Gloeobacter violaceus PCC 7421 uid58011

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|37519598|ref|NP_922975.1| hypothetical protein glr0029 [Gloeobacter violaceus PCC 7421]
    MTADTRLFNQRFAKNFLPLPGFSVPAVGEAAPDFVLPRVGGAPVRLSDYRGRMPVVIAFTRIFTEKLFCPFCYPHLQDLK
    NRYGEIRQAGAELLMVTSTDPVQSAQVVADLALPYPFLFDPGCTLFQAYGAGQALGAPLPAQYIVDMTGTIVYRHLFSFI
    DSNASTDEVLAVLKALQKV

    >gi|37519607|ref|NP_922984.1| hypothetical protein gll0038 [Gloeobacter violaceus PCC 7421]
    MDHSPDFMKLVADAKTRVRECKIAEVRERQARGENFHLVDVREDSEWQAGHIPGARHIGKGVIERDIEQAIPERAAPIVL
    Y
    CGGGYRSALAADSLQKMGYTAVVSMDGGMRGWREAGYAEQRP

    >gi|37519956|ref|NP_923333.1| hypothetical protein gll0387 [Gloeobacter violaceus PCC 7421]
    MPVCTVEYRPPAIRSPPVQPGTIAPPVSHAESVPMGTAVSSKTPRVRAPELPPKFHWLNTDRPLRLKELRGRVVLLDFWT
    YC
    CINCLHILPDLKYLEDKYRDSLTVIGVHTAKFANEQDLDNIRRAILRHDIEHPVIVDESHTIWQSYTVRAWPTLVLID
    PDGYYVGHASGEGNRDLLDQLIGELVLRQTNQGRPLPGGLRTRLEKASAPPTPLAFPGKLTVYGDRLFVSDSGHHRIVTS
    SLDGSSHESIGSGIPGWRDGNFEEAEFWAPQGLALSADGRTLFVCDTENHLLRKIDLVRRQVSTFAGTGEQSLGYGQVEG
    PGLEIPLNSPWDAVVADGALYVAMAGSHQIWKCDPHSGRISTFAGNGHESTLNGTRDGSAFAQPSGITTNDHRLFVADSE
    SSSVRTVGIAEDITALLCGSGDLFGFGDQDGLGEAVLLQHPLGVHWDGGTLWLTDTYNHKIKRIDPESGRCETLTGHIDS
    GYLDGDLAEARFWEPAGLWRNGDRIYIADTNNHAIRVIDLVSRRVSTLKIRNLCAPGYCFPDSA

    >gi|37520075|ref|NP_923452.1| bacterioferritin comigratory protein [Gloeobacter violaceus PCC 7421]
    MAIEVGRPAPDFTLDGSQGPVTLSQYRGKNNVLLAFYPGDFTPVCTKELTCFVEDWSKFQGKDTVILGISSGSVDSKSKF
    AQSLGAQFPLLSDGEKRVAGLYDVSGFLGVARAYFIVDKQGVLRYKHVEALPFFKREDEELLGVLAEL

    >gi|37520133|ref|NP_923510.1| mercuric reductase [Gloeobacter violaceus PCC 7421]
    MSEQPIGIAPMDVHNTRLVAHTHPLDWVNPKPAGRYNLVVIGGGTAGLVSAGGAALLGGKVALVERHLLGGDCLVAGCVP
    SKALIRSARAMADVKDAHRYGIRVHGNVEADFGAVMERLRRVRADISPHDAAERFKNWGVDVFLGAARFTGPDTVRVGEV
    ELRFKRAIVATGGRAARPEIAGLAEAGFLTNETVFSLTERPERLVVIGGGPIGCELAQSFARLGSQVTLLHKNERVLDRE
    DPETSRIVGCALERDGVRVLTKARIEKVSRAGSIKTVHLAGGEQVACEAILLAAGRVPNVEGLGLEAAGVRYGKGGVEVD
    DRLCTSNPRIYACGDICLPWKFTHAAEASARIALENALFGGTLVLGQKKTSALTMPWCTYTDPEIAHVGLGEDEARKRGI
    AFDTIRLPLAESDRALTDGEEDGFIAVLLKQGSDKILGATLVARHAGEMISEITLAMVAGKGLATLSQVIHPYPTQAEII
    RKVADAYESRSLERLRPFTEKWLAWLR

    >gi|37520239|ref|NP_923616.1| hypothetical protein gll0670 [Gloeobacter violaceus PCC 7421]
    MIDHIGIAQSDSRPPVTSGPAVSSCLYKRYNRSFQMDNRLAFENIEPAAYRALLGLGSYVESSGLDPKVLDLIKIRASQL
    NGCAF
    CLDMHTTEARKAGEAEQRLHALAAWREAPFFSPTERAALAFGEALTQMAQERIADAVYTELAQHFSQEDAGKLLM
    AVIAINAWNRLAVATGLVAGTQEQHFRQLRQRGILAGEAVK

    >gi|37520288|ref|NP_923665.1| thioredoxin reductase [Gloeobacter violaceus PCC 7421]
    MEQFDFDVVIVGGGPAGCTCALYTARSELKTVILDKNPAAGALAITHKIANYPGVPGEMSGDHLLEVMRDQAVEFGTVYR
    RAQVYGLDLSEPVKKVYTPEGIFTGRALVLATGAMGRIASIPGEAEYLGRGVSY
    CATCDGAFYRNREVVVVGLNPEAVEE
    AQVLTKFASTVHWITPKDPHTLDGHADELLAHPSVKLWEKTRLIRIKGEEAGVTAVEVRHPGESDSQELLAEGVFVYLQG
    SKPITDFVAGQVEMKPDGGVWVDEMMQTSVPGVWGIGDIRNTPFKQAVVAAGDGCIAAMAIDRFLNSRKAIKPDWAH

    >gi|37520449|ref|NP_923826.1| thioredoxin [Gloeobacter violaceus PCC 7421]
    MSAAVPVGDSNFKTEVLDSELPVLVDFWAPWCGPCRMVAPVVDEIAQQYSGKLKVVKVNTDENPQVASQYGIRSIPTLMV
    FKSGSKVDMVVGAVPKTTLATTLEKHIDIK

    >gi|37520899|ref|NP_924276.1| periplasmic substrate-binding protein [Gloeobacter violaceus PCC 7421]
    MTAASPLGSLSPDLEQRIVTLIPSATEIVAVLGLASRLVGRSHECDYPESVRVLPVCTRPKFDPVGTSREVHERVSKLLA
    TALSVYEVDLAMLEQLAPTHILTQAQCEV
    CAVSLSEVEAAVAGLTGGQPHILSLQPNVLGDLWEDIARVGTALGVPSAHV
    VQSLRARVKACYEKAQSAGTGRRVACIEWTDPLMAAGNWVPELVEMAGGVNLFGVTGKHSPWLEWTALAASDPEVIIFMP
    CGYDLAATRKAALALAESQPEWTSLTAVRKGEVFIVDGNQYFNRPGPRLVDSLEILAEILHPGLFAFSYAPHGWERL

    >gi|37521061|ref|NP_924438.1| hypothetical protein glr1492 [Gloeobacter violaceus PCC 7421]
    MGKIGNIERLNIRQSMHRRSIAVLLAGLLVAPGAIAAEPAAVPPADLEKQVLEIIQRHPEVVYNALRAYQSQAVRAQRRA
    EWQRQLENPVKVDLQGAPTLGPADAALTLVEFSDFQ
    CPYCSRAQSTVKALLEKYKGRIRLVYLHLPLPVHSQAKAAALAA
    FAAGEQGKFFAYHDRLFALGEQLVPESFEQIARELNLDVARFNRDRESPQALARLEADLAQARRLELDATPSFVLNGIVL
    KGALPIEEFEEAIKLLQSKSG

    >gi|37521287|ref|NP_924664.1| thiol:disulfide interchange protein [Gloeobacter violaceus PCC 7421]
    MESAPENKTGIWLRNGIVALASVLIAVLVFFAARNQAPTMQQLAAEAVPLDEALANGKPTLVEFYADWCASCQTMAPTVA
    RLKERYGEQANFVMLNVDNPRWLPELQQYKVSGIPHYAFLDAAARPLGSAIGLQPSQILEDNLTALAAGAETLPKAGAPA
    GQTSKFTPPKKVDQPRDHS

    >gi|37521388|ref|NP_924765.1| methionine sulfoxide reductase A [Gloeobacter violaceus PCC 7421]
    MIFKGFCHTMPLRRLAFVRFLGRALPIVALSAGTLACSASSATTPDPATDAALTSAVGPQTAVFAGGCFWGVEAVFEHLK
    GVEDAVSGYAGGDASTAKYAAVGSGRSGHAEAVRITYDPSKITYGQLLKVFFQVAHDPTQLNRQGPDQGTQYRSAIFFTD
    GEQQRIAQTYIEQLDKARVFPQPIVTQLAPLQKFYLAEPYHQDFVKLNPAHPYVVFHDLPKLAQLRKQFSNLYQDQS

    >gi|37521674|ref|NP_925051.1| hypothetical protein gvip289 [Gloeobacter violaceus PCC 7421]
    MINLTETALQEVRRLQKKSGNDRQFLRLGVVNAGCSGMSYTMKFDTESRADDHLFDQDGVRVAVDAASLPYLGELTLDWS
    GDLMGGGFRFHNPSATHTCGCGSSFSTNPEAAIAAH

    >gi|37521677|ref|NP_925054.1| hypothetical protein glr2108 [Gloeobacter violaceus PCC 7421]
    MARTASTMMELDTLAPAFVLPDVSTGQMLTLASFAGQPALLVMFICRHCPFVKHIQGELARLGKDYADSGLAIAAISAND
    AVKYPVDSPESLKEMVDELGFTFPVLYDESQQTAIAYQAACTPDFFLFDAARRLVYRGQLDDSRPGNDLPVTGKDLRIAI
    DAVLGGKAPAIEQKPSIGCNIKWKEGNTPPYYG

    >gi|37521713|ref|NP_925090.1| hypothetical protein gll2144 [Gloeobacter violaceus PCC 7421]
    MSTPATPNRLLHEKSLYLRKHAYNPIDWLPWGPEALAKAEHEDKPLFVSIGYSSCHWCTVMENEAFSDPEIAGFMNAHFV
    AIKVDREERPDIDAIYMQALQLMNQQGGWPLNIFLTPGDLVPFYGGTYFPVQDRYGRPGFLRVLEAIHDYYRGQRERLGD
    HKERMLGALEAATRLQPLSELPPDPLRRAVPPLRALLARDGMGPSFPMIPHAGFALRMGRFLEVELAQSACERGEDLATG
    GIFDHVGGGFHRYTVDGTWTVPHFEKMLYDNGQIVEFLSDLWASGLHIPAFERAVEFTHRWLLREMTDGRGYFYAAQDAD
    SEGEEGKFYVWSASELQEILSGEELAALESAFFLSAEGNFEGRTTVLQRRSGDVLAPVVETALTKLFGVRSRRVPAATDT
    KLIVSWNALMIAGLNRAADVFGRPEYRETAVGAARFILEHQRAPGEFYRLNYDGEPAIPAHAEDYACFIKALIDLYVSTQ
    QGEWLEAARALQQQMDERLWDLEMGGYFSAPSGPDLLIREKDFQDSATPAANGLAAANLVRLFLLTDEPAYLEAAEALLR
    QFARILAEVPRAGPSLLAGYDWYRNQVLVQSDPERIAELLRGYWPTAVFKAVDVKPAVALVCEGLRCLEPIESEAQLEAQ
    LRTSLVRAEN

    >gi|37521724|ref|NP_925101.1| AhpC/TSA family protein [Gloeobacter violaceus PCC 7421]
    MALRLGDKVPDFTQESTEGPIQFYDWAGDSWVVLFSHPKDFTPVCTTELGEVAKLKPEFAKRNVKVIALSVDDVDSHKGW
    AQDIEETQGAALNFPVLADADRKVSDLYDMIHPSANDTLTVRSVFVIDPNQKLRLTLTYPASTGRNFDELLRVIDSLQLT
    DNYSVATPANWQDGEDCVIVPSLKDEAVLKEKFPKGYTVVKPYLRMTPQPNK

    >gi|37521937|ref|NP_925314.1| hypothetical protein glr2368 [Gloeobacter violaceus PCC 7421]
    MRIPPIEPESADKQLKTVYDALKKQYGTELNPLKVLAHRPQVMRAVMNLYGAIHTHSDTISDELKELISLRVAQINSCRD
    Y
    CVPMHTYMLHKQGTVEEKIRALPRSATSDLYSEAEKVALEYAERITVPSTMVTEGLFERLKAHYGEGDIVELTAVISTL
    NFWTKFIDALEIPLDDVFKE

    >gi|37521944|ref|NP_925321.1| bacterioferritin comigratory protein [Gloeobacter violaceus PCC 7421]
    MALNVGDKAPDFTAKDTHGNTVSLASLAGKKFVLYFYPKDDTPGCTKEACSFRDNWSTYQAQGLGVYGVSMDDEASHQAF
    TSKYALPFPLLADTDGTLAKAYDADAGNYAKRITYVIDEAGKIAQVFTSVNSASHASDVLAAVGV

    >gi|37521945|ref|NP_925322.1| bacterioferritin comigratory protein [Gloeobacter violaceus PCC 7421]
    MSEPLNVGDPAPEFAAEQTSGERLSLADLRGKKVVLYFYPRDNTPGCTKEACALRDRYARLQAAGVTVVGVSTDGVRSHQ
    KFTEKFALPFALLADTEGAIAQAYGAWGEKKFMGRTSIGILRHTVVIDEAGRIAHIYRKVKPEEHADQILRDLGIAFEA

    >gi|37522085|ref|NP_925462.1| methionine sulfoxide reductase A [Gloeobacter violaceus PCC 7421]
    MGLFNKQVQMPTTAQALPGRAQRMPVSVPHHVNGRPLQPPFPQGTEQAMFGMGCFWGAERVFWQAEGVYTTAVGYAAGLT
    PNPTYREVCSGMTGHNEVVLVVFDPRVISYERLLQIFWENHDPTQGMRQGNDAGTQYRSGIYCSTPEQKQIAEASRAAYQ
    QRLTAAGLGRITTEVLDAPEFYYAEDYHQQYLSKNPGGYCGLGGTGVACPVGALESRPTAP

    >gi|37522440|ref|NP_925817.1| hypothetical protein glr2871 [Gloeobacter violaceus PCC 7421]
    MEKADVIVIGSGQGGVPLAVDQARSGRRVVLFERGALGGSCINYGCTPSKALLAAAHAAGRARLAAPLGIHAEVTVDFAR
    VMERVRGIRASFRQGIEQRLADAGVQIVHAEASFAGSSTVVGGGVEVQAPLVVINTGTGPTIPELPGLAGLPLLTNLNIF
    DLETLPRCTLILGGGYIGLELGQGLARLGSEVHIVHNHERLLNHEEPEVGEVLAEALRRDGIHLHLQSEVSQAVYQDGIC
    ALTLEDGQILRGEAALLAAAGRTPNTAALGAPAAGIALDKQGYVAIDEHFRTTAAGVYAIGDVARQPAFTHVSWEDYRRL
    QAILGGEERTRSDRVLGYAVYTEPQVGRVGLTLDQALAKGHRARSVTLPMAHIARAIEWGHDLGFYRLVVDEDTDKILGA
    TLVGYEAAEIVHVLLAHMQADSTWKVLEQSVHIHPTYCEALPSLARLLKQ

    >gi|37522503|ref|NP_925880.1| hypothetical protein gll2934 [Gloeobacter violaceus PCC 7421]
    MILKREHFDEKQAQLYDVIIAGGGAGGLSAAVYLARYNLKVLVIEKGRGRSFWMQDLWNYVPRVVSGKELIEGGKEMALH
    YGADWLNGFVEAVTDTGEEFQVRVKYRFKNSDYPVFRAKYLIAATGLMDVLPQLENMQNVYEYAGYNLHV
    CLICDGYEMT
    NRRAALIAGSEKAINTAFVLNWFTPYITVLTLGAYPVGDEMRAKLADHGYPLIEKPIARFLGKDHVMDGIEFADGTSIKV
    DTGLISMGSIRHDGYLKNLDLLTDGGDIVTEYDCRTSHPRVFALGDLKKGLNQVSIAVADGTLAATAIWKEIRRASAPRK
    WTAPLQEAAARAEESARPEISLGAPRGG

    >gi|37522589|ref|NP_925966.1| hypothetical protein gll3020 [Gloeobacter violaceus PCC 7421]
    MTSAPLSWAELEALTDFQLDTVNGPTNAQARLRLFGLSESAVRVTLYRDNHAWCPYCQKIWLWLEEKQLPYRIEKVTMFC
    YGQKESWYKRKVPSGMLPAVELDGRVITESDDILIALERTFGPLGSGMEDPTVLPLRRLERLLFRAWCTWLCYPAGSSRE
    EQRNRDQFKAVVATVEDALGRTLGPYFLEQFGTADVIFTPYVERMNASLYYYKGYSLREENPHLAAWFAAMESRPTYRGT
    QSDFHTHVHDLPPQMGGCWENGEPQMQRNKARVDHGPWAGLPDVAYPEPKNSRTEALRRVLKHRTNIIRVNPADRRLFDE
    ALRCALTHLITGQVCTPPPGSDPALRYLRDRINVPRDMSIYAARRLRESLEHTAALVGDGQGPPLPVQHRRDQDPANFAG
    V

    >gi|37522598|ref|NP_925975.1| dihydrolipoamide dehydrogenase [Gloeobacter violaceus PCC 7421]
    MAFDYDLLIIGCGVGGHGAALHAVAHKLKVAVVEARDLGGTCINRGCIPSKALLAAAGRLRVLRESEHLGISVGEISFDR
    AKIAHHAASVVDKIRADLTKSLQKLGVTILHGHARLKGSQTVEIDPGEGGGEVQVLTARDVLIASGSQPFVPPGIVTDGK
    TVYTSDEGVRLEHLPEHICIIGSGYIGLEFSDVYTALGTKVTMIEALDRLMPGFDPDIARLAARLLVKSRDIDTKVGVFA
    KKVTPGQPATVELSTGEQLQFDAVLVACGRTPDTKNLGLESVGLETARGFIPVDGRMATSAEHLWAIGDATGKMMLAHAA
    SAQGIVAVDNMLGHERTIDYRSIPAACFTHPEIGFVGLTEPQAKEQGYKVGVVRTYFGGNSKAIAQGDTEGMAKIVYDQT
    TGELLGCHIIGPEASLLVAEAAQAIAGRDRIERLAHLVHTHPTLSEILDEGYKRAAAVL

    >gi|37522726|ref|NP_926103.1| hypothetical protein gll3157 [Gloeobacter violaceus PCC 7421]
    MALRMRAPLPSLAGVPTWINGGEPKPEDYQGKVVLVHFWSISCYICHDVVAQFNAIRDEYQPKGVVVLSVHQPRSEAELD
    TGAVTKDAVEAMLLTQPCAIDSEHTLVERFTNEYVPGYYVFDRKGEMRHFQTGGKGYERITKALDRCLVEG

    >gi|37522727|ref|NP_926104.1| peroxiredoxin [Gloeobacter violaceus PCC 7421]
    MTASVGLPAPSFTLKSTKGATSPKNLGEPIALTDYRGKWLIFFFYPLDFTFVCPTEILALSDRYEEFQDLDTEVLGCSCD
    SVFSHWAWISTPREKNGIAGLKFPLVADFTKDVAEAYGVLNEKEGYSQRGLFIIDPDGILKYATITDDNVGRSVEETIRV
    LQALQNGGLCPGDWKPGQKVLEVV

    >gi|37522909|ref|NP_926286.1| hypothetical protein glr3340 [Gloeobacter violaceus PCC 7421]
    MSQSTHEKIDSLVKNNKVLIFMKGTPQFPQCGFSAASVQILSSLGHPFEAVNVLDDFEIRQGIKDYANWPTIPQVYVDGE
    FVGGCDILIEMHNRGELKPLLDQAFEGEGAKA

    >gi|37522924|ref|NP_926301.1| hypothetical protein glr3355 [Gloeobacter violaceus PCC 7421]
    MKSYLKTTEQVYEQAALTPQPALCCVQQARPHLPGLVIPPVMEAMNYGCGSTVHLQDFAEGQRMLYIGVGGGLEALQFAY
    FARHPGGVVAVDPVAAMREQARRNLQTAAALNDWFEPDFVELVDGSALALPLPDGAIDLVAQNCLFNIFEPDDLLTALQE
    VRRVLVPGGRLVLSDPIASRPIPPHLQADERLRAM
    CLSGCLPLEQYLGCIVEAGFGQIDIRARRPYRVLDSARYGLDANL
    LLESIELAAYNVPVPADGPCIFTGRTAIYTGQEEHFDDRAGHILPVGLPAAV
    CDKTADKLARLHHSDLVITAPTYHYQGG
    GCC

    >gi|37522957|ref|NP_926334.1| thiol:disulfide interchange protein; TrxA [Gloeobacter violaceus PCC 7421]
    MVTMKRRALAGALAAAVAGWPVTASTGKPQLLEFWASWCGVCRAMEPTMAALKERWGKQVDIRIVDVDEPENAALVRRYK
    IFGTATFVLLDGRGKEAYRGSGQIPQTVFESEFKKVL

    >gi|37522958|ref|NP_926335.1| bacterioferritin comigratory protein [Gloeobacter violaceus PCC 7421]
    MRKLLLKSSLLFALLLAGPQAALLAAPRVGEAAPAFELPVAAGKKISLKDFQGKWLVLYFYPKDMTSGCTIEAQRFQKDL
    AQYKQLGAEIVGVSADALDSHSMFSKKEGLTFLLASDVGGKVAQAYDSWYGLGDMGMAARNTYLIDPQGRVAKVFSNVDP
    TGHSREVLSTLKQIQAKAQR

    >gi|37522981|ref|NP_926358.1| hypothetical protein gll3412 [Gloeobacter violaceus PCC 7421]
    MLNPDTTTIELSRDELERYSRHLILPEVGLEGQKKLKAASVLCVGTGGLGAPLTMYLAAAGIGRIGLVDFDVVDASNLQR
    QIIHGTSWIGKPKIDSATDRLQEINPHLQIDRWPVRLSSENALDICRDYDLIIDGTDNFPTRYLVNDACVLLGKPNVYGS
    IFRFEGQSTVFHYEDGPCYRCLYPEPPPPGLVPS
    CAEGGVLGILPGVIGVIQATEAVKIILGIGTTLKGRLMLYDALNMK
    FRELKLRRNPECPVCGDHPTVTSLIDYEEFCGIPQARAEEEKAKATMKEITATALKQMLDAGKDVVVVDVRNPDEFAAAR
    IPGTTLVPLPEIEQGPGIEKVRSLINGSELVLH
    CRSGMRSAKALQILQSVGIEGTNLKGGIHAWSDEVDPSVPKV

    >gi|37523179|ref|NP_926556.1| methylated-DNA--protein-cysteine S-methyltransferase [Gloeobacter violaceus PCC 7421]
    MTLQPEAVAAVASQLQAYFAGERRSFDLALAPVGNAFQQTVWRQLCRIPYGVTITYGELAGRIGNPSAARAVGRANALNP
    IAIVVP
    CHRVIGSDGSLTGYAGGLARKAALLALEGTTLNLGWSP

    >gi|37523190|ref|NP_926567.1| hypothetical protein gll3621 [Gloeobacter violaceus PCC 7421]
    MLFRNPVGMQEKLTMKDALTNRRALLDLLGAAAAAAGIRLWADSPAVRAMETGSAPPLPLRGPLPDFTGITQWLNTPKPL
    TVADLKGSVVLVHIWTFA
    CINCQRTLPYVVRWHETYAARGLRVVGVHTPEFAYERDIENIRRAMQQHRITYPNAVDNRFA
    TWKAYNNEYWPHLFLADRQGRLRYDHIGEGAYNTTERVIRTLLDA

    >gi|37523252|ref|NP_926629.1| glutaredoxin [Gloeobacter violaceus PCC 7421]
    MNPKVEIYTWQFCPFCIRAKALLKQKSVAFSEYAIDGDEAARSAMAERADGRRSVPQIFIDGKHIGGCDDLYALDRSGQL
    DPLLVAS

    >gi|37523532|ref|NP_926909.1| thiol-disulfide interchange protein DsbD-like protein [Gloeobacter violaceus PCC 7421]
    MRWLTFVMFWFAVGFAVLTVPVAAIPVRSAHTEAELISEVRSVQPGRPFWVALRLKMDPEWHTYWLNPGDSGTATTLQWQ
    QPAGIQAGPLRWPYPQRIAAPPLASYGYEGTVYLLSEIQAPADLKPGAKLALRAKAEWLECKVECLPGAGTVALELPVQA
    EATAPSVHADAIAAARGRLPVTIADWKLRAAVQEGQLILRATRPEWFAGEIGPVTFFPEQDLLIEPAAPQVLEVRPDGFL
    LKLKRSAVSTATPERIAGVLVAPAGWRGAGSEQALSVRVALEPVAAVLSAGAPDLAGLLVAVGFAFLGGMILNLMPCVLP
    VLSIKVLGFVQEARTGHAWRYGLAFTAGVLASFWLLAGGLLLLRAGGEQLGWGFQLQSPPFLVILCAVLFLFGLNLFGIF
    EVGTSLTRLGGAGPAGGLGGSFFSGVLATTVATPCTAPFMGSALGYALTQPVWAALLVFTALGLGMASPYLLLSLSPALL
    RFVPKPGAWMETFKQAMGFLLMGTVVWLGWVLGLQAGVSALAALLAALVVLGAAAWALGKWGHMAAPAPTRLTARVLAAL
    GIVGALGVALVGVEQQSAASSGPTQATATPSEGIRWEAFSPQRVAALRAAGTPVFIDFTAAW
    CLSCQVNERVAFSSPQVR
    EAFARGGFVMLKADWTKRDAAIAQALAQFGRSGVPLYVLYGPTAGAPPRILPEVLTPDIIVKALQELS

    >gi|37523533|ref|NP_926910.1| hypothetical protein glr3964 [Gloeobacter violaceus PCC 7421]
    MKRKAFVMAALSLALVAANVSTVQADALVGQPAPSFTAADTNGKSHALTDFKGKYVVLEWTNYDCPFVVKQYSTQAMQEM
    QKMAAGKGVVWLSVNSSAAGKQGNYPAEKWNTLVKEKGAAPKAILLDGDGKIGQLYGAKTTPHMYIINPEGKLIYNGAID
    DKPTTDAATKPQTNYVAAALTEAMAGKPVTVATTRPYGCSVKY

    >gi|37523588|ref|NP_926965.1| hypothetical protein gll4019 [Gloeobacter violaceus PCC 7421]
    MPTKVFKSEAEWKKILTPEQFLITRKKGTERAFTGKYHDTKQAGIYQCVCCETPLFSSAQKYDSGTGWPSFWGPVNPKNI
    ATKADFSLFMRRTEVLCAVCDAHQGHLFNDGPPPTGLRY
    CINSAALKFVKLPLVSRLGRGFIEYLTSQA

    >gi|37523612|ref|NP_926989.1| glutathione peroxidase [Gloeobacter violaceus PCC 7421]
    MATVSDITVQTVDGQARSLGRYKGQVLLIVNVASYCGYTPQYAGLEKLYRRYKDAGLRVLAFPCNDFGGQEPGSNAEIAE
    FCSRYDVSFELFDKVGARGYYKHPLYVRLSEAAEPAGEVSWNFEKFLIAKSGEIVGRYRSGIGPEDPQLVADIERELAKS


    >gi|37523615|ref|NP_926992.1| hypothetical protein gsl4046 [Gloeobacter violaceus PCC 7421]
    MAIELKITGMTCAGCEAGVARILQAQPGVAAVTVDLSTGRAIVEGDADPERLTAAVDAQGFGVEVVGAR

    >gi|37523616|ref|NP_926993.1| cation-transporting ATPase [Gloeobacter violaceus PCC 7421]
    MSKSLEVEVRGMTCASCASRLERVLGGIDGVVAASVNLATERAQVSYVPPAEPAHLRAAIEAAGFKVPAAADTANTDART
    LETEALKASVIFSAAFAVPLAVLAMLPMLWPALETAMMAAAPEAVWRWLMFALATPVQFGPGLRFYRSGWASLRHGAPDM
    NALVMIGTCAAYFYSATAVLFAGWFPAGTGHVYFEASAVVITLILLGRYFESLAKGRASEAMKRLLNLQPPTARVVRDGI
    EQEVPVEAVAVGDVVAVRPGEKVPVDGEVISGASYVDESMITGEPLPVAKGEGAAVVGGTINQNGAFRFRVSRVGAGTVL
    AQIMRLVETAQASKPAIQGLADRVVAYFVPVVLVIAALTFVLWVVFGGPAAVGFALVNTVAVLIIACPCAMGLATPTSVM
    VGTGKAAELGVLFRRGAALETLANVQVVALDKTGTLTRSRPELTDFLAQPGFERQEVLILVAAAESMSEHPLARALTAAV
    GDVALPEAERFAAVPGYGIEAMVQGRRVQVGSERYMGRLAVATDAVASRAVALAAAGKSPIYAAVDGRLAAVLAVADPIK
    PESRAAVEQLHRQGLEVVMVSGDNRRTAEAIARELGIETVIAEVLPDAKAETVRKLQSAGRTVAFVGDGINDAPALAQAD
    VGIAIGTGTDIAIETGEVILMAGDVGGVPNAIALARTALTNIKVNLFWAFAYNVLLIPVAAGVLYPALGWLLNPVLAAAA
    MGFSSLFVVSNALRLRRFRPPLTHHAA

    >gi|37523718|ref|NP_927095.1| hypothetical protein gll4149 [Gloeobacter violaceus PCC 7421]
    MDPFACVFLPMPYQEISVAELQRKLASQAEGTQFVDVREPEELEQSRLDGFINLPLSHYQEWSMRLGEILDPQKETIVLC
    HHGMRSADMCSFLLRRGYENVKNVQGGIHAYSLYVDPNVPRYM

    >gi|37523770|ref|NP_927147.1| glutathione reductase [Gloeobacter violaceus PCC 7421]
    MQKHYDLVVLGTGVAGSSVAKRCREAGWKVAVVDSRPFGGTCALRGCTPKKVLVQAGELLDRWRHLAGKGLRAEEARIDW
    PELMRFKRSLIEPLPAAREAEYAEAGIESYHGVARFVGATALEVEGAHLQGEKVLIATGSRPATLGIEGEEHLASSDDFL
    ELGTLPRRIVFVGGGYISMEFAHLAARAGSQVHVLHQDERPLAPFDPDLVDRLIEATRELGALCLCHKVKAIEKTAQGLL
    VHTDGDGGPYAADLVVHGASRVPNVEALDLDGAGVEAGKKGIKVNAHLQSVSNPAVYAAGDVADAPGPQLTPVAGLHAET
    VAENLLKGNTRSLEQAVFASTVFTVPALAGVGLLEEQAQAQGLHYRVLQADHRDRLAVRSLAAPYAAHKILVEEPGGRIL
    GAHLLGPFATEIINVFALAIQAQVDIDQLRATHFAYPTGSSEIFAMLSKG

    >gi|37523908|ref|NP_927285.1| hypothetical protein glr4339 [Gloeobacter violaceus PCC 7421]
    MQKVLKSDQEWRQQLTPEQYKITRQKGTERPFCGVFYDHKQPGEYTCVCCELPLFTAEAKFDSGTGWPSFLAPINAENVA
    TQKDFSHGMSRVEVLCARCDAHLGHVFTDGPPPTRLRY
    CLNSAALEFVPQVKS

    >gi|37523951|ref|NP_927328.1| hypothetical protein gll4382 [Gloeobacter violaceus PCC 7421]
    MTTSIDTAPARRLPRRGIQMTESALAEVMRLRERRGGDLMLRVGVKGGGCSGLSYTMDFEEESNVTAHDEVFDHSGFKVV
    SDKKSLLFLYGLVLDYSDELLGGGFKFNNPNAERSCSCGSSFSA