Geobacter uraniireducens Rf4 uid58475

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|148262232|ref|YP_001228938.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Geobacter uraniireducens Rf4]
    MSRIGVFVCHCGENISRTVDVERVAREAGALSGVAFATDYKYMCSDPGQNLLKKAVAEHNLDGIVVAACSPRMHEKTFRK
    AAQSAGLNPFLCEMANIREHCSWVHEDREEATAKASEIVAMLVERVKKDKKLAPITVPITKRSLVIGGGIAGIQAALDIA
    DAGHQVVLVEREPSIGGHMAQLSETFPTLDCSQ
    CIMTPKMVDVANHPNITLHTYSEIENVDGYIGNFQITIKKKARSVDM
    AKCTGCGICMAKCPQKKIPNAFDRNMGMRPAIYVPFPQAVPNTPVIDRENCTWFKTGKCGVCQKVCGPGAVDYTQEDELI
    VEKVGAIVVATGFELYDITEKPKGSPIKGYGEFGHGKIPDVIDGMTFERLASASGPTGGKILRPSDGKEPKQVVFIQCVG
    SRAREKGISYCSKICCMYTAKHTMLYKHKVHDGQAYVFFMDARTPGKGYDEFWRRAVEEEEAGYIRGMVSRLYQKGDKVV
    VMGSDISVGVQVEIEADLVVLATAVQPRQGADTLAQKLGISYDKYNFYSEAHAKLRPVECATAGIYLAGACQGPKDIPDT
    VSQASAAAAKVMTLFSRDELEREPIVAKVNEKNCVACFYCKKVCPYGAVEEKEIRDRNGNLIRVVAYVNPGVCGGCGTCQ
    ATCPSKSVELDGYTDEQIVAMIEAL

    >gi|148262378|ref|YP_001229084.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Geobacter uraniireducens Rf4]
    MSICTLVTQEAPDFTAEAAMPDNSFAEIKLSNYRGKYVVLFFYPLDFTFVCPSEILAFNKRLGDFKAKNCEVIGVSVDSK
    FTHLAWKNTPVENGGIGNIQYPLVQDLNKAIARSYGILFNESVALRGLFLIDPHGKVRHAVINDLPLGRSVNEALRMVDA
    LQFVETHGGEVCPANWQEGEEAMKASTEGVAAYLAKHGK

    >gi|148262418|ref|YP_001229124.1| thioredoxin domain-containing protein [Geobacter uraniireducens Rf4]
    MNEAASTYLVGCPACGAANRIPSTKEGQSGKCGNCRASLPPLYLQPVELTDRSFDSFVSRYPGPVLAEFWAPWCPHCRNF
    APAVREIARELAGKAAVVQVNTEENPLLSNRFGIRSIPALLILKKGTVLATLSGAQEKRAVLAWFRQNAL

    >gi|148262446|ref|YP_001229152.1| thioredoxin [Geobacter uraniireducens Rf4]
    MASEKVLTFTDDNFEAAVLQSDVPVLVDFWATWCAPCKAIAPLIDTIADEYDGKIKVGKVNVDDNPGTPGKYGVRGIPTV
    ILIKDGKVVDQVVGAVPKAQLEALIKKAV

    >gi|148262447|ref|YP_001229153.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Geobacter uraniireducens Rf4]
    MKLRVTQMRYPVLALFLLSLLATPAFAILQKGQPAPPINVVTTSGQQVSLANYKGYVLVLDFFATWCIPCRESIPHIISL
    NRKYGKQGLQILGMSVDEGSDKAVKTFIAERKINYPVAVTSEDLQADYGLRSVPTLFIINKKGVVAEKYQGYSDEVAKSI
    ELTIMKLLAE

    >gi|148262465|ref|YP_001229171.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Geobacter uraniireducens Rf4]
    MTTGQEGINPELQAELQRLQDENLAKLPPDTVAAMRKATMELVQSGIADRALKPGEKAPDFSLPNAVGKEVQLHGLLNAG
    PVVATFYRGAW
    CPYCSLQLRAYQKILPQILTLGATLVAISPQTPDRSQATLLKNFLEYEVLSDLGNKVARQFGLVYPIAE
    EMRSIYQGFGVHLPEYNGDESWELPLPGTFVIDRKATIRLAFVNADYTNRLEPAAILDSLQQLQRV

    >gi|148262478|ref|YP_001229184.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Geobacter uraniireducens Rf4]
    MSLEGKKAPAFDLEGSDGKRHTLAEYAGKTVVIYFYPKDNTPGCTKEACGFRDLHKTLLDRDVTLLGVSRDSLKSHDKFI
    KDFGLPFVLLSDPETTMMQAYGAFGEKVQYGKKSMGTIRSTVVVGPDGVVVKHWSRVAKAEEHPAAVMEFLQKMHG

    >gi|148262518|ref|YP_001229224.1| thioredoxin domain-containing protein [Geobacter uraniireducens Rf4]
    MRKLIVAALLLAAATSHAELPSATDTTVRQAFASGKPVVIDLGARTCIPCKKMAPILESLSGEYRGRAHVLFIDVHEDRA
    AARKFRVQMIPTQIFFNAQGKEVRRHIGFMDKADIVKELKAAGMK

    >gi|148262519|ref|YP_001229225.1| redox-active disulfide protein 2 [Geobacter uraniireducens Rf4]
    MKIEVLGTGCAKCKRFYENTKIALEENGKSAEVVKVEDIPSIMKYGVMCTPALVIDGQVKFSGKVASVGEIKGMLS

    >gi|148262520|ref|YP_001229226.1| rhodanese domain-containing protein [Geobacter uraniireducens Rf4]
    MTLMTLQLYPTTIFAVASEFETFLGRFDYEVRDDMKIDSKGLVPLLTTGKAILVDVRFKEEVAAWHTGFALNIPLNELPR
    RIGELPKDKIIVAA
    CPHKDRSAIAMAYLRSKGYDAKYLTDGLIGLAELLRGERAKDFMEDMNKAKTK

    >gi|148262527|ref|YP_001229233.1| rhodanese domain-containing protein [Geobacter uraniireducens Rf4]
    MSEKAIKKTKLLLLALLGVVIISTLVIWGCGTKGYDNPAAVSAAKYYANDATVNTMIDPATVNRWVTQGNKTDDGKRVVI
    LDVFPNDTDTDSWFAGDSTLIKQQMITQYGGTLSPQYKMIDGLKNANLLGHIPGAIPQVSHAGYEVATRNDGPIETEHEV
    GTGAYIDQMLQKLGVNKDDVLVLTTSRYDYPGFCSARLFWTLYYWGFSRNNIKVLNGGNKAYAQAGFPLETGKVISTITP
    STFSVTQLGQKHLDARISIGEMIQLVDSGATNQTTGSVVVLDTRQPPAAYYFLDQDNNGIPDAFEIPGYTMSKNSTEGLY
    FVRNSDGRHVTLSELLFKETTPARVAFSGSSNPPITLPNAFIGITAPAGPNPNGGVPLSFPLGNKAAAFEGIIKGAKVTK
    TGTYNITVPSLCKPDGVSYLDQAAMKSVFATAGIDGSKPIVVY
    CNSGALASIYYYALHEVCGFQNVKIYDGSWLEWANMA
    AYEPTDPTYVMNDDYTAYPSYPAPSPSVVFYAASNKYLEWDGTQFVDSFTKQPVNGLVKKGGALGGNTFWDTAHRSEHVM
    FRPLGSLTYTMLTSTPNSSIAFLYNNKTYSSLTDWAPIVTHPAYSGAGSEINNTDKAYTTPAGASSGSSGPAPFIPKGGG
    C

    >gi|148262533|ref|YP_001229239.1| rhodanese domain-containing protein [Geobacter uraniireducens Rf4]
    MAKQVWRKGRIVLAGICGVVALTLLAMWGCGTSGYDNPSAAVVTTKTATALIQAADLKRWADAGLVNKAGGYDRVVILEV
    TTNTNNYNGEHIPGAISVNRATDIAVQRVEGPALTGDLVADGKMMDALIQRCGIDQNTTIVFTTSEAEMNADNHYNLTRG
    YATFRYWGFPKERLKVLDGGNKAWKAAGLPMTTIVPGIKSSTYCVTPDNTNRVRDDLRATLSDMIKAVQAVQAGTATYDF
    IDGRADGVPGETQDIIDTTLTGPTYDTTTTPPTIKSVGGLKKDVVFEGQVKGGRGYAYSNLRDVTTRKFKSISDVIAGLD
    LQKPTTYVM
    CRSGNIATVLFFAIDGYAFYDGSKKAVWYDGSWGQWGLMATSDQLTTAGIIAGGKLPVGSAWSTVSLTNIL
    SYNKDNTLRTVIDITSRLAPVSHADVNANQTEEADKAYRSPVSTSGGGATVGGGGGGC

    >gi|148262694|ref|YP_001229400.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Geobacter uraniireducens Rf4]
    MKVVTVGTGMAAAEFVQRLRLEGFGGEIVMCSDEGFAPYSPCVIPFYLAGEPLKTVYWKGKDFYDRYRVTPYLSDPVVEV
    DTERRLVRSASGRNVTYDRLFFATGTRSWYPRPEWLETMGVFGFKTLTDMMAIDRYISERNIKKAVVFGGGFIGVDAALA
    LWHRGLEITLVHRNTRLLSQMTDEDGGQFATRKLAAKTGIDIRLKTTVSEIVLANGQLAAVEFSNGERMETSLLIVSIGV
    SPNSEALCGNDKGVPSNEQMLADPDIYTAGDVAVTRHAVTGEQGFFATYPNAMQQARIAARHLVHGDGSFGGSVNTNVLK
    KHIDFPIVSAGRFEGEAITRQQGDIWRRVYMKDGMINGYIIIGDTRISGFIYHLYLSRKRVDKSIGTILSEPRHDSYYRG
    MLGIADPNRN

    >gi|148262915|ref|YP_001229621.1| mercuric reductase [Geobacter uraniireducens Rf4]
    MHDNRHDIVILGSGSTAFAAALRAQSLGARVLMIEKSVLGGTCINWGCIPSKTLIHAALFRHEARLGASIGLQIEDHGVD
    FARLIAHKDAAVDHLRQTKYLDVLKNAPGLELVKGTARFVAPDAVEVSDRVYRGDKFLIATGGFPRTIAIPGLDETPYLT
    SRSALLMKSLPESLVIIGGGVIALELGQMYLRLGTRVTVLEHGPRLLPALEAEPVLALQEALVAEGMEIVLNAPICSVSR
    RGETTVVEAEVIGRREEFAAEKLLLAVGTAPASAGIGLEKAGVEVNGKGFIRVDEQMRTTATGIWAAGDVAGGMMIATIG
    AREGIVAIDSMLNPGCGCTMDYPSIPMAIFTDPEVATVGYSEEGAKKAGFSVVVNTMPVAAIPKAHVTGQTRGAIKMVAD
    SGSGRLLGVHLSCHRGADLINEAAMAVRFKLTVEDLANTLHVYPSIGEGLRLCAQGFSRDISKLSCCAE

    >gi|148263117|ref|YP_001229823.1| peptide methionine sulfoxide reductase [Geobacter uraniireducens Rf4]
    MKKHRNTARIVLILLFACSLLAEAPCSAGQAVKGGLEKATFAGGCFWCMEAPFDRLEGVTSVTAGYTGGQKKNPTYEEVS
    AGGTGHAESVQIVYDPARIGYAKLLDVFWRNIDPTVRDRQFCDVGTQYRSAIFYHSPEQKNLAEESKRLLEKTKPFAAPI
    VTEIVPASEFYPAEDYHQHYYKKNPIRYKFYRQGCGRDRRLKELWGAAAGH

    >gi|148263299|ref|YP_001230005.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Geobacter uraniireducens Rf4]
    MRKSVIKGIFSSALSAVSSIGARSLEPGEKAPPFEAPSTSGVVRLADYLGKRNVLLAFYFVDFTPTCTDEMRAFQRDLSR
    FEGLNVQVLGVSPDSPATHDEFSARHGITFPLISDEKGAVQRQYAPGRVTFIIDKAGIVRFIQKGVPDNELLLGELEKLE
    T

    >gi|148263335|ref|YP_001230041.1| dihydrolipoamide dehydrogenase [Geobacter uraniireducens Rf4]
    MPDEIFDLIVIGAGPGGYVAAIRAAQLGMRVAVVERSERLGGVCLNEGCIPSKALLDSSELFVLARDRFSLHGIDIDPPK
    LNLARMMARKDDVVKKLTDGVAFLFKKNKITRFQGTARLAGKSGDDHRIEVRGTGNKENQILTSKRMLLATGSQAMEVPA
    FPFDGETVVSARDALSFSSVPEHLLVVGGGYIGLELGSVWLRLGSKVTVVEMLPKILPNTDRQVADALMRSLKKQGMTFL
    LETKVSSLEKRDGKAHVQINSGDKAEEIVCDRVLVAVGRRPLSADLGLEETGIVVDGEGRITVNEDYATSVAGVYAIGDL
    VHGPMLAHKAMTEGEVFAERLLGQASVVDYEFIPGIIYTWPEAASVGKTEEQLQAENIPYAAGRFNFMANGRARCMDETD
    GFVKVLAHKETGRVLGVHIIGPRASDMIAEAVTVMTYGGSAQDIAMTFHAHPTLSEAMKEAALDVEKRAIHS

    >gi|148263398|ref|YP_001230104.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Geobacter uraniireducens Rf4]
    MKNTKTMLATLTAGIIFIGISSSPAQTMEMPPTMMHGIEEMMMGQHQAKVGQFAPDFSLEAVVGTEAGKEFRKISLSDYR
    GKWLVLFFYPLDFTFV
    CPTEIKGFNDALDAFKKLDAEVLGASVDSKFSHLAWIKRGDLGNLKYPLLSDFKKEVSERYGIL
    DNKEGVALRGLFIIDPQGVLQYQVVHNLDVGRSVEETLRVLEALQTGSLCPLGWKPGQKTLGK

    >gi|148263446|ref|YP_001230152.1| alkylhydroperoxidase [Geobacter uraniireducens Rf4]
    MSILNNRERELVAIGAALGSNCVPCIEYHIQQARKTGLSDAEIAEAIEFADKIKRVPAEKVLEAASRRLSAPIDEQAAAP
    GACCTPATAAKSCC

    >gi|148263597|ref|YP_001230303.1| heavy metal translocating P-type ATPase [Geobacter uraniireducens Rf4]
    MQKAAFAITGMSCVNCAARIEKALGETAGISRASVNFAMEELLVEFDDAVITSGAIEEKVTKLGYGIRAKGGAGELRFGV
    MGLH
    CASCVNNLEKKLLAAPGVTAAVVNLAQESAFVRFDPSTIAPAEICAVVTAAGYQPVPEGAAKEDEAKTYRNQRNWF
    MASLLLSLPIMLTMGVHHIRAVGWMNLVLASIVQFTAGLTFYRGSFYALKSRSANMDVLVALGTSAAYFYSLFAFFGAFG
    EHGGEVFFETSAMLIAFIRLGKYLEARARGKAGEALKKLLRLQADKARLITDEGEKEVPASMVRVGDLLLVRPGETIPTD
    GEIVEGSTSVDESMVTGESVPADKVAGDAVTGATINRTGLIRVRATRVGEETLLSQIVKMVQEAQGDKAPIQRFADRVSG
    VFVPVVVALALLTFGLWYALLNEPFLFAFKLVIAVVVIACPCAMGLATPTAIMVGSGVGLSRGILIKRGSVLENISRLQA
    ILLDKTGTLTEGRPTLTDVVVAKAVDEGRFLECLASAESQSTHPLAQAAVQGATARGIAPGPVSDYREKGGFGVACTFGG
    MQLMAGSARLLEEAGISVASLEASALRLAEEGKSLIYVAAGERLLGIAALADRLKASSAAAVVEMRRLGIKTFMITGDQR
    AVAAAIARQVGVDGFEAEVLPDRKQQVVKEYQEKGLSVGMVGDGINDAPALARADIGIAIGGGTDVAKETGDVILVRDDL
    MDAVRAIRLGRATLAKIKQNLFWALFYNILGIPIAAGVLYYPLGITLKPEFAGLAMAFSSVSVVTNSLLLKRVRNKL

    >gi|148263622|ref|YP_001230328.1| rhodanese domain-containing protein [Geobacter uraniireducens Rf4]
    MKRRDIFTVLGLLLVALTTGSLLSGCNSSSATAATAPTATAQLSDYFKSTDWVALHASDQNFVIVDTRPAAKYNAGHIPG
    AINIPRDQFYFPRKVIDAATGSYKVDSNGQPVQIAYDIPTPAELIDILTRNGITPDTTVVAYDNDTSSYGGRVPWVLKSY
    GHAKAYVIDGGIDKWKDVDGRTLSTTAVIPTPSAKPYKITSYQNHRVTKSDLAAVIDTANGNVTKAGYVISDVRTPSEYT
    GFVTTVTSGTASTGAWTQNSTPLVYSTNQGARPGHIPYAKFSDYESAVYTDYINPATGQPVASTLQPGRNVKVLKSAAEI
    QAHFTSLGITPDKIVYNH
    CEGGFRSGVYTLILLGLGYPNVYNYDGSWNEWSIQGAAYPVVTGDGRVSGP

    >gi|148263623|ref|YP_001230329.1| rhodanese domain-containing protein [Geobacter uraniireducens Rf4]
    MKRGIVISFVALMALAITVLAGCGSSVTEKTPAAPVAKAYSDPTMATDAATLKASLGKAGTVIIDARSASAFSAGHIPGA
    INAVWQSFATVGTGVPGDANWGVLKTAAEIGIALGNLGIDASTEVIVYADAPGGWGEDGRILWMLRMAGVTKSKLLNGGL
    NGWKAAGYGLTTAATPAPAPTTLSIASFTGDYVVEKAWILANMAGSDVKIIDARDPEEFAGAVKYGEKRGGHLPGAINMP
    FNTALYTNNPANPGIIKSQDELEALFTAAGIKKTDTIVSY
    CTKGIRSGLMTMILRMAGYSKAVNYDASFYEWAGDATLPV
    Q

    >gi|148263627|ref|YP_001230333.1| rhodanese domain-containing protein [Geobacter uraniireducens Rf4]
    MQIIAKFIQQAKRAGLHHVIMVLLMVVTVIVSCFSAATAADLRLIDAAALKGNSAKWVILDARPKADWETGHIPGAIQFS
    WDNYTRTDAKGVKYSSFPPQELAVALAGLGIDEKTPVVVYGDADKSWGGEGYNIWLLSWLGHKGPIRLLNGGIQAWRNQN
    LPLAKGPEKPAAKKARYQVDLKPPYIVSTEEVQKGKGSFVLVDVRSTFEWIKGRIPGAIHIPWEDFYTGKDHHPLPPAEL
    KKLLAKHGVDTSKPVVYY
    CLGGVRSAYAWTAHQLAGLPEARNYKGSWAAWEKRAGQ

    >gi|148263809|ref|YP_001230515.1| peptide methionine sulfoxide reductase [Geobacter uraniireducens Rf4]
    MGDVRETATLAAGCFWCVEALFKRLEGVERVASGYAGGEVANPTYEEVCSGTTGHAEAIQITFDPEVISFEELLQVFWRS
    HDPTTRDRQGADVGSQYRSAIFCHDERQRQLAERSRAEAETLWIEPIVTEIVPFKNFYPAEGYHQDYYRLNRNQPYCRLV
    IDPKIQKLQKDFSERFKETPGD

    >gi|148263860|ref|YP_001230566.1| hypothetical protein Gura_1803 [Geobacter uraniireducens Rf4]
    MYRVMVLTGLMLGLSAGSALAMAKEGCGGECVSCHSLSEKEAGTLLKGLGTVKSVKPSPVRGLYELRLEKDGTQAIAYVD
    YGKKNIIAGQIFDIASRQLVTTKITASPIKAEKIDVGKIPLDNSLVMGNANGTKKLFVFTDPD
    CPYCANMHAELKKLVEM
    DKDIAVYVKLFPLEMHPKAYDKSRLILSENSLNLLDTAFSGGKLPEPLAKHSGKGVDETKAFARSVGISSTPTLVLPDGR
    ILPGFRDALAVMRSVNGETQ

    >gi|148264275|ref|YP_001230981.1| hypothetical protein Gura_2225 [Geobacter uraniireducens Rf4]
    MENSVINKSGRTDMKTVLLWSAVTAGLVLAVLSALKICTAACSESTKYDIFGIDFGWFGVVFFIISIVTLGLRNRGAWLS
    SCFSSLVFAGFGAELRFLWLQKFVIGRWCPLCLWIAVMVFVAAIVLVYEKFLVTRMSRGDMKSSLKFLVIMLVAIALGAM
    SAMVGVRKEADAAGLNIYLGKQNSPTTVYFVSDWF
    CPGCRRLEPKIEKMYPALARQTRIAFIDYPIHPETSNYTPYNLQF
    LVYEKDKYIQLRRALSELSMKVKAPSNEQVQAAVAPYGVKLRQLNFMDVMNGVKQNESIYRGYGVNATPTVVVANEKTKK
    RKLLVGDGEITSQAINAAISAVEK

    >gi|148264330|ref|YP_001231036.1| hypothetical protein Gura_2283 [Geobacter uraniireducens Rf4]
    MSGNDLKDENVRIKRLIELDKSTLPSDGGPEFNRLIFAMSPYLLQHATNPVDWYPWGEDAFAKAAADDKPIFLSIGYATC
    HWCHVMEHEAFEDREVAAVFNRFFICIKVDREERPDIDEQYMAVAQMMTGSGGWPLNIFMTPEKKPFFAATYMPRTPRMG
    MPGIIQILERVAELWRTERQKLEQDSDVTIEALTHHFQPHPGSLPDMVLVQNAYQQLTEMYDDLWGGFGNVPKFPMPLYL
    TFLLRFWKRSGNGASLAMVEHTLRMLRQGGIYDQIGFGFHRYAVDRQWLVPHFEKMLYDQALIAIGYLDAFQATAVPFYR
    QVAEEVFAYVLGEMTSPEGGFFAGQDADTEGEEGNYYIWTPAEIAAAIGHDEAQVFCRLFDVTEKGNFEGRNILHLPVPP
    ETFAAREAILTEVLTADLERWRHTLLKVRGNRIRPFRDEKVLTAWNGLMIAALARGYALSGEERFLAAAKRAAAFIGTRL
    TSPGGRLMRSFHLGEASVPAFLDDYAFFVWGLIELHQVTLEPEFLDSARFLADEMLRLFHSGKGGLYETGLDSEQLPVIR
    QSARDGVLPSGNSVAAFDLFRLGRITGDGRFLESGEAVVRTFMGDVTRQPLASLNFLSASDYHLGPEVTVTLAGNREELG
    GMLDAVHRRFIPNLALRYGGEGGESPTVGGLPTAYVCAKGACRPSVTRADALGALLDELG

    >gi|148264457|ref|YP_001231163.1| putative oxidoreductase [Geobacter uraniireducens Rf4]
    MCNNLTAKERLAIDRVHMPELDAELRSRNFEEVNQGLAREEAVREAQRCIQCKTRPCVEGCPVGVSIPEFIDALAAEKLP
    KAARILQGDNALPAVCGRVCPQESQCEARCVRGVKGEAVAIGYLERFVADWAMTNADKLRSEPLPTGTGKKVAVVGCGPA
    GLTAAGELARKGHTVTIFEALHDTGGVLRYGIPEFRLPKEIIDVEVDRLLALGVEIECNVIIGKTMTLDQLREQFDAVFI
    ANGAGLPVMLNMPGENLKGVYSANEFLTRVNLMEAG
    CNPNSPTPIIKGNSVAVIGGGNTAMDCVRTARRLGAERAMIIYR
    RSEAEMPARIEEIRHAKEEGVEFVMLTAPLEIIGDDKGWTAALSCEKMELGQSDESGRRKPVPVANSRYEVPVDVVVNAI
    GTRSNPLLTATAPDLALNKWGNIVSDEQGATSIPGVFAGGDIVRGGATVILAMGDGKQAAAAIHGFLSGAA

    >gi|148264490|ref|YP_001231196.1| methyltransferase type 11 [Geobacter uraniireducens Rf4]
    MSRPAEEIRNEVSRDYAKRIAAPAGCGCGCGSLSPQGPLATLAGYSATELSSVPAEMTTSSFACGNPLAYAGVREGDVVL
    DLGSGAGLDLLLAAQKVGPTGRVMGVDMTDAMIAKANENIRAAKVTNVEVRKGIIEALPVESGSVDWVISNCVINLSPEK
    QKVFREIFRVLKPGGTMLVSDIVAKDLPSELLAIPTLYSS
    CISGAISEEAYLEGLREAGMVEVKVLDRLVYDAGQIAGFA
    ETALGEAFDRTPQISKRIGSYAKELAGKIWSAKVYGKKPA

    >gi|148264495|ref|YP_001231201.1| alkylhydroperoxidase [Geobacter uraniireducens Rf4]
    MELNDRIRELIAVGASITANCQPCLRIHVEKALKSGADPQEVTAAIEIGKRVRKGAADKMETFSSNLQAGKSQGFEVVME
    GNGYQFLGP

    >gi|148264583|ref|YP_001231289.1| rhodanese domain-containing protein [Geobacter uraniireducens Rf4]
    MYSPTRLIRKYLMPMIGLFLLLAVSAPLPAAEAEFKSISSERLKDMVDENKAFILIDARTKAEYQEAHIGKAINIPDKDF
    DGLVSLLPVDKHSLMIVY
    CNGIKCGKSKKVAVKAQAAGYDNILLYSEGFPVWEEKGMPIVAGPDYAKKIETSKLSPADIE
    KFIKEKKQDYVLVDVRDEFEFEEGHIPTAINIPAETFAVKSGVLPKEKKIIVY
    CNTGGRSYMAYRKLMKLAYPTIYQTIF
    TEWKEAKLPVEK

    >gi|148264591|ref|YP_001231297.1| protein-disulfide isomerase-like protein [Geobacter uraniireducens Rf4]
    MTIISRKFCAGLLLALACTSAAFAASAALKPEEAFKQAYPQVKVDSFEPADINGIYQVVTGQNVLYYVPEKDYVILGEIF
    TKDGKSITAERKGRLAAKLVESLPLEKAVKIGDGKKVVIEFTDPD
    CPYCRKASEFLAKKTDVTRYVYFAPMAHPAAISKI
    QYILSSENKAKAYGEMMLGMEIPKAAPAVSNEVKSLAQEHMELAKKMGVQGTPTFFISGQQVVGADLAKIDQLLK

    >gi|148264657|ref|YP_001231363.1| peptidylprolyl isomerase, FKBP-type [Geobacter uraniireducens Rf4]
    MNMNHCQRIISSHAVKRSLVILAAVSALAGCAGQPLKSAAVQETPPAAGTNQAASPEKANAALDEAVKSGRTTASIDLNE
    TPGTVQKGDVVTVDYTVTDAAGKLLRTSRAAVANDPGQRLAPEEIIAGTPAAIPGLGEAVPGMAIGGKKSVKLPAEKAFG
    LSDPAKIFQFPTVKTISKTIRMPADEYVKQFGAFPVVGKELELAPYFKSRITAVSEKEATLEFLAKDGERFTEPYGEVQV
    RLDGEQISINIAPRIGAPLEVQGKRGTITAVDAASFTADFNHPLAGKDITLDLEVVSLVKASALGKHAITWLEDHDKGLS
    AAKENGTPAVLVLYAEW
    CGWCKKLFEESVQDPRVRLLSDRFVWLKVNSNKEQKFKAQYGQDGFPLIVVLDRDGREATRID
    GFRDGEALSRELRAVTENLKI

    >gi|148264999|ref|YP_001231705.1| YruB family glutaredoxin-like protein [Geobacter uraniireducens Rf4]
    MPAIIRTIIVLTFILLAAICQAETAADGPQSPISPAAPAKHKYPKIVLYSVSWCPHCKQAKEYFTKNNIPFINKDVELDD
    AAMNDLTRKYKSQGVPVIVIGDDKVILKGFDEQKFLKAIKGLQEK

    >gi|148265043|ref|YP_001231749.1| protein-disulfide isomerase-like protein [Geobacter uraniireducens Rf4]
    MKSLATALLLVTIAAGSASAMSKEGCGGDCAGCHALSVKEANDLVKGLGGKVTRVKSPAMRGVWEIDLEKEGKKAVAYLD
    FGKKYLIPGPIFNLTTKKPIAAGEQQTSPVKKVKSSSIPLGNSIVMGNPKGKKRLFVFTDPD
    CPFCAKLHGELKKLVAMD
    PDVAVYVKLFPLKMHPTAYDKSRVILQGPSAKLLDDAFAKLQLPAPGPETSAKGVDETIRLAKSLGVNSTPTLIFPDGSV
    MPGAKDAVEIKTLLAGKTGKKK

    >gi|148265288|ref|YP_001231994.1| methylated-DNA--protein-cysteine methyltransferase [Geobacter uraniireducens Rf4]
    MRKQESGEYRSIFVTEFGSGAVVASAEGLVEVFLPFAGNSPAEMAERVGELYPSAVRENPLTMKAAGLLQRYFAGEKVTF
    DIKIDRRGFTPFQQAVYAEVSKIPYGMVKTYGEVAGAIGRQRAARGVGTSMARNPLPIIIP
    CHRVVGGAGDMTGYSGAGG
    IVSKRLLLTMEGVVLDDCGRVKPSVPGRNDR

    >gi|148265376|ref|YP_001232082.1| uncharacterized peroxidase-related enzyme [Geobacter uraniireducens Rf4]
    MARITTIETGTAESEVKEIFAEVEGAFGMVPNLFKTYAHHLPLLRANWSKVKAVMAEGSLSQKTKQTIAVLVSRDNSCAY
    CVAAHTGALRSLGVSESEIKTIEEDLEKADFSGKEQALIAFARKANFSPLRISDEEFAALRRTGATDAEIIEALGVMELF
    TSFNKFLDSLQVEIDF

    >gi|148265422|ref|YP_001232128.1| hypothetical protein Gura_3399 [Geobacter uraniireducens Rf4]
    MKLSSAITTAFFLIILSGASALAAPQLVVDEPNFSFGTIPQGKKVNHVFAIRNSGDTPLTIQRVRPSCGCTTANASSPVI
    QPGKSGEIKITFDSTNFFGKVSKTVFIDTNDPKSPAVTLTLTGSITEEIQIAPRQLNLGQTKIGTPKEVTISVTNRGNRP
    LKLVSAKSPISQVVARIRKDQLKPGESGVIDVTVTPRAEDRMLSGYLFITTDNPQKSEIMVPLYASAVK

    >gi|148265531|ref|YP_001232237.1| methyltransferase type 11 [Geobacter uraniireducens Rf4]
    MDIPRIFNITESAHRIHNPFTPEKLATLGAALRLETGTRVLDLGSGSGEMLCTWARDYGVIGTGIDMSQLFTEQAKLRAE
    ELGVADQVEFIHGDAAGYVSDEKAGVAACLGATWIAGGVVGTIELLAQSLRTGGIILIGEPYWRQLPPTEDVAKG
    CLAGS
    ISDFLMLPELLASFGHLDYDVVEMVLADQDGWDRYEAAKWLTMRRWLEANPDDEFAKDVRAKLTSEPERYAAYTREYLGW
    GVFALMTR

    >gi|148265604|ref|YP_001232310.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Geobacter uraniireducens Rf4]
    MSRIGVFVCHCGENISRTVDVERVAREAGALSGVAFATDYKYMCSDPGQNLLKKAVAEHNLDGIVVAACSPRMHEKTFRK
    AAQSAGLNPFLCEMANIREHCSWVHEDREEATAKASEIVAMLVERVKKDKKLAPITVPITKRSLVIGGGIAGIQAALDIA
    DAGHQVVLVEREPSIGGHMAQLSETFPTLDCSQ
    CIMTPKMVDVANHPNITLHTYSEIENVDGYIGNFQITIKKKARSVDM
    AKCTGCGICMAKCPQKKIPNAFDRNMGMRPAIYVPFPQAVPNTPVIDRENCTWFKTGKCGVCQKVCGPGAVDYTQEDELI
    VEKVGAIVVATGFELYDITEKPKGSPIKGYGEFGHGKIPDVIDGMTFERLASASGPTGGKILRPSDGKEPKQVVFIQCVG
    SRAREKGISYCSKICCMYTAKHTMLYKHKVHDGQAYVFFMDARTPGKGYDEFWRRAVEEEEAGYIRGMVSRLYQKGDKVV
    VMGSDISVGVQVEIEADLVVLATAVQPRQGADTLAQKLGISYDKYNFYSEAHAKLRPVECATAGIYLAGACQGPKDIPDT
    VSQASAAAAKVMTLFSRDELEREPIVAKVNEKNCVACFYCKKVCPYGAVEEKEIRDRNGNLIRVVAYVNPGVCGGCGTCQ
    ATCPSKSVELDGYTDEQIVAMIEAL

    >gi|148265759|ref|YP_001232465.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Geobacter uraniireducens Rf4]
    MKKIIFAVMILFSVAVIGCSRQEEPVIEGKVAPDFTLKDLAGRQVRLSDFRGKVVFLNFWATWCPPCREEIPSMVRLDRM
    MAGKPFQMLAVSIDEGGKDAVKRFFKNSGAALPALLDTDQAISKRYGTTGVPETFILDKKGVIVKKVVGGMDWSDPQVVA
    FFNEIMKPQM

    >gi|148265769|ref|YP_001232475.1| mercuric reductase [Geobacter uraniireducens Rf4]
    MQSAPFILPDDDHNRTLVDNVHPGNWTNPAPAERYNLVVIGAGTAGLVTAAGAAGLGAKVALIERHLLGGDCLNYGCVPS
    KGIIRAARAIHDVRTAHEFGVDGGESLPIDFTAAMKRMRRIRSEISPHDSARRFRDELGIDVFFGAGSFTGSDSVEVGGK
    LLRFKKAAICTGARAAAPPIPGIVEAGYLTNETVFSLTELPQRLAVIGGGPIGCEMAQTFARLGSKVTVLEYSDHLLSRE
    DADAAEIVQNALMDDGVELCLRASILAVARRDNDKIITVEQDGKGMELAFDEILVGIGRAPNMEGLNLEAAGVAYDPKVG
    VTVNERLQSTNPRIFAAGDICFPYKFTHSADALARILIANALFMGRQKTSALTIPWCTYTEPEIAHVGMYEREAREKGIE
    VTTLTVPLSEVDRALLDGESEGFARVHLRKGTDRILGATIVARHAGEMINEMSLAMTAGLGLSAVGKTIHPYPTQAEAIK
    KLADAYNRTRLTPFVKKILSVWLKWQRKTQ

    >gi|148265771|ref|YP_001232477.1| radical SAM domain-containing protein [Geobacter uraniireducens Rf4]
    MWNHQFPVPSSQFTIHGVKMVAVFKERLLKINPVYIRFDSLQTLQLNLGNLCNLSCSHCHVNASPHGKEIMDKEVMTKVI
    AFLARQSGITLDITGGCPELNPHFRFLIEATDGLSPRRIVRSNLAITQEAGMAWLTEFYREHDLVITASLPCYLEENVDR
    QRGQGVHAKSIAALKKLNALGYGRTHELNLVYNPGGDYIPGAQKELETAYKAELLECYGVTFNNLYAITNAPIGRFREYL
    EMKGAYERYLNLLATSFNPDAAQNIMCRTLVSVDWKGFLYNCDFNQAIGLPITDEDGGILMIDDLENAARTGNELFLAQH
    CYCCTAGEGSS
    CTGVLA

    >gi|148265935|ref|YP_001232641.1| rhodanese domain-containing protein [Geobacter uraniireducens Rf4]
    MIANQKPHILVEMAMIFLLAAAAGIGWNHKLLADAWSGKAVQPKQEAVPASPQGTTPLPLGLMQVKEIYDHKEGTFVDAR
    DTETYAAGHIKGALSLPPGDADGGLTVLNSRVKPETTIVVY
    CNGFDCHDSMDLGNRLLKAGYRKVYVFLGGYPEWRDAGY
    PTDGGKP

    >gi|148265956|ref|YP_001232662.1| UBA/THIF-type NAD/FAD binding protein [Geobacter uraniireducens Rf4]
    MLSEEQIARYSRHIILKEVGGKGQKKLFDGRVMIIGAGGLGSPIALYLAAAGVGTIGIADADVVDLSNLQRQVIHQTKDV
    GIAKVLSAKEKMQAINPELKVNTYQEWISAANIADIISEYDFVIDGTDNFAAKFLINDACVLAGKPYSHGGILQFDGQTI
    TIEPGKSPCYRCLFPAPPPKDAIPT
    CSTAGVIGVLPGVIGTIQATEAIKYLLGKGELLTGRLLTYNALRMRFREVPVKKS
    AKCPICGENPTITELKDELDALTVCDLETK

    >gi|148266043|ref|YP_001232749.1| thioredoxin reductase [Geobacter uraniireducens Rf4]
    MSIIHHRLIILGSGPAGYTAAIYAARGNLNPVIITGMQQGGQLMTTTEVDNWPGDPDGVQGPELMDRMLRHAERFDTQVI
    YDHIHKADLKQRPFVLEGDSGTYSCDALIIATGASAKYLGLPSEEAFKGKGVSA
    CATCDGFFYRGKPVAVIGGGSTAVEE
    ALYLSNIASHVTVIHRRDQFRSEKILADKLIEKTKGGNVTIEWHHNLDEVLGDETGVTGIRIRHTSGSTKDLQVHGCFIA
    IGHQPNTDIFEGQLEMDNGYIRTQCGNEGNMTATSVPGVFAAGDVQDQTYKQAITSAGTGCMAALDAERYLDMLKA

    >gi|148266083|ref|YP_001232789.1| methionine-R-sulfoxide reductase [Geobacter uraniireducens Rf4]
    MTYRYAMPAFLLLLTAICGPLRLSVTSAAQPLQLKVYSAERKGFIMTQKVVKTDEEWRKLLTAEQFRVTRKKGTEKPFAN
    EYWNNHEKGIYQCVCCGLDLFSSDAKYESGTGWPSFWQPIAKENIRTEADNSFFTRRTDVLCARCDAHLGHVFDDGPKPT
    GLRY
    CMNSASFKFKRAE

    >gi|148266234|ref|YP_001232940.1| rhodanese domain-containing protein [Geobacter uraniireducens Rf4]
    MKKTGLISAIILTAASLAIAAGQRNISSLQARALLAKNKNAFLLDVRTPDEYRQAHLKGAVLIPLNEIERRLGEVPKNRT
    IVVY
    CAVGSRSNLVAGFLAGKGYGEVYNVSDGIVGWYRNHLPIDR

    >gi|148266329|ref|YP_001233035.1| protein of unknown function DUF395, YeeE/YedE [Geobacter uraniireducens Rf4]
    MATGFIMHRSDFCMAGMFRDLFLFRQNSMLRILALAVIASMALFEAARQTGLLLYPFPLFGSPSLANLVGGLIFGIGMVL
    AGG
    CVAGILYKMGAGSLLSAIAFAGLIAGSTVYAEIHPWWGEFARATTIFKGKVTIPQIMGIDPASVIVAVLAVALFLFH
    RWFREGKWARRSRAEGYLQPWKAALLLALIGLCSALIIGMPLGITTAYAKMGAYLENAFFPAHTAGLAYFQAIPLDYISP
    VGNTHLVGGPGWRFDAIAAVQFPLVSGIVAGGTLSALLLGEFKIYFRIPVRQCLSAFAGGTIMGMASRMAPA
    CNIWHLLG
    GLPILAGQSVLFLSGLFAGAWLGSRILVKWVVRC