMVGTGLGA
    RAGLLFRNAEALERLHTVTTLIMDKTGTLTLGRPGVTDIVPAPGVAADTLLSAALALERNSEHPLARAIVDHAVSRDIEA
    APVRDVRAIPGRGVQAQDADDSGATLRLGSPRFLAESGCGGDEPTVQRLEQDGRTVIGVARGSTLLGHIALADQIRPDAA
    AGLAALRARGIRLVMLTGDNPRTAAAVASRLGLDETIAGVLPEDKAHEVERRRGAGRIVGMVGDGINDAPALAAADIGIA
    MGSGSDIALDTADVVLMRSELRGLVDAMDLSRATLAKVRQNLFFAFIYNVLGIPLAAAGWLNPALAGGAMAMSSVSVVSN
    ALRLNRWKPGSDALRSRPRTSNT

    >gi|162148904|ref|YP_001603365.1| ArsR family transcriptional regulator [Gluconacetobacter diazotrophicus PAl 5]
    MENGNMARSVTIYGIKACDTMKKARAWLETHGVACVFHDYKSQGITREVLEGWVRQVGWEILLNRSGTTFRNLPDADKAD
    LDAARAIDLMLAQPSMIKRPVLDVDGALTVGFKPELYAVRLN

    >gi|162148925|ref|YP_001603386.1| thioredoxin reductase [Gluconacetobacter diazotrophicus PAl 5]
    MSSALDGHIPCIVITSTPESMTQTHTTDLLVIGAGPAGYTAAIYAARANLKPILVAGLQPGGQLMITTDVYNYPGFARGI
    QGPELMEQMAAQAAHVGTQIIHDIITECTLKGHGGAGEPFRLVGDSGDVYLARSVVIATGAQAKWLGIPGEAQYQGSGVS
    A
    CATCDGFFYRGRTVAVIGGGNTAVEEALYLTHHAEHVILIHRRDSLRAEKILQDRLFAHPKITVKWNCVVDEIVATGTP
    PVVTGLNLRDISSGTNEHLAVDGVFVAIGHAPNTAVFKDQVETDDEGYIVTNPGGTRTSVPGVFAAGDVQDRIYRQAVTA
    AGTGCMAALEAERYLAGMSH

    >gi|162148999|ref|YP_001603460.1| putative peroxiredoxin osmC [Gluconacetobacter diazotrophicus PAl 5]
    MTIKKYGTAQWQGGLKDGKGTVSTESGALSAHPYGFNTRFGDVKGTNPEELVGAAHAACFAMALSNILGEAGLTASALDA
    KSVVSLDKQPDGFAVTAAHLTLTATIPGTTDAQFQELAAKAKAG
    CPISKLLKAEITLEATLKS

    >gi|162149116|ref|YP_001603577.1| putative peptide methionine sulfoxide reductase [Gluconacetobacter diazotrophicus PAl 5]
    MSRRRKDARPNGECGMTQVKTPTVCGVLTPEQVRVMREHGTERPGSSPLNHEKRTGLYRCAACGTPLFRSDTKYDSGSGW
    PSYYDALPGAVEEQVDTSHGMVRVEIHCASCKGHLGHLFPDGPPPTGQRY
    CINGVALEFVPA

    >gi|162149196|ref|YP_001603657.1| putative peroxiredoxin bcp [Gluconacetobacter diazotrophicus PAl 5]
    MPDSTTPTFPAPGAPVPDFDMPASRGRHVRLADMRGRPFILYFYPKASTPGCTTEACGFQEALAALGGTGIPVIGVSRDS
    MKAIDTFADKQGLDFPLASDATGTVTEAYGVWVEKSQYGRKYMGIERATFLVDAEGRLVRTWRNVKVPGHVAEVMTAAAT
    L

    >gi|162149212|ref|YP_001603673.1| putative thioredoxin disulfide isomerase [Gluconacetobacter diazotrophicus PAl 5]
    MTGTVPHPPNLARRRLLMAAPLAAAGVAGVAFWRMLSGMSQGSFDPHDIHAPVLNRPVPDFKLPDQTPGQGFGTADLRAL
    QAPVLVNFFASW
    CIPCVAEMPELNALKDRLPIWGIAYKDKPDDAAGFVKRAGNPYARIAGDLSGMTAIDWGVSGVPESFL
    VGPGGVIRWHSAAALDADTVRGTLLPLAASLHS

    >gi|162149388|ref|YP_001603849.1| putative peptide methionine sulfoxide reductase msrB [Gluconacetobacter diazotrophicus PAl 5]
    MTSRRQFCLASAAFLLAARPGRAAPPYAVSHSDAEWRRLLTPAQYDVLRRAGTEMPWSSPLLGEHRPGRFACAGCDTAAF
    DAGTKFESGTGWPSFYRALPHAVQERADHSLGMDRTEVLCATCGGHLGHVFDDGPPPTGLRY
    CMNGVALSFHPA

    >gi|162149389|ref|YP_001603850.1| putative peptide methionine sulfoxide reductase [Gluconacetobacter diazotrophicus PAl 5]
    MTRSGLLGISLIAMGALGTACHAADAPLATRLPPPAAAEAPATTHRATAVFAGGCFWGVQSVFQHIRGVTATRAGYDGGT
    KDTAEYETVSGGDTGHAESVAVEYDPTQVGYGTLMQIFFSVALDPTQVNRQFPDVGSQYRSALFTRTPEQATAARAYIRQ
    LNAAHVFARPIATQIVPDHGFYPAEEYHQNFAARHPEDSYIATYDAPRIEALKMVYGAQYRDDPILTLAAPGGP

    >gi|162149411|ref|YP_001603872.1| putative arsenate reductase [Gluconacetobacter diazotrophicus PAl 5]
    MCVTIYHNPACGTSRTVLGLIRDAGIAPTIIEYLKTPPSRDELAGLIARMGVPVRDVLRRRGTPHDELGLDDAGLSDDRL
    LDAIMAHPILINRPIVVTPLGVRLCRPAERVLDILPPRQGA

    >gi|162149593|ref|YP_001604054.1| putative peroxiredoxin protein [Gluconacetobacter diazotrophicus PAl 5]
    MRIGDAAPDFQARTSQGPVRLSDYRGRLLVLFSHPGRFTPVCTSEFVALARAADRFAALDCALLGLSVDSLHAHLAWIDA
    IRARFGVTIPFPVIEDPTMAVGRAYGMLDAAARDSATVRATYFIDPAGIVRATTSYPVSTGRSVAEMLRLVAALQRAAVG
    DVLTPEGWEPGADIVLPTIATADDMAAAGPSWFCRITPDPQA

    >gi|162148554|ref|YP_001603015.1| putative redoxin [Gluconacetobacter diazotrophicus PAl 5]
    MTGQLKNGDMFPNLVIPEVGGGTLRPANDLNGKYRVILIYRGHWCPFCNEQIAAFAQAADALSEAEIDVMAFSVDDETAS
    AAFAAKHHWPFPLGHSADVETIVERTGAYDMHHPSRGHFLETTGFILAPDGSIVNAVYSTRAIGRLVPGDVIRLIAFMRS
    LSK

    >gi|162146400|ref|YP_001600859.1| alkylhydroperoxidase protein [Gluconacetobacter diazotrophicus PAl 5]
    MSIETLKERLPDYAKDLKLNLSSLANDITLSPQQLAGTFVASAIASRNADVTRAIVAEYESVLSPQALTAAKAAAAIMGL
    NNIYYRFVHMVEGDYAHMPARLRMNVIGRPGVEKLDFELWSLAVSAINGCGM
    CVESHEKVVREGGLSAEQVQTAVRVAAT
    VHAVAATLDGAAALGDHPAAG