Allochromatium vinosum DSM 180 uid46083

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|288939835|ref|YP_003442075.1| Glutathione S-transferase domain protein [Allochromatium vinosum DSM 180]
    MTLYSDPTCPYCHRVRMVLAEKGIAVDVVDVDAKALPDEVMDFNPYGTVPTFVDRDLRLYESRIIMEYLDERFPHPPLLP
    VDPVSRANARLFMYRVDRDWYSLMGRILHGEGGEVEQARKELRESLTATAPVFGAHAFFMSEEFSLVDCCVAPLLWRLPV
    LGVELPKQADPIRVYMKRIFTWEAFRRSLTEAEKEMIADIRR

    >gi|288939846|ref|YP_003442086.1| peptide methionine sulfoxide reductase [Allochromatium vinosum DSM 180]
    MRQTHRWPLIALGLSALLHTGTDNQATAAQNPARDPSGVAPDPTADTIVLGMGCFWGAEKRMSELPGVIDVESGYANGEI
    EGTYEAILAHERARRRGADEKRNHAEVVKVRFDPARVSLEQVLAKFWESHDPTQGDRQGNDVGSNYRSAIYTSSPEQAAV
    AERTRARYQAALTQAGRGAITTEIAPLSAYFRAEEAHQDYLRKNPRGYCGLGGTGVAYPGTASGVDEAAESPSPDPLDGA
    TLERARQLVMFEAEYCGACKQFKAEVLDHWQSPVPVARSLSFSAPTGWTLDKPLFATPTLVLFEDGREVSRYTGYDGDAT
    RFWSWLGGQILTPEQRRIAFEQGTERAFTGSLLDEKRSGTFVDPITGAPLFRSETKFESGSGWPSFFDPVDGAITFHEDV
    SHGMRRVEVRSASSGIHLGHVFEDGPPPTRKRY
    CINSRVLSFVPDP

    >gi|288939869|ref|YP_003442109.1| iron-sulfur cluster assembly accessory protein [Allochromatium vinosum DSM 180]
    MSLAITEADLTLTGPAQAKMSDLFQQVDDSVQGVRVFATAGGCSGVSFGMTFTDVINEDDGVLSFDGFKVVVDDGTLEYL
    RGVEIDFVDQGDGNATFIFNNLPQMGGGCGSCGSSSGGGCS

    >gi|288939871|ref|YP_003442111.1| iron-sulfur cluster assembly accessory protein [Allochromatium vinosum DSM 180]
    MNAEADLEAPLVFTASAASKVAELIRDEGNPGLMLRVYIQGGGCSGFQYGFTFDEDVQDGDTEVVTDGVKLLVDPMSLQY
    LMGAEIDYTEGLQGAQFVIRNPNATTTCGCGSSFSA

    >gi|288939907|ref|YP_003442147.1| Redoxin domain protein [Allochromatium vinosum DSM 180]
    MKITALTLCLLAFGSMATQAAELNAPAPGCRVQTLTGQSSVDPAAFPGKVVYLDFWASWCIPCAKSFPVLDQWQSELGGR
    GFEVIAINLDEERQEALDFLQQHPVRFTIGADPAGKCPRLYAVRGMPTSYLIDRQGRIREVHEGFKTSDAAGLRARIESL
    LSER

    >gi|288940015|ref|YP_003442255.1| Rhodanese domain protein [Allochromatium vinosum DSM 180]
    MPYQSVRRFVALIVASLVFVAGAQAGGLDLSPQEALAKAKAGEILLIDIRTPPEWRETGVAPEAHRIDMTDPKFLERLLQ
    DMGGDKSAPIALI
    CRTGNRSGYVQKQLQKMGFSQVHNVPEGMAGSRSGPGWIRRGLPVETCTNC

    >gi|288940072|ref|YP_003442312.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Allochromatium vinosum DSM 180]
    MVSTETPLCDFGAPAPDFALPGVDGRIWTRDQCKGPRGLLVMFICNHCPYVKAIRDRLVRDARELAALGIGCVAISSNDV
    NDYPEDSFDHMKQVAEAFHFPFPYLYDESQAVARAYGAVCTPDFFGYDSELGLQYRGRLDASRKEAAPPDVRRDLFEAMK
    QVAETGAGPIEQIPSMGCSIKWKAH

    >gi|288940119|ref|YP_003442359.1| methylated-DNA/protein-cysteine methyltransferase [Allochromatium vinosum DSM 180]
    MCHDAQCLIETPIGRLGLHWRGDVLTGIELDPLPADGQSPSECEPPQAITRQLDAYFQAPETRFELPLELAGTAFQQRVW
    ALLRAIPAGQTRTYGEIARELGSAARAVGQACRANPCPIVVP
    CHRVVGQRGLGGFAGDLSGRRLAIKRRLLEHEGILRYS
    TLVDSTLGPTTVL

    >gi|288940122|ref|YP_003442362.1| Disulphide bond isomerase, DsbC/G-like protein [Allochromatium vinosum DSM 180]
    MNRLTQRLLIAAALVLSSGLALAAPEQKIREALKEIAPDLEISNIQPSPIKGLYEVMAGTDLMYITADGRHFISGHIVDL
    KTREDLTEPRLSEARKRLIDRIGENDMVVFGDKDAKHTITVFTDIE
    CGYCRKLHSQIADYEKEGIRVRYLFFPRAGKGSP
    AFDEAVSVWCAGDAEARRTAMTKAKAGEPVASKTCDNPVEEHMALGADLGLRGTPAILTDTGELIPGYVEPKRLAAQLNS
    QSGG

    >gi|288940245|ref|YP_003442485.1| UBA/THIF-type NAD/FAD binding protein [Allochromatium vinosum DSM 180]
    MTDDDLLRYSRQILLPQFGIEGQERLRESSVLVVGLGGLGSPVALYLAAAGVGRLLLADFDRVDLSNLQRQILHTTDRIG
    LAKTESARRALQAIAPNVELIPVEVPLTSETLPELVGDVDLVVECSDNFATRFAVNAACRAACVPLVSGAAIRLEGQVTA
    FSGQPGGPCYRCLYPDEGTIDET
    CTANGVLAPLVGIIGSVQAAEAIKILTGLGVPLFGRLLLLDASRMEWREVRLRPDPA
    CPVCAESAGISAPTAP

    >gi|288940306|ref|YP_003442546.1| electron transport complex, RnfABCDGE type, E subunit [Allochromatium vinosum DSM 180]
    MSTPQSYGSILSGGVWSNNQMLVALLGLCPLLATTTSATNGLGMGLATLVVIVCSNGTVSLVRNLVRPEIRIPVFVLVIA
    SFVTLVELIMQAFFYDLYQVLGLFISLIVVN
    CMIIGRAEAFASKNRVDRALFDGLAVGLGATLVLTTLGGLREFVGQGTL
    FHQADLLLGDWAKAISLSLGEDFQGALIAILPPGAFIGLGLMIALKNLIDQRAKRRAAARAVPAVRTDPSPA

    >gi|288940312|ref|YP_003442552.1| electron transport complex, RnfABCDGE type, A subunit [Allochromatium vinosum DSM 180]
    MTEYALILVGTVLVNNFVLVKFLGLCPFMGVSKKLETATGMGLATTFVMTLSSVISWIVNEFVLEPLDIGYLRTISFILV
    IAAVVQFTETVMRKTSPMLYQLLGIFLPLITTN
    CAVLGVALLNQQAEHTLVESALYGFGAAIGFSLVLALFAAIRERVAV
    ADVPEPFQGSAIALVTAGLMSLAFMGFAGLVAN

    >gi|288940347|ref|YP_003442587.1| thioredoxin [Allochromatium vinosum DSM 180]
    MSDSIVHVTDDSFEEEVLKSPDPVLVDYWADWCGPCKMIAPVLDEIADEYAGRVKIAKLNIDENPNTPPRYGIRGIPTLM
    LFRGGEVEATKVGAVSKSQLTAFIDSNL

    >gi|288940350|ref|YP_003442590.1| thioredoxin-related protein-like protein [Allochromatium vinosum DSM 180]
    MLVTAIWLAVGTQVWALDIRADLEAAVAAGKRGLMVYFDQEDCAYCERFKQVNLADPDILAYLQRHFDLISVDIHGRAEV
    RTLDGERLDVQTWARREQTDFTPSILFYDADGRLALWLRGYHPPYAFRAALEYVADGHDRRESFDDYLARGDERLVFDSE
    DLNDQPFFSPPPHVLDRRIPAERPLAVFFERGDCHPCDVLHDQVRRSPEIRRRFEALDTVQLDRRSETPVITPAGERTTA
    RAWADALGLQHAPAILFFDGRGRELQRLDSVAGFRRLSQRLDDILASDRASCQVESP

    >gi|288940437|ref|YP_003442677.1| thioredoxin [Allochromatium vinosum DSM 180]
    MSHSPHVVTVTAANFHAVVIEGSYERPVLVDFWADWCAPCRMLMPMLAKLAEQYGGRFLLAKVDTEAEQALAAQFGIRSL
    PTVQLFRNGQVVDQFMGALPEPQVREFLDRHLPRASDGLLQQAEAAMAGGDPAGARALIDRARAEDPDNKRLPLIEVRLL
    ASSGEIAKALEAIDGLPLEFVSDPEVAALRGQLNFAAAIEGAPGETELNARLDADPRDSEARYQIAAHRVLRGDYERALE
    HLLELMKRDRAYGEDAGRKGMLAVFDLLGGGNDLVARYRAKMMTALY

    >gi|288940438|ref|YP_003442678.1| thioredoxin [Allochromatium vinosum DSM 180]
    MSQSLHVVCPQCDAINRLPAERLGSDPKCGKCRAPLFASHPLALDAARFERHLTRSDLPLLVDFWAPWCGPCRMMAPAFE
    SAAGRLEPAVRLIKVNTEEEQVLAGRLGIRSIPTLILFRNGAEVARQAGAMDAAGIETWARRQIGR

    >gi|288940526|ref|YP_003442766.1| heavy metal translocating P-type ATPase [Allochromatium vinosum DSM 180]
    MEEEHCFHCGLPIAAGARETAEIAGTECAFCCTGCKSVCLAIHAAGLEGFYRRTPEGALLGPPPEPPKNLTLFDLDAVQE
    EFTDVAAEDREINLLVEGIH
    CAACVWLIERGLQSLPGVEEARVNLTGRRLRVRWDNGRLQLSRILRRLADLGYAATPFDP
    DASEGAIARENRALLFRLAWAGFAMMNLLWISIALYSGADQGEFRELFHWLGFLLATPTILYSGAPFYRGAWSGLRSGHL
    SMDLPIAIGVSVTYGYSLYVTLGGSEIGAVYWDTVVNFLFVILVGRYLEAISRRRAVAATQRLFDLQPRVATRLQDDGGE
    TVVPIRSLVVGERVLVRPGERIPVDGEILDGGSGVDESMLTGESRPVPKTAGDRVSAGTINGAGVLRVRVTGLLAETTLG
    RIIRLVEEAQASRAPIQRLADRIVPWFVAATLGLAALTFVLWVQVDLERALTAATAVLIITCPCAFGLATPMAIAVASGV
    GAARGILIKNGAVLERLSSIRHLVFDKTGTLTEGRPAVVAIAGAGADWRPLDPESPVLTDEQRADLRLIGALERLSEHPA
    ATAVLDLCERAGIDPGGLTVEAVEVEPGLGIAGRVAGRALVIGRAEWLTCQGIALPSDPESNTEPDSRILCAIDGRLTLR
    LGVADQLRPGAESVVARLRAQGLRVTLLTGDRRTAAERIAGRLGSIELIAEVLPEDKDRVIDDLQRAGEPVAMVGDGVND
    APALVRADVGIAMGSGTDVSIASADIVLMSSELERVLEASELSRRTLTTIRQNIALSILYNLVMVPLAMAGVVTPLIAAV
    SMPLSSLAVIGNSARLGARFKSSDSHHPTR

    >gi|288940541|ref|YP_003442781.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Allochromatium vinosum DSM 180]
    MADDSEPTPDSACAPPAPTARQRWRRRLGGWLVNLVLIAAIVVGVQWWKGRTLVTGEAPPLVGRTVDGTSIDLADWRGRP
    VLVHFWATW
    CPVCRITDGTIDAIADDHAVVTVALQSGTEDEIRAYMHEAGQDFRVVSDPDGRLARTWGVAGVPTSFVIDG
    DGRIRSSIVGVGTGLGLRLRLWLAGR

    >gi|288940542|ref|YP_003442782.1| dihydrolipoamide dehydrogenase [Allochromatium vinosum DSM 180]
    MSTIIEVKVPDIGDFKDVQIVEILVVPGDRIEPETSLVTVESDKASMEIPSPRAGVVKAVNVKIGDLISQGDPILTLDVA
    SASVDESDDRASDDDAELAAETTAVQEIVTEVVVLGAGPGGYTAAFRAADLGKKVVLIERYPTLGGV
    CLNVGCIPSKALL
    HTAAIMEEVKTLGVMGVTYGEPEVDLAKMRAGKDKVVAKLTGGLTALAKQRNVQVVQGAGRFESPNRIGVETKEGRVRVR
    FDQAIIACGSSPMKIPGFPHEDSRVMDSTDALALADVPDRLLIVGGGIIGLEMASVYSALGSRIDVVELKNQLMPGCDPD
    LVKAVEKIIKKRYENIWLETKVASMSAGPEGIKVVFEGKHPGTELYDKVLVAVGRLPNGKLIDAEAAGVTVDQHGFIKVD
    QHQRTNVPHIFAIGDVVGGPMLAHKATHEAKVAAEVIAGQPSLFDPLTIPSVAYTDPEVAWMGLTETQAKADGIPYEKGV
    FPWAASGRALGIHRDEGMTKLLFDPETKRILGAGIVGPNAGELIGEAVLALEMGADMEDIGLTIHPHPTLCETIGLAAEM
    AHGSITDLMPPKKR

    >gi|288940604|ref|YP_003442844.1| Rhodanese domain protein [Allochromatium vinosum DSM 180]
    MSTMTEELPTGLSPREALEMLESHPQAILVDIRSSMEFLFVGHPKGAVHVPWIDEPDWVVNPDFVTEIRKLVLGGAVCEQ
    RQGCAPIILI
    CRSGKRSLEAGRALIREGFKSVFHVDEGFEGELDEQHHRSTLGGWRFHGLPWEQC

    >gi|288940606|ref|YP_003442846.1| Rhodanese domain protein [Allochromatium vinosum DSM 180]
    MYSSFNPERPVGLMDFVASAKSRIQEIAPEALSQTLDARRSDPLIVDVRESSEHEQGHIEGALLVPRGILEAAADPAYPK
    HMPELAAARERPVVLY
    CATGGRSAMGAAVLQMMGYKDVLSLAGGFAGWEAAGLPVKREARYV

    >gi|288940607|ref|YP_003442847.1| thioredoxin-related protein-like protein [Allochromatium vinosum DSM 180]
    MTTHRSRILALSLGALLSLPLPAQEGENTAQTEQATSTGKILGTRQSVHPDWFKDSFLDIDEDIDEATQHGKHVILLLEM
    NG
    CPYCARMVEENFAQASYRDFIQEKFDVIVLNVQGDREVALDAETSLPEKEVARQLGVRYTPTVIFLNAGGEPVARVDG
    YRNATDFKRVLDYVATRAYAKQTLAEFIAAESTSDYGFRPHPRLQSITDLSTVKDQPLAVLFEDAQCAAACNALHDGHLA
    APEVDAALAPFVLVRLDAQADTPITTPDGRQTTARAFAEELDIDYRPTLVLYDRGREITRIANELYRYHFIGILEYVGQR
    HYQTYPDSPFDYINAKTAERLAAGQDVHIADD

    >gi|288940649|ref|YP_003442889.1| Redoxin domain protein [Allochromatium vinosum DSM 180]
    MAQTALQGNPVTLSGELPAVGSVAPDFQLVDKDLADRSLADFAGKKKLLNIVPSLDTPVCATSTKTFNAAMAAKSDAVAL
    VISADLPFAMGRFCGAEGIDNVIGLSMMRSRHFAKDYGVLIEDGPLAGITARAVVVLDADNTVVYTQLVPEITEEPDYEA
    ALAAL

    >gi|288940738|ref|YP_003442978.1| Peroxiredoxin [Allochromatium vinosum DSM 180]
    MTQETTTTMPRLNEPAPTFDAPTTHGRKTLEDYRGKWLVLFSHPADFTPVCTTEFMGFARRHTDFQAIGCELLGLSIDSH
    YSHVAWVRNIKEKFDVEIGFPIIADLSMAVAKAYGMIQPGASDTSAVRATFVIDPQGVLRAMLYYPMSNGRSIDEILRLV
    KAMQTSDANKVATPENWQPGDKVIVPPPGSVEEANARAVSGEYECVDWYFCKKSL

    >gi|288940754|ref|YP_003442994.1| glutaredoxin 3 [Allochromatium vinosum DSM 180]
    MPQVTVYTTQTCPYCDRARRLLRRKGVDFAEIPVDHDRTRMAEMVERSGRHTVPQIFIDDFHVGGYDDMALLDMEGELDE
    RLGLDTDD

    >gi|288940907|ref|YP_003443147.1| electron transport complex, RnfABCDGE type, E subunit [Allochromatium vinosum DSM 180]
    MPELLNPQEKLTPDTFLRGLWEENPVFVMLLGMCPVLAVTSTTLNAIAMGLATTFVLVCSSLLISLLRNWIPKQVRIASY
    IVIIATFVTIVDYAIQAISLELYAALGAFIQLIVVN
    CVILGRAEAYASKQRLHTTLVNSLGMGVGFTLALLALGTVREVL
    GNGTLLGIPLFGPDFQPWLVMILPPGGFFVLGVWLLLFNWLRQSKVRRAAQFSGAPADAR

    >gi|288940908|ref|YP_003443148.1| electron transport complex, RnfABCDGE type, A subunit [Allochromatium vinosum DSM 180]
    MHAEPLSLIFLNAAIVNNFVLALFLGICPFLGVSGKKETAWNMGLATMFVMLVSSAAAYGINWLLTQLGLEFLRLICYIA
    VIASAVQLVEMFVKKTSPALFRSLGIFLPLITTN
    CAILGLALFQTSKEYDFVQSLVYALGAGVGFTLALMLMAGLREKLA
    LARVPSVSQGAALSLMLAGLLSLAFMGFAGLGGGHG

    >gi|288940984|ref|YP_003443224.1| DsrE [Allochromatium vinosum DSM 180]
    MKFALQINEGPYQHQASDSAYQFAKAALEKGHEIFRVFFYHDGVNNSTRLTTPPQDDRHIVNRWAELAEQYELDMVVCVA
    AAQRRGIVDEGEASRNGKDATNIHPKFRISGLGQLVEAAIQADRLVVFGD

    >gi|288941052|ref|YP_003443292.1| glutathione-disulfide reductase [Allochromatium vinosum DSM 180]
    MSQHFDLIAIGGGSGGLAVAEKAAQFGRRVALIEGAKLGGTCVNAGCVPKKVMWYAANLAAAVADAPDYGIQARSDGLDW
    GKLIAGRNQYIADINGYWDGYAERLGLTRIDGFARFVDARTVAVGDQHYTADHIVIATGGRPIVPRMPGAELGITSDGFF
    ALEEQPKRVAIIGGGYIGVELAGVLSALGTEITIVALEDRMLALFDPLISETLAENMTLHGIDMHLQFEVAGIERDEQGL
    VLAARDGQRLTGFDQVIWAVGRAPNTRELNLEAAGITVERSGVIPTDAWQNTTVPGIYAIGDITGREPLTPVAIAAGRRL
    AERLFNDKPDSKLDYENVPTVVFAHPPIGKVGLTEPEARERYGDTLTIYETSFTPMRYALNAHGPKTAMKLVCAGEDEKV
    VGIHLIGDGVDEMMQGFGVAVKMGATKADLDNTVAIHPCSAEELVTLKVPVRRPGQSG

    >gi|288941053|ref|YP_003443293.1| Redoxin domain protein [Allochromatium vinosum DSM 180]
    MFQDRTGSRIPSVTFHTRRGHEWVDVTTDELFAGKTVVVFSLPGAFTPTCSSSHVPRYNQLVPAFKELGVDSVVCVSVND
    TFVMNEWQKAQNADNLIFVPDGNGEFTEGMGMLVDKDAIGFGKRSWRYSMLVRDGVVEKMFIEPEVEGDPYEVSNADTML
    EYLAPNKPKPLDIAVFSRDG
    CPFCVKAKEALRNAGLDFEELVLNEDYTEQGLRAVSNAATVPQVFVNGKLIGGSDAVIAW
    LESR

    >gi|288941145|ref|YP_003443385.1| thioredoxin [Allochromatium vinosum DSM 180]
    MAVVELDTANFEQTIQNNAFVIVDFWAPWCGPCRSFAPVYEKVSEDFPDIVFAKLNTEEHQAIAGHFQIRSIPTLMIFRD
    QIIIFSQAGALPEGSFRDLLTKAGELDMDDVRRQIAEQSNAQA

    >gi|288941166|ref|YP_003443406.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Allochromatium vinosum DSM 180]
    MSSSSAPLKIVVIGGSAAGPKAAARARRLDEHASITLIQKDPDLSMASCGYPYYIGGVFDDRNQLICTPAGIVRDPNFFE
    KAKRIEALVLTEAVAIDRAAKTVTCRHLPSGETRVIPYDRLVIATGATPLFPQVPGTDLAGIHTLHSLGDADQLRAIRDQ
    GQVRRAVVVGGGLIGFEVCEALHLAGIQITVIEKTDCILPFLDPDLARLVANHVRANGADIITGNGVAAFLGEHGRLTAV
    KLDNGTELPCELAVVAVGVRPNIALAQAAGLTIGEQGGIAVDEYMRTSDPDIYAAGDCVECTSLITGRKVRAPYGDIANL
    QGRVIGRNLIQPETATFPGITHTGICKIFDYTVGITGLSARQARALDFDIETATVAGLDIPGYMHGKLLISLMVAERGSG
    RVLGFQCIGPGDASKRVATVAMAIRGGLTVEDLGNADLPYAPPYSLALDHVIVSAHVLENKLRGLMHGVSAAEVKQRVDS
    GADCFIIDTRSPQEFEEMRLGIGETLIPQGALRGRLNELPEDKDREIILY
    CKISLRGYESAAILQAHGWRNVRVMEGGVM
    AWPYPREK

    >gi|288941257|ref|YP_003443497.1| thiol-disulfide isomerase and thioredoxins [Allochromatium vinosum DSM 180]
    MKTFKVLGGGCRNCEVTARAIEQAAKEAGVAIQLEKITDMAEILGHGVMSTPGVVLDGQVIHSGGVPAPDQIRAWMRD

    >gi|288941312|ref|YP_003443552.1| Rhodanese domain protein [Allochromatium vinosum DSM 180]
    MKNFLELIKHCLTEVHELMPWDLEERLQANPDLLVVDVREPDEFAAMHIEGSINVPRGILESACEWDYEETVPELVQARE
    REIVVV
    CRSGYRSVLAAHSMNVLGYTSVVSLKTGLRGWKDYEQPLVDAEGRPVDLDEADVYFTPRLRPEQRRPV

    >gi|288941534|ref|YP_003443774.1| heavy metal translocating P-type ATPase [Allochromatium vinosum DSM 180]
    MTQELRIGVNGLNCASCVARVERVIVNHPGVESAEVNLASGLALVRFEQTSVPELLEAVRAAGYAPVTESVTLGVGGLKC
    ASCVAGVERRLRAVPGVLEANVNLSTESAKVVYLPATVSRERLAQTIRAAGYEARLPDQPQESDETRQARELGRLKRDLL
    FAAALSLPLLLVSMGPMLLPGLHGLMERLAPMAVWHWLQLLLATPVVFWSGRRFFSRGVKELAQLSPGMDSLVMLGSGAA
    YGYSLLALTLPQLFPAGTAHLYFEAAAVIVTLILFGRYLEAIAKGRTSQAIRRLLHLQPPTARVLDAEGETEIPAEAVVP
    GDVLLVRPGERIPVDGTLIEGASHVDESMISGEPVPVRKEPGDAVIGGTLNQTGAFRYRATHVGADSVLARIVQLVQEAQ
    SGKPPIQRLADRIAAVFVPIVMGIAVLTFGVWLWLGPEPALNHAFAAAVSVLLIACPCAMGLATPTAILVASGRGAGLGL
    LFRQGAALETLARVDTVVLDKTGTLTAGQPTLTELTAFGLDENAALTLAASVEQHSEHPLGTAIVAAARARGLSLSEAGE
    VEARPGLGIGAQVDGRMVVVGARRWMEELGVDLEPAAAGEGPANSTATLMYVAVDGELVAVLGVSDPIKSGSREAIGRLA
    EQGLDVALLTGDGRPTAESVAHELGIGRVLAEVMPADKSAEIARLQAEGRRVAFVGDGINDAPALAQADVGLAIGTGTDI
    AIESGSVVLMRGDPRGVADAVELARRTLRTIRLNFVWAYGYNVALIPLAAGVFWPFTGWQLDPMFAAGAMSLSSLFVVTN
    SLRLRTALSG

    >gi|288941547|ref|YP_003443787.1| OsmC family protein [Allochromatium vinosum DSM 180]
    MARIRLEFPNANGQTLVGLLETPPERVPVVRYALFAHCFTCSKDVAATSRISRALAERGIAVLRFDFTGLGNSDGDFANT
    NFSSNVQDLLAAARKLEQDFEAPALLVGHSLGGAAVLAAAPQLPSVQAVATIAAPATAAHVKHLLTGARDQLAERGEAEV
    QIGYRRFKIRQQLLDDLDRYAAPDHIRQLGRPLLVFHSPLDTIVDISEAAKIYQSALHPKSFISLDKADHMLTNREDAEY
    VAETLVAWASRYLGIKRHGFETSTGTAPKVAANEVVVTEIDTDTPFLRGLYTQRHQWQADEPKPAGGSDLGPTPYELLLM
    ALGA
    CTSMTLRQYAKRHGLTVDDIEVTLSHARDHAEDCAVSAERPVKLDRIVQRIDIHGHLSALERERLLEVAERCPVHR
    TLDANPRIETRYIEDDPKR

    >gi|288941625|ref|YP_003443865.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Allochromatium vinosum DSM 180]
    MKALKVILVTALAGGISIGTAIIGQRWVEFENADSGRDTERFELQAESLQTLPDFRLTDLEGREVASNAWAGKVLVLNFW
    ATW
    CPPCLSEIPRFVEIQERLRESGVQFVGIAVDQVEDVRAFVAEQPVNYPLLIATPEVLKFSVQLGNRLEVLPFTVIFD
    RHGRRVHGQIGELSAEELAELLNPLLVREGPRVSRTP

    >gi|288941626|ref|YP_003443866.1| cytochrome c biogenesis protein transmembrane region [Allochromatium vinosum DSM 180]
    MKRPWFLAWAWLWLMVAVGGTQALADDFLTQEQAFPVSAEVAGPEAVRVIWDTADGYYLYRSKIRFDSETPGITLGNAVL
    PEAEIKQDEFFGEVETYHGRLMVDLPITRTPDSGSHLTLRVGSQGCADAGFCYPPHRETFTLQLPPILPVAAQASPEAKP
    SRLATLLSSTATSQGLAGTDEIPAVEHAFRFQSEVVAPDLVQLTWDIAPGTYLYADLVELALFESPEVALGAVERPAGTL
    KHDSVLPDGSIGDVRIYQGRLDLTVPLRRAATAPTDVTLVVKYQGCAEIGICYPPQTQRLALNLPEAPAAIADASVMAAL
    EKASPANGPSESAPPVSEQDRIAAVLAGEGLWVIIAVFFGFGLLLAFTPCVFPMIPILSGIIAGQGAGLTTRKAFVLSLV
    YVLAMALTYTVIGVLAGLFGANLQAVFQNPWILTAFALVFVGLALSMFGFYELQLPSGLQTKLAELSNRQEGGTLIGVAI
    MGLLSALIVGPCVAPPLFGALIYISQTGDALLGGLALFALSLGMGAPLIVIGTSAGRYLPRAGVWMDAVKAVFGVALLGV
    AILMLERILPPAVAMLLWALLLICSAVYMGALTQLQPGASGWTKLWKGLGLALLIYGSLMLVGAAAGGRDTLQPLRGLLP
    TGSVASSAEHVVFKRIKSVADLERELAQAQSNGQPVLLDFYADW
    CVSCKEMERYTFSDPTVIAEMSRFVRLQADVTANDD
    EDRALIQGRFGLPGPPAILFFDRTGQELANYRLVGFKPAEPFAAHLRQVAP

    >gi|288941634|ref|YP_003443874.1| glutaredoxin-like protein [Allochromatium vinosum DSM 180]
    MDVLERIGEQVRSNPVVIYMKGTPQFPQCGFSMRAAQALQQCEVPFAYVNVLQDPEIFEHLPRFADWPTFPQIYIDGELV
    GGCDITLELHASGELKTMMEQAVAKADDA

    >gi|288941673|ref|YP_003443913.1| peptide methionine sulfoxide reductase [Allochromatium vinosum DSM 180]
    MTIRKATLGGGCFWCLEAVFQSLAGVESVLSGYAGGSIANPTYQQICTGTTGHAEVVRIEFDDQVIDYETLLDVFFATHD
    PTTRDRQGADVGSQYRSAIFHHDDGQRAIAEAVVARLNGGRIWPAPIVTQIEPVPTFYPAEGYHQNYYRRYPTQGYCQAV
    IAPKLSKLRRSFRNLVADEERRSA

    >gi|288941747|ref|YP_003443987.1| Peroxiredoxin [Allochromatium vinosum DSM 180]
    MKPSVLLLGLAAMSATAGAETAPCSSLLDLDVRRLAGDEVVNLCDAYQGQVILVVNTASKCGFTSQYEGLEQLYRTYKDR
    GFVVLGFPSNDFANQEPGSEQEIQKFCRLTYAVEFPMFEKVSVKKGRAAPLFERLAAAGAPYPKWNFYKYLIDRNGNLVD
    HYISTTKPDSGKVIKAIERLL

    >gi|288941778|ref|YP_003444018.1| protein of unknown function DUF255 [Allochromatium vinosum DSM 180]
    MSPSIHAHDVQRTNRLASATSPYLQQHAHNPVDWWPWCAEALALARELDRPILLSIGYSACHWCHVMAHESFEDPATAER
    MNRLFVNIKVDREERPDLDKVYQTAHQLLSQRAGGWPLTVFLTPDDHTPFFAGTYFPREPRHGLPSFTQLLVGVERAYRE
    QGAAIREQNRSLLEALAGLEPQGGAELPEAGLLEAAFHQLALSFDAEHGGFGRAPKFPHATDLELLLRRQARLAANGGDP
    DPRPLHMAGFTLERMIRGGLTDQLGGGFCRYSVDDEWMIPHFEKMLYDNGPLLALCCDAFSATGESIFRDAALATADWVM
    REMQSPEGGYYSTLDADSEGHEGTFYVWDRDAVHARLSAAEYPLFAAVYGLDRPPNFEGRWHLHGYRTPTQAAESLGLNL
    PQAEALLASARATLFSAREQRVHPGRDEKILTAWNALMIKGMARAARVLDRPDYLESAEQALAFIRSTLWHDGRLLATCK
    DGVAHLNAYLDDYANLIDALLELLQVRWSSADLAFAVELAEVLLDEFHDAERGGFWFTGRSHEPLIHRAKPLGDDSMPAG
    NGVAALALQRLGHLIGEVRYLEAADGTLRLAAESMRRMPHAHASLLMALDDWLDPPEMLVIRAADDRLETWQRLAQQGYR
    PHRLVFAIPSGIDALPGTLASMRGGERPLIYRCRGTHCEPPVASLADL

    >gi|288941893|ref|YP_003444133.1| periplasmic protein thiol/disulphide oxidoreductase DsbE [Allochromatium vinosum DSM 180]
    MNTSAKRALIPLGIFLALAALLFYGLQLDPRKIPSPLVDKPAPEFSLPDLKDPNQTLTRDILIGQVSLVNVWASWCPSCR
    QEHAELMRIAREHGVRVIGFNWKDTRPEALAMLQRYGDPYTVSLYDPDNKAGIDWGVYGAPETFIVDAEGIIRHKRVGPI
    DAQVWAEEIQPIVARYQGGKP

    >gi|288941916|ref|YP_003444156.1| amine oxidase [Allochromatium vinosum DSM 180]
    MSTDFDHIVIGAGISGLGAAHFSARRGLSTLVLEASDRVGGCINSQVFPALGGFWTEAGGHTCFNSYGHMLSILDDLGLT
    SQVHPKVKVGYKLWKAGKRRSILSALHLFEGARSIPKLFKEPKDGRSVRDYYGAVLGRRNYRDLLQHAFQAVICQPADDY
    PAEALFRRKPRRKEVIKAFTFAEGIATIPNAIAAQNTLDVRTGQRIEQVESEGEGFRVRLQDGTAIRAAHLTLAVPPDVA
    AKLLPAGFEDARALVAGIGMAEIETLVLVLRQDDLELPPIAGLIAVEDAFYSAVSRDFLPDAQYRGFAFHFRPGVLDADA
    QVRRACESLSIAPERIAAQARVHNRLPALRKGHFALVERLDAALAGKRLALTGNWFLGVSMEDALTRSHSEHVRLFGDRA


    >gi|288941985|ref|YP_003444225.1| thioredoxin reductase [Allochromatium vinosum DSM 180]
    MSETKHCRLLILGSGPAGYTAAVYAARANLKPVLVTGLEQGGQLMTTTEVDNWAGDPDGVQGPELMERMRRHAERFETEI
    LFDHIHTTDLSSRPFRLIGDSATYTCDALIIATGASAQYLGLPSEQTFRGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIASEVTLVHRRDALRAEKILQQQLLEKAEKGNVRIAWNHVLDEILGDATGVTGMRIKHVQTGETQDIDLQGVF
    IAIGHTPNTAIFAGQLDMENGYIKVQSGTQGNATATSVPGVFAAGDVMDQVYRQAITSAGTGCMAALDAEKYLDALEAQS


    >gi|288942212|ref|YP_003444452.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Allochromatium vinosum DSM 180]
    MAKREFDTIVIGTGPGGEGAAMKLAKAGQRVAVVEAHQAVGGGCTHWGTIPSKALRHSIQMLADYRRNPLFQHTQHQIEA
    EFPDLLRAADGVIDAQVRTRYRYYRRNRVEVIFGRARFIDPNRLSVERPGGTRLELRAEHFVVATGSRPYRPPEVDFEHP
    RVRDSDTVLALSHTPRSITIYGAGVIGCEYASIFAALDVKVNLVNTRDRLLSYLDDEITDALSYHLRQQGVIIRHDETHA
    RIETSDSGVVLHCTSGKKFKTDILLWANGRTGNTQDMGLEEIGLTPNARGQLDVNASYQTALPHIYAVGDVAGPPALASA
    SYDQGRFVGAHIADGHCDWSLIEEFPTGIYTVPEISSVGRTERELTAAQIPYEVAQADFKSIARAQITGHTVGMLKLLFH
    RETLEILGIHCFGEQAAEIVHIGQAIMSQPGAANSLRYFTETTFNYPTMAEAYRVAALNGLNRLF

    >gi|288942275|ref|YP_003444515.1| Disulphide bond formation protein DsbB [Allochromatium vinosum DSM 180]
    MVLKRIERLWLLIGIAGIGIGLASVVLTEWLHLDPCHLCIFQRLLMLVAGVFALVAAGVAWRGANPLPFGGLAMLTTLGG
    VAVAAHHSWIQAYPSDTNS
    CVGSTPGPIESFIEWLGQQLPALFLATGFCDDDSFRLFGLTLANLSLLLFIVLTSAAFWAL
    LRARST

    >gi|288942276|ref|YP_003444516.1| DSBA oxidoreductase [Allochromatium vinosum DSM 180]
    MPLTRRHFNRLIFGSFALAALPPVAARAALVEGEDWRAITPPQPTDVPGKIEVLEFFSYGCPHCGSLNPLLKQWKSTLPE
    DVVLRRVPITFGRQAWANLACLFYALESLEALDRLDQAVFTALHEQRVKLYTEPAILEWLGDKEIDIQSFKDAFNSFDVQ
    TKVGRSDYLAERYQIDAVPTLAVAGRYAVLGHKAQGMPDLLAIADQLIDRARNEGAAG

    >gi|288942301|ref|YP_003444541.1| Rhodanese domain protein [Allochromatium vinosum DSM 180]
    MVNEIDSESLSQRLADTEDVLLVDIRTPAEIAQGMIPDALQLPMHLIPIRMSEIPKDRDVVIYCRSGARSYQACAYLMQQ
    GYGRVLNLRGGIIAWARHGLPIVAPEG

    >gi|288942368|ref|YP_003444608.1| iron-sulfur cluster assembly accessory protein [Allochromatium vinosum DSM 180]
    MTVTLTEAAARHVASQLERRGHGLGLRVATKKSGCSGFTYAVDYADELGADDRVFESHGVKVVVDETNLSRLDGLEIDFV
    KTNLLNQGFEFHNPNAKDHCGCGESFRV

    >gi|288942374|ref|YP_003444614.1| electron transport complex, RnfABCDGE type, A subunit [Allochromatium vinosum DSM 180]
    MGEYLLLILATALVNNVVLVKFLGLCPFMGVSGKLDSALGMGLATTFVLTLAAVAGWVLEHALLQPLGLGFLRILTFILV
    IAAVVQFTELAMRKISPALYQVLGIYLPLITTN
    CAVLGVALLNVQEEHGFLESALYGLGSALGFTLVMVVFAGMRERLAL
    AQVPAAFSGAPIAFIAAGLLSLAFMGFAGLA

    >gi|288942379|ref|YP_003444619.1| electron transport complex, RnfABCDGE type, E subunit [Allochromatium vinosum DSM 180]
    MSLEPNTANKTAWGRISRDGLWSNNVVLGQSLALCPLLAVTGTATNGLGMGLATTAVLIASGFLIALIRGWVTPEVRIPI
    FVLVIAVLVTLVDLGMNAWLHDLHKMLGLFIPLIVTN
    CAILGRAESFASRHPVLPAAFDGLMMGLGFTLVLVLLGAVREI
    IGSGTLFANASLLLGEGMAFLETTLIPDYRGFLLAILPPGGFIALGFILAGKRLIDTRLAEAQRRRESTAGTGALA

    >gi|288942501|ref|YP_003444741.1| Peroxiredoxin [Allochromatium vinosum DSM 180]
    MLQPGDRAPDFALPNADMEPVSLASLKGRRHGVIYFYPKDDTPGCTMEALEFTDLQAEFEAAGTEILGISRDTCASHGAF
    RDKYGLSIHLLSDSDGEVCEAYGVWREKEAHGEKRLGILRSTFVVDKSGVIRHALYEVKPKGHAAQVLDLVRAL

    >gi|288942720|ref|YP_003444960.1| Rhodanese domain protein [Allochromatium vinosum DSM 180]
    MSQLIEFIGNHWFLFLALIVILGLLTYNLIVGSKGSVGPLQATEMLNHREAVIIDVRPAADYARGHIINALNIPMNGFNN
    QLATLNKYKGRPIIVN
    CRSGAQSSVACAHLRKAGFEEVYNLQGGIMAWESANLPLTRKKR

    >gi|288942761|ref|YP_003445001.1| Thioredoxin domain protein [Allochromatium vinosum DSM 180]
    MSSAPDSYPSVFDVHYEDFQTQVIAASSEQPILVDFWADWCGPCHALAPHLKRIIDEHAGRLRLAKVEVDEGENMRLAGH
    YRVRGFPTVILFRHGEERGRFSGARSRIQINHWLQEHLPE

    >gi|288939933|ref|YP_003442173.1| OsmC family protein [Allochromatium vinosum DSM 180]
    MKARVKWIDGVAMLGESGSGHGVVMDGPPELGGRNVGVRPMEMLLLGLGGCTQFDVLLILRKGRQDVTDCVVELEAERAE
    QDPKVFTRIHVHFVITGRGLDPRRVEQAIRLSAEKYCSASIMLGATATVTHDFEIREAP

    >gi|288940990|ref|YP_003443230.1| DsrL [Allochromatium vinosum DSM 180]
    MATSSDEMKMKPTWRRFEDGEHVWDNLTDKIFNQDRSHKCPTYVHKTPPCQGSCPSGEDIRGWLQIVRGMEKPPQGMDWQ
    EYAFRRSTDANPFPAMMGRVCPAPCQDGCNRNELEDFVGINSVEQFIGDTAIANGYTFEAPELDTGKRIAIVGGGPAGLA
    AAYQLRRKGHSCTIFEANDGLGGMFRFGIPGYRVPRDKLDAEIQRILDMGRVEVRLKTRIGTDVTVEQLEKDYDAILWAI
    GCQSGRGLPVPGWEGTPN
    CVTGVAFLKAFNEGRMKVTAGKVVCVGGGDTSIDVVSVARRLGHVNKSNPNELPETVIRDGY
    VAHDAASAAAAQGAEVTLTSLFTRDKMTASEHEVDDATREGVTILDGVMPVEVIKDANGRAIGLKVADCTMTDGRPTPVE
    GTERVLEADLIVSAIGQGGDLSGLEQLDNGRGLMDSDKFYQVPGKAGHFVAGDIIRPHLLTTAIGQAWIAADSIDAYVMQ
    AEHKRRPKVDVHHFNLLDKLTEAHLAPESFVAGQAGDMRGTSDANYAIHNYEDRSGAEVIPHEELFLGHFNYVPRNLRKE
    EVPSADEVLGHFHERVIGLTEPEAIDEAKRCMSCGLCFECDNCVIFCPQDAVFRVDKGSRTTGRYVDTDYAKCIGCHICA
    DVCPTGYIKMGLGE