Geodermatophilus obscurus DSM 43160 uid43725

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|284988731|ref|YP_003407285.1| peptide methionine sulfoxide reductase [Geodermatophilus obscurus DSM 43160]
    MFFSRFKTQPVAPADALPGRSTPLPSVPELHAVNGNRIRPPFPEGMQTAVFGAGCFWGVEKVFWEQPGVYSTAAGYAGGY
    TPNPTYEEVCSAQTGHTEVVLVVFDPAVTSYEQLLKVFWEDHDPTQGMRQGNDVGTQYRSAIYVQGPEQEAAARASREAF
    QQRLTAAGYGEITTEIAPLGDFYYAEDYHQQYLYKVPNGYCPINSTGVACPVGLSGV

    >gi|284988848|ref|YP_003407402.1| Rhodanese domain protein [Geodermatophilus obscurus DSM 43160]
    MGRVMPQQVPTVPASEVPEDAVVLDVREDDEWVAGHIDGATHIPMGEVPARLDDLPEADPLYITCRGGGRSARVAAWLNA
    NGYDAVNVGGGMGEWEAAGRPMVSETGQQPFVR

    >gi|284989119|ref|YP_003407673.1| Redoxin domain protein [Geodermatophilus obscurus DSM 43160]
    MSTGDRTAAGVLALGLALAGCTADATEEPDGAAASPSPDPLTVLGACPEQPDRPAEGADTLPALDLACPGGGSLDLGRAP
    GVPTVVNLWASW
    CGPCREELPLVQQLADAGGDRLAVVGVISRDGAPQAASFAADAGATFPSAFDGEGELMAELGLGALPY
    TYLLDADGGIAHVQVGPVADVAELEGLVAEHLGVTL

    >gi|284989414|ref|YP_003407968.1| peroxiredoxin, Ohr subfamily [Geodermatophilus obscurus DSM 43160]
    MDRVYTAEATASGARTGEVSSSDGRLTASLSRPAEMGGDDGPGTNPEQLFAAGYAACFHSAMRFALRDLGLTPQALEGSS
    VTAEVHFLRAAPGDFGLGVDLWARLPQLDDEQARQLVEKTHTV
    CPYSRATAGNVEVGLHVVPASSAA

    >gi|284989523|ref|YP_003408077.1| protein of unknown function DUF255 [Geodermatophilus obscurus DSM 43160]
    MPNRLATATSPYLLQHAGNPVDWWEWGEEAFAEARRRDVPVLLSVGYAACHWCHVMAHESFEDEATAGQMNADFVCVKVD
    REERPDVDSVYMAATQALTGHGGWPMTVFTTPDGRPFYCGTYFPPRPAHGMPSFRQLLSAVSDAWRSRREDLETAGTRIA
    EGISSRLDLGPPAPLAAEVLDHAVAALAGEYDERWGGFGGAPKFPPSMVLEFLLRHAARTGDDRALRMARGTLGAMARGG
    IHDQLAGGFARYSVDARWVVPHFEKMLYDNALLLRLYLHLWRATGDEWARRVADATAAFLVRDLDTPEGGFASALDADAE
    GVEGLTYVWTPAELVEVLGEDDGRWAAAVFEVTDAGTFEHGTSTLQLLRDPGDPARLASVRERLGAARARRPQPARDDKV
    VTAWNGLAIAALAEHGVLTGSPSSVDAARRAAELLADVHWGDGRLRRASRNGVAGAPSGVLEDYGDLAEGLLALHQATGE
    GRWLELAGDLLDVVAGQFIDADGWHDTAADAEALVHRPFDPADGPTPSGLAAVAGAAVTYAALAGAPRHRELGEAAVGSL
    ARLAERAPQAVGWAMAVGEALLAGPLEVAVSGPAGPDRDALVAAARASTSPGAVVVVGEPDAPGVPLLAGRPLVGGRPAA
    YVCRGFVCAAPVTDVSALGAALTSS

    >gi|284989589|ref|YP_003408143.1| methylated-DNA/protein-cysteinemethyltransferase [Geodermatophilus obscurus DSM 43160]
    MTPLPARSATVDTPPGPFTVVVDRGGAVLASGWTADVADLLPVVHRALRPAWVEEVEHLPVLDAVTAFVAGDVAAIDDVP
    VRQRSGPFLEDAWEVLRTVPAGEPDTYAAFAARCGRPAAVRAAANACARNAAALFVP
    CHRVLGSDGGLGGFRWGTPVKRW
    LLDHEAAHAPVTV

    >gi|284989721|ref|YP_003408275.1| OsmC family protein [Geodermatophilus obscurus DSM 43160]
    MDAAQLRDLQAPIKQRYRDEPASACVTMHAEATFADPGVTATVQTWAGPARAGLHPSTGGDGSDACSGDMLLQALLACAG
    VTMRSVATAMGVEIRSARLTARGDMDARGTLGVSKEAPVGLGAITVDAELDTDADDATLTKLGQLTERYCVVAQTLAQPP
    HLTVRRA

    >gi|284989820|ref|YP_003408374.1| DSBA oxidoreductase [Geodermatophilus obscurus DSM 43160]
    MKVEIWSDVVCPWCHIGKRRFEAALQRFAHRDAVEVEWRSFELDPGALSAAAGNEVSPTEYAERLARKYGTSVPSAQQMT
    DTMTQQAAAEGLDFRFDKAVRANTFDAHQVIHLAGDRGVQDAVKERLLTAYFSEGEAVGDRETLVRLAAEAGLDADEGRA
    ALEDQRYAGAVRADEAEAQALGISGVPFFVVDRKYGVNGAQPADALLQVLERAWAERTPLIPVITGGEVCGPDGC

    >gi|284989914|ref|YP_003408468.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Geodermatophilus obscurus DSM 43160]
    MTDTDVAPVRLAPGDTAPEFTLPDADGNPVSLADHRGRRVIVYCYPAAMTPGCTTQAVDFTASAGDLAEAGLDIIGISPD
    PPEQLLRFREKEGLRITLLSDPEKQVLAAYGAYGTKKLYGKEVVGVIRSTFVVDAEGRIEKAAYNVKATGHVAKLRRDLG
    LG

    >gi|284990090|ref|YP_003408644.1| DSBA oxidoreductase [Geodermatophilus obscurus DSM 43160]
    MTEAVQSAPTQARVDFWFDPLCPWAWLTSRWVLEAAKVRDIDLHWHVMSLTVLNRGRDLPEEYQEMMEKAIGPVRVAIAA
    AQQHGDEVLGDLYTAMGTLRHHEGLELDELIAPALERVGLPASLAEAATSTEYDEALEKSHHAGMDPVGDDVGTPVMHID
    GVAFFGPVISKVPTGEDAGKAFDGAVLLANLPDFWELKRTRLSGPDMDSVPADALEITRR

    >gi|284990161|ref|YP_003408715.1| selenide, water dikinase [Geodermatophilus obscurus DSM 43160]
    MAIAQEAPPARTRLTQFAHGGGCACKIPPGELESVVAGLTATGPVDPAAELVIGLDDGDDAAVVRIAGGQGIVLTTDFFT
    PVVDDAHTFGRIAATNALSDVYAMGGTPVVAVNLLGWPRDVLPAELAAEVLRGGLEAAQEAGCHVGGGHSIDDPEPKYGM
    AVTGVVDVDRVITNAAAVAGTPLSLTKPLGIGVLNNRMKATGEVSEEAVAAMTTLNRDAGRAAVAAGIRAGTDVTGFGLL
    GHLYKMARASGVTAVVDAAAVPYLTGAREALAAGFVSGGTRRNLDWVRPHTDLSAVAEDEALLLADAQTSGGLLLGGEVP
    GAPVIGEFVPRGEHVVIVR

    >gi|284990226|ref|YP_003408780.1| Heavy metal transport/detoxification protein [Geodermatophilus obscurus DSM 43160]
    MSTATYTVVGMTCGHCVSSLTEEVSAVPGVTDVDVDLASGGLTVTGDAEVDDAAVRAAVEEAGYQVAGA

    >gi|284990303|ref|YP_003408857.1| Rhodanese domain protein [Geodermatophilus obscurus DSM 43160]
    MQSFHLGQPIEQIEPDSDRCFPAQGPLAYGFVDHVVSRAATLPGGRARSAGPEGGGGRRVAAVVPPVVDPSWLRAHRSEV
    VLADVRWYLDGRSGRAAYDAGHLPGAVFVDLDRWLAAPADPGAGRHPLPEPEIFAEGMAGLGIGDLDTVVAYDDAGGVVA
    ARLVWMLRATGHEAALLDGGVAAWDGPLEQAAPEPVPAVFTARPWPAERLAGVEDVLDPAAVVIDARDPDRYRGDREPVD
    PRAGHVPGAVNVPARANLDGSGRFRPVEELRRTFAAAGVTADSDVVSY
    CGSGVTACHDLLALELAGLPQGRLYAGSWSQY
    SADPERPMAVGDRPS

    >gi|284990329|ref|YP_003408883.1| cyclic nucleotide-binding protein [Geodermatophilus obscurus DSM 43160]
    MSTSVSRQSTPGGWGLLARVAPLRQRLRTEAGGAGLLLAATVVALLWANSPWGGSYETFWHTEFAVRFAGAELALDLQHW
    VNDGLMVFFFFVVGLEIKRELVMGELTDRRRAAVPALAAVTGLAVPALVYVAFTLGDEAASAWGVVISTDTAFLLGVLAL
    VGPACPAQLRLFLLTLAIADDVGALTVIALFYTEDLAVGPLLLAVLGLALMVALRYLNVWRGPAYLVLGLAVWVAMYLSG
    VHPTLAGVVIALFTPAYPARRDEVADAARLTRAYQQSPNPRFARAARLSIDRSVSASERLQQLWQPWTSFVIVPVFALAN
    AGVPLTGETLRTAATSPVTLGVVAGLVLGKLVGILVGTGLAVRLRLGELAPGLTWLQLAGGAALSGIGFTISLFIVDLAF
    DDEARADQARVGVLVASVLAALLGWALFRLADRRRPPGAGARPVLLDPPVDVDRDHVRGPADAPLTLVEYGDFE
    CPFCGR
    ATGTVEELRERFGDRLRYVFRHVPLVGVHPHARLAAEAAEAADAQGRFWEMHDRLFAGQDRLMPTDLLEHAAAAGLDVSR
    FARDLGSSRFARRVEEDVESAEASGVTGTPTFFVNGRRHTGPFDADSLAAALLAAGGEEGLPPSGDDGLSGLVLPALGQR
    RGEPRPEADDAPADVPADLPETPDRDGAFPRLTDEQIALVERSATRMRCAPGDTLFREGDAGYAFHVVVSGTVAIVEDHG
    RTGQRVISVHGRHRFLGELDLFSGQPVSLTALVLQPAEVLRVEREQLRAVFTADPAFKELVLRAFLLRRSMLLELAADLR
    IVGRGGSPDSRRLQELARSRRLSAGFVDLDAGGDGAAVLTELGVTEDDLPVVVGRRGGVLRNPTDDEVMAAVEAVD

    >gi|284990414|ref|YP_003408968.1| methionine-R-sulfoxide reductase [Geodermatophilus obscurus DSM 43160]
    MTTSAQNQPKVTRSDEEWRAQLSPEEYAVLRQAGTERPWTGEYVDTKTRGVYSCRACGAELFRSETKFDSHCGWPSFYEP
    SSADNVVLREDRSHGMVRTEVLCGTCHSHLGHVFEDAPQTPTGDRY
    CINSVSIRLEPAAG

    >gi|284990775|ref|YP_003409329.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Geodermatophilus obscurus DSM 43160]
    MVVIGGDAAGGSAASQAKKRRPDLDVVVFERGRATSYSACGIPFWISGTVEREADLVARTPEQHRAMGIDVRMRTEVVGI
    DLDRRVVHWRDLAGGGSGVEPFDDLVYATGSVPMRPPVPGIDATGVHGVQTLDDGAALRAELEDGDVRRVVVVGGGYIGL
    EIAEACRIRGLDVTVVDMSATPVGTFDPDVGEFIAEAVRKEGVELVLSDAVAAIETDAGGRVRAVVTASGRELPADLVVL
    GLGVRPSVRLAEEAGIPLGVSGGIAVDAGMRTLVEGAWAAGDCVESVHRLSGQRVVVALGTHANKQGRVAGINIGGGYAT
    FPGVIGTAITRVCDLEAARTGLSTAEAEAAGYQFVTTVVDSTTKAGYFPGAQPIRLKMIAERRSGRLLGAQIVGREAAAK
    RVDALAICIWNEMGVDEILSLDLSYAPPFSPVWDPVLIAARKAFEAVEADVRQL

    >gi|284990960|ref|YP_003409514.1| alkylhydroperoxidase like protein, AhpD family [Geodermatophilus obscurus DSM 43160]
    MSYGHGVQDELREPSRALRRAIPEVYDGYRQMHTAAYAAGALDEKTKELIALAIAVSKQCDGCIASHARGAARTGATEAE
    VAEALGVTIAMNGGPATVYGPRAFAAYREFAERAGRTDTRQG

    >gi|284991394|ref|YP_003409948.1| dihydrolipoamide dehydrogenase [Geodermatophilus obscurus DSM 43160]
    MDMRIPDIGDFADVPVIEVHVAPGDVVAAEDPLLTLESDKATMDIPAPAAGTVEEVLVQVGSRVSPGDLVLRLTASDTGA
    PPATHTVTHEDAVPAPVDRPGYGSAAGVYDRIEVTVPDLGDFADVPVTEVLVGPGDRVGPHNPVVTLESDKAVMEIPASQ
    AGTVEEVTVRVGDRVRAGSILLFLRPEDAPSRPATAATPAPTPAAAYGPGDVRADVLVLGAGPGGYTAAFRAADLGKSVV
    LVDRWPALGGV
    CLNVGCIPSKALLHAAKVIAETREMAEHGLAFGEPSIDVGKLRGWKDTVVGRLTGGLTGLARQRKVTTI
    RGYGRFTSPSQVQVELADGGTTTVDFEHAIIAAGSEPVRLPFVPHDDPRVMNSTGALELADVPRRLLVLGGGIIGLEMAT
    VYHELGAEVTVVELMDQIIPGADKDLVQPLHKRISQAYAGVHLKTKVAAVEARPEGLVATLEGETSTTATFDRMLVAVGR
    RPNGPEIGAERAGVVVDERGFVPVDKQMRTNVPHIFAIGDVVGQPMLAHKATHEGKVAAEVTAGQNSYFDARVIPSVAYT
    DPEVAWVGITENEAKTAGIQYGKGVFPWAASGRALSLGRDEGFTKLLFDETSHRVIGAGVVGPSAGELIAELGLAIEMGA
    DAADIGLTIHAHPTLSETVGMAAEAFEGTLTDLYLPKRRK

    >gi|284991682|ref|YP_003410236.1| uncharacterized peroxidase-related enzyme [Geodermatophilus obscurus DSM 43160]
    MVLPLAAARAAGQGGPVSTGPVSRFPVPPRDELPEQLRERYAEVEERSGFLPNVFAALAWRPAEAAAFFALHDALMDKDT
    PGLSTADRELVVVATSAANDCLY
    CVVAHGAIARIRARDPYLADQVAVDWRKAPVSDRLRAVLEVAVRLAVEPVAVTAADL
    DRLRGHGLTEDDVWDVGAIVSLFALSNRLAHWAAIPPNEEFFLLGRVPRR

    >gi|284991768|ref|YP_003410322.1| iron-sulfur cluster assembly accessory protein [Geodermatophilus obscurus DSM 43160]
    MTVQDTTATGVILSDPAAAKVKTLLDQEGRDDLRLRIAVQPGGCSGLRYQLFFDERFLDGDQTYDFGGVEVIVDRMSGPY
    LGGAVIDFVDTIEKQGFTIDNPNATGSCACGDSFS

    >gi|284991779|ref|YP_003410333.1| dihydrolipoamide dehydrogenase [Geodermatophilus obscurus DSM 43160]
    MSAPTSPADLVILGGGSGGYAAALRAAELGMSVVLVERDKVGGTCLHRGCIPTKALLHAGEVADLAREGEQFGVKTSLAG
    IDMDGVNNYKDGVISRLYKGLQGLIKSRKIQYVEGEGRLVSPTAVEANGQRYEGKHVLLATGSYARSLPGLDIDGTRVIT
    SDHALNMDRVPASAIILGGGVIGCEFASAWKSFGVDVTIIEALPHLVPLEDESSSKLLERAFRRRKIGFELGSRFSGVQH
    TENGVKVSMENGKEFEAELLLVAVGRGPVSQGLGYEEAGVAMERGYVLVDEYLRTSVPTISAVGDLIPTLQLAHVGFAEG
    ILVAERLAGLEPAPIDYAGVPRITYSDPEVASVGLTEAQAKERFGEIKTLNYDLGGNGRSQILKTAGAVKLVQAVDGPVV
    GVHMVGSRVGELIAEAQLIYNWEAEADDVAALIHPHPTQSEALGEAHLALAGKPLHVHG

    >gi|284991851|ref|YP_003410405.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Geodermatophilus obscurus DSM 43160]
    MTDELRDEYDVVVVGGGAAGLNGALVLARSRRSVVVLDAGAPRNAPAAGVHGLLAREGMPPGELVERGRAEVRSYGGSVV
    EGEVTTATRDGDGFTVGLADGRTTRARRLQVTTGLVDELPDVPGLRERWGRDVLH
    CPYCHGWEVRDQAIGVLACGPMAVH
    QALLFRQLSADVTLFAHTQPAPAGEQAEQLAALGIPVVTGEVAGLELAGDRLVGVRLADGTVVERRAVAVQSRMVARTGF
    LTGLGLTPVPHPSGMGEYLAADAAGRSDVPGVWVAGNVTDLAAQVGAAAAGGAAAAAQVNHDLVLEDTRRAVAAAREPLG
    V

    >gi|284991852|ref|YP_003410406.1| protein of unknown function UPF0061 [Geodermatophilus obscurus DSM 43160]
    MSGRLAHHRPAVHGNTSGTGRAVHRVSVAPAPTVSFDDRFARELPEMAVPWQADEAPDPRLLVLNDALATELGLDPGALR
    RPDGVRLLVGTAVPDGAKPVAQAYAGHQFGGFVPRLGDGRALLLGELTDVEGRLRDLHLKGSGRTPFSRGGDGLAAVGPM
    LREYVVSEAMHALGIPTTRSLAVVATGRPVRRETLLPGAVLARVASSHLRVGSFQYARATGDVDLLRRLADHAIARHHPA
    TADAEQPYLALFEAVVAAQASLVARWMLVGFVHGVMNTDNTTISGETIDYGPCAFLDAYDPATVYSSIDIGGRYAYGNQP
    IVAEWNLARFAETLLPLFSDDQEQAVALAVEALERFRPQYNAAWSAGMRAKLGLPDGLDDEVATALVEDLHALMQESHVD
    LTSFSRALGAAARGDAEPARLVVMDLARFDAWLERWRALGPDAELMDRTNPVYIPRNHLVEEALTAATDGDLAPLQRLLE
    VLAGPYEERPGLERYAAPAPGDTGPYRTF
    CGT

    >gi|284991911|ref|YP_003410465.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Geodermatophilus obscurus DSM 43160]
    MSLSVGDVAPEFSLPDQDRQVVSLTGLRGTPVLLVFYPFAFSRICTGELCQLRDELATYTDAGVRVLALSTDPAPALKAW
    REQEGFDFALLSDFWPHGAVAQAYGVFNDKAGMAVRGTFLVDAEGRIAFTEVNGPGDAREQSGWKDAVAQLAA

    >gi|284992006|ref|YP_003410560.1| Heavy metal transport/detoxification protein [Geodermatophilus obscurus DSM 43160]
    MSTASYTVVGMTCGHCVNAVTEEVSAVPGVTDVDVDLASGGLTVTSTEPVDDGAVRAAVEEAGYQVAVG

    >gi|284992008|ref|YP_003410562.1| heavy metal translocating P-type ATPase [Geodermatophilus obscurus DSM 43160]
    MSTPDVRTGEVELLIGGMTCASCATRVEKKLNRMDGVTATVNYATEKARVSVAGDVTTDDLIATVQKTGYTAALPEPPAP
    EAEPAEDDPTRPLRQRLLVSTLLTVPVVAMAMVPALQFTSWQWLSLTLAAPVVVWGGLPFHRAAWTNLRHGAATMDTLVS
    LGTGAAFLWSLYALFLGNAGEPGMTHPFELTIARTDGSANIYLEAAAGVTTFLLAGRYVEARSKRRAGAALRALLELGAK
    EVTVLRGGTETRVPVDRLAVGDLFVVRPGEKIAADGVVTEGASAVDASMLTGESVPVEVAPGDSVVGATVNAGGRLVVRA
    TRVGAETQLAQMARLVEEAQNGKAEVQRLADRVSGVFVPVVLALAVATLGFWIGAGAGLPAAFTAAVAVLIIACPCALGL
    ATPTALMVGTGRGAQLGILIKGPEVLESTRAVDTVVLDKTGTVTTGRMTLQDVVPAAGEDADRVLALAGAVESGSEHPVA
    RAVVEAAAERTGPLRPVTGFANEAGLGVRGVVDGTAVLVGRAGLLAGAGVTVPAELERAQATAEADGRTAVLVAADGVAR
    GVLAVADAVKETSAEAVRQLRDLGLHPVLLTGDNTTVARAVAAEVGIDEVVAEVLPQDKVDVVRRLQGEGRVVAMVGDGV
    NDAAALAQADLGLAMGTGTDVAIQASDLTLVRGDLRAAADAIRLARRTLAVIKGNLFWAFAYNVAAVPLAMAGLLNPMIA
    GAAMAFSSVFVVTNSLRLRRFAPLPGNVDATTAVPAGRRAAVPAA

    >gi|284992164|ref|YP_003410718.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Geodermatophilus obscurus DSM 43160]
    MSIDWDVAVVGAGIAGLTAARVAAERGLRVVAYDRLTPGGQLVNLTALHEHPGGTGPELMAALTAAAEGAGVRLAYVEVT
    RVHPGSPVRLETSDGEVSAGAVVVATGLGPGRLGLPGEEALVGRGVST
    CAGCDGPLFRGRPVAVLGDDEWTAEEALELAG
    WASAVTVLVPGPPRWSPERAERLAAAERVEVVPDATVTALRGEGVLSGVVVRTSDGDRELAVAGLFPFVNRRGPEGLVEG
    LAADEHGRLVPSHGVLVAGDARAGAEQSLTAAEADGRAAGEAAVAALATAAGSLRIVDPTYGLPPEDDAGPLEPAGSTAT
    WTDVALFTNSKPNATELLRGLGERLQAHWELPELGFAAKESASVAADKDTIDWLSQRFKMVLVAVGD

    >gi|284992274|ref|YP_003410828.1| heavy metal translocating P-type ATPase [Geodermatophilus obscurus DSM 43160]
    MSTTAPATAAAATEQASCTLDIDGMTCASCVGRVEKALNRVTGVTAADVNLATEVATVRFDPAQIGVDELTAAVARAGYT
    ATPRREAQSTAERPGTGADAPGEDRDGEAHLTALKRKWQITLATGLGLMVLMYVPLYLDTMDWLMPAILVVATVVQFWAG
    RDVYRAAWTAARHRSTNMNTLVALGTGVAYGYSAFVTLWPAAAERWGLPLHVYFETSLVILALVLAGRWMEARAKKQTAA
    AITALVGLAPKTARVVRNGAEVDVPVERVVVGDLIRVRPGDKVPVDGVVTDGATAVDESMLTGESLPVDKTVGDTVIGAT
    INRTGTVVLRATAVGADTALAQIVRLVEDAQGAKVPLQRLADRVSAWFVPIVLGLAAATFLAWALLGPDTGRLTMAITTT
    IAVLIIACPCALGLATPTAVMVGTGRAAELGILIGNGDALETARRVTAVVLDKTGTITRGKPALTGITTTAGWAEDDILA
    LVAAAETGSEHPVGEALVAAATARFLDLPPLRTFDAVPGHGIDAVVDERHVLVGNTALMTARSVDITALAGTAASAAAVG
    QTPMFVAIDGQPAAVLSVADTVKPESAQAVAQLQALDLQVWMITGDNAATATAIADQVGIEHVLAEVLPADKAAEVRRLQ
    EQGHVVAFCGDGINDAAALSAADVGIAIGTGADVAIAASDITLIGGDLRVIVSAIALSRRTVTTMKQGLGWAFGYNLLLI
    PVAAGALYWWNGLLLDPVLASAAMAMSSVSVVTNALRLRRFHRPTMVDEILHPPLRARIGQYAYLTGIAVVALALGAGLT
    AVSRMDFAERGMNGQLAWAQGTGMPMRPAMSEMMTAEVPPTDATDARVDVRLDLPADVRPGQPTRLVATVVDSGTGEPIE
    DLTRSHEAWMHLIATREDLGTFAHVHPQPTSEPGQLAVEVTFPTAGRYIVNTEFRRQGEMGDVHQRQVITVAGAAPEPVV
    LAAGPRSVVVDGVRVELTGEAAAGGRSDLAFTFTDDATGRPVDDLQPYLAAAGHVVVMRADGQTFAHEHAEVEDDRGRPV
    FALPGQTFGPELDVHAEFATAGTYQLWAQFRLADGDVITVPFTIEAT

    >gi|284992277|ref|YP_003410831.1| Heavy metal transport/detoxification protein [Geodermatophilus obscurus DSM 43160]
    MLSSTPRTFIGSTTFTVTGMTCGHCQRAVAEEISAVDGVESVTVDPASGTVTVTADRPVDRADIAAAVDEAGYALVP

    >gi|284992487|ref|YP_003411041.1| Thioredoxin domain protein [Geodermatophilus obscurus DSM 43160]
    MQPTRPGRPDPRAQAQQAQLAASLAGAVDLAAVKARSEAAARAQSAPPPSAAGPAGAPGAAVVDVTEETFQAEVLDRSFQ
    VPVVLDLWAEW
    CGPCKQLSPVLERLAAEGGGSWVLAKVDVDANPALAQGLRVQGIPAVKAVWQGQLVAEFTGAIPEEQAR
    QFVTELVRATTGGAVPGAGDEPGEAEDPRLDAAEAALERGDLTAAEAAYQSILDAEPDHPVAGLALRQVQLFRRADEAGP
    DALAAADAAPDDVAAQARAADFLLGTGDVEGAFERLLDVVRRTAGDDRDQARRHLVELFGVVGDQDPRVAAARRQLTLAL
    Y

    >gi|284992612|ref|YP_003411166.1| glutaredoxin-like protein [Geodermatophilus obscurus DSM 43160]
    MTAAPAAVTMYTTTWCGYCVRLKKLMQREGIEYAEVNIEQDAAAADVVMQANGGNRTVPTLLFPDGSALTNPTIDQVKAQ
    LAQSTGS

    >gi|284992626|ref|YP_003411180.1| UBA/THIF-type NAD/FAD binding protein [Geodermatophilus obscurus DSM 43160]
    MSLPPLVEPAADLTIDEVRRYSRHLIIPDVGMDGQKRLKNAKVLAVGAGGLGSPVLMYLAAAGVGTLGIVEFDVVDESNL
    QRQIIHGRSDVGRSKAESARDSITEINPYVDVRLHETRLDSDNVMEIFSQYDLIVDGTDNFATRYLVNDACVLLGKPYVW
    GSIYRFDGQVSVFWNEHGPNYRDLYPVPPPPGMVPS
    CAEGGVLGVLCATIGAIQATEAVKLITGIGETLLGRLMVYDALE
    MTFRTIKVRKDPEGEPITGLIDYETFCGVVSDEAQQAAAGSTITVDELKDMMDAGKDFELIDVREPNEYEIVSIPGATLI
    PKDEILSGRALAQLPQDKPIVLH
    CKTGVRSAEVLAAVKNAGFSDAVHVQGGVTAWATRIDKTLPTY

    >gi|284992940|ref|YP_003411494.1| Redoxin domain protein [Geodermatophilus obscurus DSM 43160]
    MRRGLLGALVGALLLTGCATGDGAVDVNNGGEFRFVQGTPAGEVIPSGERAAAPEFSGTLLDGGDFDSTELDGGIAVVNF
    WGSW
    CAPCRVESPEFQEVYAEVRDRGVRFLGVNVKDTDQLARAFEDSFGIEFPSVHDPRGEVALAFRDYPANAIPSTIVL
    DAQGRVAAVYTGAVAQEDLRAVLDLLLAEEG

    >gi|284992949|ref|YP_003411503.1| glutaredoxin 2 [Geodermatophilus obscurus DSM 43160]
    MTGDAPRLQLLTRADCHLCAVAAETVDRLAAEAGLTVTTVDVDADPELQAEYGDRVPVVLLDGREHSYFTVDVPRLRRDL
    GL

    >gi|284993007|ref|YP_003411561.1| Rhodanese domain protein [Geodermatophilus obscurus DSM 43160]
    MSRNDVLVTADWAQEHLGQPGLVFVEVDEDTSAYDGGHLEGAVKLDWKKDLQDPLRRDFVDKSAFEALLSSRGISNDDTV
    ILYGGNNNWFAAYAYWYFKLYGHESVKLIDGGRKKWELDGRPLSKDVVERPATQYTAKDPDLSIRAFRDEVVASIGSKNL
    IDVRSPDEFSGKILAPAHLPQEMAQKGGHVPTAKNIPWSKAANEDGTFKSDEQLAALYDEQGYDDSKATIAY
    CRIGERSS
    HTWFVLRELLGKPDVKNYDGSWVEYGSLVGVPIEK

    >gi|284993008|ref|YP_003411562.1| thioredoxin [Geodermatophilus obscurus DSM 43160]
    MPGVDGTDGVVLERLGVHPDRADLTVVQFSTAFCGPCRATRARLRQLQATRPGLVHVEVDAESHLDAVRALGVDRTPTLL
    YLDREGRLVGRSSGAPRPAELAAVVDAHVPAAASRAGRDV

    >gi|284993146|ref|YP_003411701.1| peroxiredoxin, OsmC subfamily [Geodermatophilus obscurus DSM 43160]
    MPTRTARTAWNGTLQEGSGQVELSSSKVGTYEVSFPKRAAEEADGTTSPEELIAAAHSSCFAMALSNEIAKAGGTPQSLE
    VSADVTLGQKDGGPHITKIAITVRGEVEGLDAAGFEQAAQAAKAG
    CPVSKALAGVDEISLDASLES

    >gi|284993230|ref|YP_003411785.1| DSBA oxidoreductase [Geodermatophilus obscurus DSM 43160]
    MTGLVRSVRIEVWSDVVCPWCYIGKRRLEAALERFPHRDEVEVVWRSFQLDPGTPEGETHRTLPALAARFGRPVEDVRGM
    MRHVEETAAGEGLHYDLASGVSGNTLLAHELIHLAAERGLQGAVKERLLHAHFEEGRSVFDVDSLAALAVEVGLDEAEVR
    AALTDHRYRAAVLDDLRTAQELGATGVPFFVVDRRYGAAGAQPVDLLLQVLERAWADTARSGQQVAGRP

    >gi|284993241|ref|YP_003411796.1| Peroxiredoxin [Geodermatophilus obscurus DSM 43160]
    MSGLLDTPLTTLQGEPTTLRALTRGGAALVVNVASRCGLTPQYTRLEALQREYGARGLTVVGVPCNQFAGQEPGTAEEIA
    GFCSATYGVTFPMTEKLDVNGPGAHPLFQRLSEAPDASGEAGDVQWNFEKFLLDTDGEVVARFRPMTQPDAPEVRHAIEE
    ALHR

    >gi|284993242|ref|YP_003411797.1| hypothetical protein Gobs_4895 [Geodermatophilus obscurus DSM 43160]
    MSSPTPHADLLFWFDPVCPFAWMTSKWVRMVAEQREYRVEWRLISLRLLNRHVDYDAQFPPEYEAGHTSGLHLLRVAARA
    RAEHGPQALDPLYATLGRHVFEDPAGQPPPERATSRAFLEQVLAEAGLPADLAAAVDDGSWDAEIQAQTDAALQLTGKDV
    GTPILQFRPPEGASFFGPVISRLPSPEDAVVLWDHIVALAGFPGFTELKRSLRERPQLPAFGVRPGEAGLQEDWHGGSRR
    QHR

    >gi|284993427|ref|YP_003411982.1| thioredoxin reductase [Geodermatophilus obscurus DSM 43160]
    MTEEHVEPAIPPAEHDGVRDLIIIGSGPAGYTAAIYAARANLHPLVFEGSQFGGALMTTTEVENFPGFAEGVQGPQLMDD
    MRTQAERFGAELVARDVSEVDLTAEPKIVKVGDEVHRAHAVIVATGSKYRYLGLDNEARLLGRGVSA
    CATCDGFFFRDQD
    IVVVGGGDSAMEEATFLTRFAKTVTVVHRREELRASKIMQKRAQENEKIRWALGKQVTDVLGDQTVSGVRLTDVGTGTTE
    ELPVSGVFVAIGHDPRSELFVGQLKLDDEGYVQVEHPTTRTNIEGVFACGDVVDHIYRQAITSAGTGAAAAIDAERWLAV
    TFGER

    >gi|284993428|ref|YP_003411983.1| thioredoxin [Geodermatophilus obscurus DSM 43160]
    MAGNTVTVTDATFADDVLGSDKPVLVDFWAEWCGPCKMVAPVLEEIAAEHADKLTIAKLNIDENPQIARDYQVMSIPTMT
    VFQGGKPVKSIIGAKPKGAILSDLADYL