Geobacter sulfurreducens PCA uid57743

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|39995177|ref|NP_951128.1| AhpC/Tsa family protein, selenocysteine-containing [Geobacter sulfurreducens PCA]
    MAIDEQKPVYELQKELDALREDYLAGMSPEHAATLQRTATELVLSGIVGHAATIGDRAQDFTLPNAVGRQIRLSEVTAQS
    TAVVTFYRGAW
    CPYCSLQLRAYQAVLPRLRELGGELLAISPQTPDKSQATLLKNFLQYEVLSDVGNLVARSFGLVYPLGE
    EMRRIYLGFGVNLADYNGDESWELPLPGTFVIDGTMTIRYSFVDADYTRRLEPATILDVLERIREERGRDDNQAS

    >gi|39995201|ref|NP_951152.1| heterodisulfide reductase subunit [Geobacter sulfurreducens PCA]
    MSRIGVFVCHCGENISRTVDVERVAGELAKVPGVAFATDYKYMCSDPGQGLLKKAVAEHRLDGVVVAACSPRMHEKTFRT
    AAKAAGLNPFLCEMANIREHCSWVHEDRDEATAKAISIVEMMVARVKKDRRLVPITVPVTKRALVIGGGIAGIQAALDIA
    DAGHKVVLVEREPSIGGHMAQLSETFPTLDCSQ
    CIMTPKMVDVANHPNITLHTYSEIESVDGYIGNFQVTIRKKARSVDE
    SKCTGCGVCMAKCPQKKIPNSFDKNLGMRPAIYVPFPQAVPNTPVIDRENCTYFKSGKCGVCAKVCGPRAVDYEQQDQLI
    VEPAGAIVVATGFSLYDIGPKPAGSPIEGYGEFGYGTIPDVIDGLTFERLASASGPTGGKIVRPSDGKEPKQVVFVQCVG
    SRAREKGISYCSKICCMYTAKHTMLYKHKVHDGQAYVFFMDARTPGKNYDEFWRRAIEEEEAVYIRGMVSRLYQKGDKVV
    VMGSDVHVGVQVEIEADLVVLATAVQAREGADSLAQKLGISYDNYNFYSEAHAKLKPVECATAGVYLAGACQGPKDIPDT
    VSQASAAAAKVMTLFARDELEREPIVAKVDERRCVACLYCKKICPYGAVEEKEIRDRQGNLIRVVAYVNPGVCGGCGTCQ
    ATCPSKSVELDGYTDEQIMAMIEVL

    >gi|39995461|ref|NP_951412.1| thiol peroxidase [Geobacter sulfurreducens PCA]
    MEERTGIITFKGNPMTLLGPQLKVGDQAPAFTAVDTSLTVRSLSDFGAAIKIISAVPSLDTPVCDAETRRFNQEAASLPA
    NVVLLTISLDLPFAQKRWCGAAGIDRVVTLSDYRDRSFGLAYGVLIKELMLLSRSVFVVDGNGVIRYLQHVPEVTSEPDY
    AAVLDSVRAML

    >gi|39995490|ref|NP_951441.1| hypothetical protein GSU0382 [Geobacter sulfurreducens PCA]
    MELIVTFPGGKKVNAELGGMVIPTDQPVESGGEGTAPSPYDYFLASIGTCAGFYVLAFCQQRGIATENISLRQAMEFTPT
    ADGRKKLSRVQMEIVVPSDFPEKYRNALVKSAELCSVKRALADPPDFAIRTVVA

    >gi|39995506|ref|NP_951457.1| phage prohead protease [Geobacter sulfurreducens PCA]
    MFMVTSLAATALAAPYRNIGSAEAKALLDKKRNVFLLDVRTPDEYRQARLAGSVLIPINEVERRIAQIPKGRPVLVYCAV
    GSRSGLVAGYLTQRGYGEVYNMHDGIVGWYRNGFPITR

    >gi|39995596|ref|NP_951547.1| thioredoxin reductase [Geobacter sulfurreducens PCA]
    MQATHHRLLILGSGPAGYTAAVYAARANLSPALITGLQQGGQLMTTTEVDNWPGDPDGVLGPDLMDRMRRHAERFNTAMI
    YDHIHTANLRERPFRLEGDSGIYTCDALIIATGASARYLGLPSEEAFKGKGVSA
    CATCDGFFYRGKPVAVIGGGNTAVEE
    ALYLSNIASHVTLVHRRDKLRAEKILADKLIEKTRGGNVTIEWNHVLDEVLGDQAGVTGVRIRHTSGSTKELDVHGCFIA
    IGHTPNTHLFEGQLEMDEGYIRTQCGAEGNFTATSIPGVFAAGDVQDQHYRQAITSAGTGCMAALDAERYLDMLKP

    >gi|39995612|ref|NP_951563.1| rhodanese-like domain-containing protein [Geobacter sulfurreducens PCA]
    MKSDPKRLAAEMAIIVVVAAIIGITWNYRLLADVFQGRAVGAGTSDPPPAATVASAPIPLPLGLMQVKELFDRNEALIID
    ARDRDSYGAGHIRGAVLLPLGEADQLIPPLAANTPKDRFLIVY
    CNGYDCHDSRALGEKLIRAGFGQVFVFEGGFPEWRDA
    GYPVARGGA

    >gi|308513282|ref|NP_951624.3| glutaredoxin family protein [Geobacter sulfurreducens PCA]
    MKQRFTGTVELYVTDWCGYCKRAERYLQSKGVSYVAYDIEKDSAAMQRHKDLGGRGVPLIVVGSHKISGFSPETIDYYLE
    NGR

    >gi|39995714|ref|NP_951665.1| selenide, water dikinase, selenocysteine-containing [Geobacter sulfurreducens PCA]
    MTEGIKLTSLVKAAGCAAKLGPAGLEQALSDMVREDDPNLLVGPETADDAGVYRIGEGLALVETVDIITPLVDDPYTFGR
    IAAANALSDVFAMGGRPVTAMNLVFFPACALPGSVLSAILAGGHDALREAGACLVGGHTVEDDELKYGLAVTGLISPSRV
    VRNATARAGDRLVLTKPLGTGIVSTAIKADMAPAALTAEAVRWMTMLNAEAAGLMLECGASACTDVTGFGLVGHACEVAR
    GAGVTLRLHLEQVPVLDGVMGLVADGLVPAGCYRNRDHYAPFVGAPRSDDDRLLPLFDPQTSGGLLLSLSPSSAGRFLAA
    AGDRGLFALEVGEVLPAGECAVDIV

    >gi|39995760|ref|NP_951711.1| thiF family protein [Geobacter sulfurreducens PCA]
    MLTSDQQERYARHLILEGVGPEGQEKLLNGKVLVIGAGGLGSPAAFYLAAAGVGTIGIADSDRIELSNLQRQIIHSTAGI
    GRLKVESAREAMCELNPDVQVRTYPVRVDDAILPTILADYDFVIDATDNFASKFLINDACVRAGKSFSHGGILRYAGQTM
    TVHPHRSACYRCLFEEEPSSEIATS
    CSRAGVMGVLPGVIGSLQATEALKHVMGVGELLTGRMLTYDSLALRFREVAVGRR
    RGCGACGQ

    >gi|39995900|ref|NP_951851.1| pyridine nucleotide-disulfide oxidoreductase/rhodanese domain protein [Geobacter sulfurreducens PCA]
    MSIVVIGANAAGAKAASKAKRINPTAEITLIDRGTFISYGACGIPYFVSDTVEDVKELMSTPVGVVRDHQFFRKVKGVTV
    KTATEVIAIDRAAKTVCMRDCQTSRETKLPYDRLVLATGSTPFIPQISNVNLANVLTVKSIEDAELLKSLAVPGTRACIV
    GGGLIGLETAEALRHKGLQVAVVEMRDQMLPGVLDWEMAALVEKQLRQQGVTVMTGSAVTGLVGDAAVEAVQIGDVRIPA
    DLVVLAPGVAPNVELARGAGLEIGPTGAIAVDTRQCTTDPDIYACGDCCETTHLITGKKVFIPLGSTANKQGRVAGINAA
    GGEATFAGVIGTSILRVFAVNAGKTGLTEAEAKAHGFEVETVLSPSHDKAHFFPGAKPIILKLVAERGTGRILGLQAVGE
    GAVDKRLDAAATAITFGATAEQVAQLDLAYAPPYSAAMDNLIVAADILKNKLAGHARGITPREVKRKFDEGDDFILLDVR
    SPAEHNAVGIEGAKLIPLGMLREKLEELPRDKEIIAF
    CKISLRGYEAQKILDAAGFRNAKFMDGGILAWPFALRTSDK

    >gi|39995901|ref|NP_951852.1| rhodanese-like domain-containing protein [Geobacter sulfurreducens PCA]
    MRSNELLKRRKANNPPTVIDVRTGFEFKAGHVPGAVHAPAWKILLMLARLPADKSAELVVTCEHGPRAQMAKGLLGLYGY
    RNVELLDGHMSAWRQAGHPLEK

    >gi|39995949|ref|NP_951900.1| NADH oxidase [Geobacter sulfurreducens PCA]
    MKTVIIGGVAGGLSAASQIKRADRDAEVIVLEKSGDPSYAACGMPYNLFFKDTPVEALYALSLDTIRNGRGIDYRLRHEA
    VAIDPRRQEVTVVDHEQNREYRERYDFLVYATGNRPAPLPLPGFDDPAVCYFKTLDDTRRVKRLIHDQAPACAILVGAGY
    TNLEVADVLYNMKIRPVIVEKAPAILPAFAAEIRDKVMEKIAEKGIEFHAGVDVQGKEGATVRTTAGDFDAGLVVVAIGV
    KPNTGLFAAAGGELGAAGAVKVDQFLQTNLPGVFAAGDCAEHYVRQLGRNSYMPLGPVANKQGRLAGNNIAHRDAMTMFH
    GIDQTAAFKFFDLTIATTGLNERQLREMGTDFGKIHVDTPTRGSFPGGGTMRTVLLFEKGTGLLLGGQMVGQDVVAKRLD
    VLAVAVYKQMTVFELAELDLSYAPPYAPVWDPLLIAANQAVKAV

    >gi|39995956|ref|NP_951907.1| hypothetical protein GSU0850 [Geobacter sulfurreducens PCA]
    MTKRLINSCLVGALVAVLAAGSALASPKEGAKEESPEATIKALFPTLPLTSVKKTPIDGLFEVITDGNVIYIYPKTGNVI
    IGNLFTKEGKNLTAEASNRLVADRYKLITAADKEKAVKVGNGKYEVIEITDPD
    CPYCRKMHEYWGRRPDVTRYVFFLPLA
    MHPDAEKKIRYILSAENKELAFWEVYSGELDNKREILDAPRDDKGLLAAHKAIVAKLGVNSTPTFWVQGTYVNGANTQLI
    EKVIGTCKTAEGMAPGAPVKCEDEGQKK

    >gi|308513291|ref|NP_951949.3| thioredoxin peroxidase [Geobacter sulfurreducens PCA]
    MVQSEPERAMVGEPAPAFSLEAVVNKEFKRVNLADYRGKWVVLFFYPGDFTFVCPTEIRGFNAAVDRFTELNAVVLGASV
    DSKFSHLAWINRGDLGDLKFPLLADNKKEATIRYGILDEKEGVALRGLFIIDPNGVLQYQVVQTPSVGRSVEETIRVLEA
    LQTGELCPLGWKPGEKTIKK

    >gi|39996033|ref|NP_951984.1| sulfur transferase, selenocysteine-containing [Geobacter sulfurreducens PCA]
    MKTKGWGALAVLPLALALAGNVAAEEVKGKVKTVSVKAGQISLTVESKGVMLFRVTDGTTFANAASIREIHADDLLQVDY
    RVDGFDNVAKAVAKVVAKLPEGVTAMDTRELEALVAKGTEEGGYLLIDSRPAGKYNEAHIPTAVSIPFAELEKNPALLTA
    SKDRLLVFYCGGVT
    CVLSPKSAGLAKKSGYEKVRVYLDGEPEWKKAELPLESSLAFVEKGNIVLIDLRSPEKVAAGHIPG
    AVGIPAADLAAAQAKFPAYRGAHLVFYSDSAEDLSQALELARDWNYKNATIFPGGIGAWQKAGKHLKTGAAAATVTYVKK
    LAPGEVGTEDFQAALKDGRTVVIDARAPGEFEKGHFKGAVNIPAEEAAKRLAEIPADRPVLVH
    CSTGTRAEMVYDLVKDK
    GYNLKYLKAGVEFAADGSYTISE

    >gi|39996157|ref|NP_952108.1| hypothetical protein GSU1055 [Geobacter sulfurreducens PCA]
    MTGDPASLVAAGLLLGMVAGFVMHRSDFCMAGAFRDLFLFGSATMLRPVLLMSAAAMVLFEVARVCGLVPLYPFPLFGVP
    SASNLAGGAIFGVGMVLAGG
    CVVGTLYRVGAGNVAAMVTLAGLVAGSALYAEIHPVWKRLADATAMPAMGVTVPAFLGIE
    PYWLTTPLAIVAALIVFHWQRRGMLTRQAQVEGYLQPWWTALALAGVSLLSVMATTMPLGVTTSYTKAGGWLLDRVIPGH
    IAERNYFLALPLNLAATTPLGEVPLIGGPAPVTDAIALVQVPVIAGIIAGSALSALLLGELGFRYRIPARQYLAALTGGI
    LMGLAARMAPS
    CNIWHLAGGLPILAWQSIIFTAGLLAGAWLGSRIIIRLLA

    >gi|39996257|ref|NP_952208.1| glutaredoxin family protein [Geobacter sulfurreducens PCA]
    MRKIFTAACVLAIAALAVPVLAADVSPTQSKIDASAKKQTYPKVVLYSVAWCPHCKEAKEYFTTKNIPFINKDVELDATA
    MEELTKKYKSQGVPVIIIGNDKVLKGFSPEAFEKAVKEVQSKK

    >gi|308513297|ref|NP_952224.2| hypothetical protein GSU1171 [Geobacter sulfurreducens PCA]
    MGNEARHHDEQRIERIFSADRRTLPPDGGPHFNRLIFATSPYLLQHADNPVEWYPWGEDAFARARAEDRPVFLSIGYATC
    HWCHVMAAESFDDDEVAAVLNREYVPVKVDREERPDIDDTFMRVAQMMNGSGGWPLTIIMTPDRQPFFAATYIPRRSRGG
    MPGLIDLLEKIAEVWRQRRDVVRQNCSAIMDALSRFNSVRPAAAEDEAPLHGARQQLADIYDKEFGGFGGAPKFPMAMNL
    SFLLRYGQRYGDGEAVAMATDTLTAMAQGGIWDHLGGGFHRYTVDGRWLVPHFEKMLYDQALCTLALVEAAQVTGNSVFR
    ELAKETCGFVLRELSAPAGGFYSALDADSEGREGACYLWTPAQVRDILGVADGELFCRLYAVTAWGNFEGANVLHLPLAP
    DAFARDEGVDPLRLQEKIAQWHILLLEARERRPRPFRDEKIITGWNGLMIAALARTFLICGDELLLEGAERAVRRVCIDL
    RTPAGRLVRSCHRGEASGPGFLEDYAFFIRGLLELHEATLDPRHLALARSLAHDMLRLFGDSGGGLFDTGSDAETILVRG
    KGALDGAIPSGNAMAASVLIRLGRITGDGVFEEAGRGIIRAFLAGAARQPAAHIHLLCALGELLADPFEVVIAAATRPHA
    VRELLCILGGRLIPGLVLMEREENAPAREGGGGGSIARVCAGRVCLPPVTAPEGLEEILARHIIRPVRPG

    >gi|39996275|ref|NP_952226.1| methylated-DNA--protein-cysteine methyltransferase [Geobacter sulfurreducens PCA]
    MLDDGNSGARRGVCVLFRDGGGGRCRGGGQRGTQGGVPPFRVATREDMVATVRSRYPRQAGENSLSREAARQLVAYFAGE
    AVEFTVPLDEEHVTPFRKKVYEIVRGIGRGQVMTYGQVAVAAGSPGAARGVGSAMAANPLPIIVP
    CHRVVGVGGALTGYS
    GAGGIDSKRWLLELEASTGAGE

    >gi|39996292|ref|NP_952243.1| tRNA 2-selenouridine synthase [Geobacter sulfurreducens PCA]
    MIKTTPFHESLLDTHLVVDVRTPLEYEEDHLPGAINVPLLTNEERVEIGTIYKQTGPLEARRRGLHLTAHRFPAMVGEIA
    RAAAGRPILVY
    CWRGGLRSKTVVSILDLAGFDAVQLQGGHKAFRHLVLSSFDPFTPPAPLVVLHGMTGVGKTTFLLQLAR
    AGHAVVDLEGLARHRGSAFGELGLRQDISQKRFETLLWDAFRRLPAGCPILLEGESRRIGRLTLPGNLYDVMRGSVKLWC
    EASVATRVARLTEEYGRPEYRDGMAGALERIRKKLGGDNYEAIKGHLDRWEMEPFMEGLIRHYYDKLYYKTRDWVEDAVI
    SLEDFSSGERELNTFLASRRQAAV

    >gi|39996309|ref|NP_952260.1| HesB/YadR/YfhF family protein, selenocysteine-containing [Geobacter sulfurreducens PCA]
    MTITDAAKAVLAPIVGEHPGKILRVVFEGFGCGGPRLGLVLDEPADNDARMVLNGIEVAVTSNFRSLLDDQILDYITNEQ
    GEGLVFRRESGDVCC

    >gi|39996414|ref|NP_952365.1| radical SAM domain-containing protein [Geobacter sulfurreducens PCA]
    MTESLAQSSPCIEAFSRALERCGLELRRDRTTTLQVNVGFLCDLACRHCHLEAGPSRTEIMTPETMEEVIAYASRCRFQA
    IDITGGAPELVPGIERLVTGLAPLTPRLIIRTNLSAFLNPGVAHLPELLRSAGAAIVASFPSANVGQAEAQRGHGIMERS
    ITALKLLNDLGYGRDGSGLELDLVANPTGAFLPPSQCEAEQKLRRDLERKYGVVFSHLYTFANVPLGRFRRWLEDSGNLE
    GYLQRLAGNFNPATVPGLMCRALVSVAWDGHLYDCDFNLAAGRGLGGERRHVADMACLPPEGTLIPTDDYCYACTAGSGF
    T
    CGGAIGAPEGPGTP

    >gi|39996415|ref|NP_952366.1| carboxymuconolactone decarboxylase [Geobacter sulfurreducens PCA]
    MDSYYVPDDLAKFGDIGKDAPDLAKKFFDYYGAVFAEGELTEREKTLIALAVAHAVQCPYCIDAYTRACLEKGSNLGEMT
    EAVHVANAIRGGAALVHGVQMRKIAEKLSL

    >gi|39996417|ref|NP_952368.1| mercuric reductase [Geobacter sulfurreducens PCA]
    MSDNFASPHDRDLDERVRPPGWINPSPAPRYDLVVVGAGTAGLVCAAGAAGLGARVALVERHRLGGDCLNYGCVPSKALI
    RAARAAHDAGNGAPFGVTGCHGTGVDGAAVMERMRRLRAEIGRHDAAVRFRDLGVHVFFGQGSFISRNALEVDGRRLNFV
    HAAVCTGARAAAPPVPGLAEAGYLTNETIFSLATLPARLAVIGGGPIGCELAQAAARLGSSVTVIEAAPEILPREDTDAA
    ALVRHALERDRVSFLTAAAVVGVERRSGARTLIVRQGDQSHEVTADEILVGAGRTPNIEGLGLERAGIVADPLRGVRVND
    RLRTDNPRVYAAGDICSPYRFTHAADAMARIVVANALFGARQRFSTQIIPWCTYTDPEVAHVGLYEREAGERGLAVDTLT
    VPLTEVDRALLDGEDEGFARVHLKRGTDRIVGATIVARHAGEMLNELTLAMSAGLGLSAIGRSIHPYPTQAEAIKKLADA
    WNRTRLTPGVKRLMGIMLTLRRLWR

    >gi|39996423|ref|NP_952374.1| thioredoxin family protein [Geobacter sulfurreducens PCA]
    MRKFVRLLPLLILLALLGCSKEQKPAVQGNPAPDFTLNTLKGEVVKLSDLKGQVVLVNFWATWCPPCREEIPSMMRLEAA
    MAGKPFKMLCISIDDGGPVAVEDFFRKTGFNLPTLMDTDKQASKLYGVTGVPETFVVDKNGVILKKVVGGVQWDHPDVIA
    YLNGALAK

    >gi|39996452|ref|NP_952403.1| thiF family protein [Geobacter sulfurreducens PCA]
    MFTDQQIERYSRHIILKEVGGKGQKKLLDGKVMVIGAGGLGAPIALYLAAAGVGTIGIADADVVDLSNLQRQVIHFTPDV
    GKPKVESAREKMEAINPDVRVRTYQEWISAANIARIIADYDFVIDGTDNFAAKFLVNDACVLAGTPYSHGGILQFDGQTL
    TVKPGESPCYRCIFPAPPPKDAIPT
    CARAGVIGVLPGVLGTIQATEAIKYLLGQGDLLTGRLLTYNALRMRFREVPVKKS
    ARCPVCGDNPTITELVDELDIETS

    >gi|39997193|ref|NP_953144.1| NADH oxidase [Geobacter sulfurreducens PCA]
    MKVVTVGTGMAAAEFVERLRLDGFAGEIVMCGDEEFAPYSPCVIPFYLAGEPLETVYWKGSDFYGRYRVTPRLADPVVEV
    DAERRLVRTASGRSEQYDRLFYAAGARSWYPRPDWLDTRGVFGFKTLSDMVAIDRYIREHNVGEAVVFGGGFIGVDAALA
    LWHRGLAITLVHRNTRVLSQMTDEEGGQFATAKLVEKTGMDIRLRTTVADIVTTGGELSAVRFSDGTARETKLLIVAIGV
    SPNSEPLRGDDKGVPSDRQMLAEAGIYAAGDVAVTPHAVTGEAGVYATYPNAMRQARTAARHLLNGDGSYAGSVNTNVLK
    KHIDFPIVSAGSFTGEPVTWQRGDVWRRVYLKDGMINGYIIIGDTKMSGYVYQLYVSRQRVDGTIRTILSSPRHDAYYRQ
    VTGCGAGRASGRGYGMQGVMAG

    >gi|39997245|ref|NP_953196.1| cadmium-translocating P-type ATPase [Geobacter sulfurreducens PCA]
    MATDTPTSISGQGKAYFHVKGITCLDCAQKFEKAVNALPRVVSATLNTMSGRLTVEGSVDLEEIRRLGEEENYVISPESR
    QDVSADEHIGKPDWEMRRALISGIALAIAYGLERFGGPAIVFIPVYLTAMVLGGWGNFRKAARSLPRGNFNMSVMMSGAI
    IGAIAIGKYEEGASVAFLYAISEMLEAWTMDRARRSIRQLMDIAPKVALVRRDSRETVIPVEEIVIGDVMIIRPAERIAM
    DGIIVRGESAINQAAITGESMPVEKGVGAEVFAGTLNTHGSLEVKVTKLVQDTTIARIIHMVEEAQTRRAPSQAFVDRFA
    AIYTPVVLALAVGIVIVPPLFLGHAWVPWIYRGLALLVVACPCALVVSTPVAIVSAISNAARHGVLIKGGIYLEEAGTLS
    AIAFDKTGTLTKGKPVVTDIVPLGETAEGELLQMAANLEARSEHPLAASIVKAAKDRGCTITPVVDFTAVAGQGAQGTIS
    GKMVYIGSPRLFSEKNISIDEIVPQAERLESEGKTVMILGSAERIVGIIAVADEVRSASAGAISSLKRAGIRHAVMLTGD
    NTATAKNIAAQVGVDEFRAELLPQDKLTAIDGLLKEYGKVAMVGDGINDAPALALSTVGIAMGSAGTDTALETADIALMS
    DDLAKLPFTILLSRKALAIIRQNITFSLCIKAVAILAVFPGWLTLWLAILADMGASLLVTLNSLRLLRVNDIH

    >gi|39997407|ref|NP_953358.1| metallo-beta-lactamase family protein [Geobacter sulfurreducens PCA]
    MFIQQFFVSGLAHSSYLLGGTSTCAIVDPRRDIEIYLDAAASMGMKITHILQTHLHADFVSGHLDLAEATGAVIVAPRSA
    DCQFSHLDVAEGDSFRIDDLEIRVLETPGHTPEHITYVVVDHGRGPEPAVIFCGDTLFVGDVGRPDLFPGMALELAAKLY
    GSLHEKLMALPPFCEVYPAHGAGSLCGRAMGAKRTSTVGYEKLYNGALAIGDRQRFITSLTTDMPAAPDHFSRCSDINRR
    GPALVRTLPVPAPLPPQRFREAMAESDTVVLDVRGYAAFGGQHVPGSYHIDLGGNFATFAGWVLPPDRKILLVAEQAHEA
    SEAAVALHRVGLDQVIGYLEGGMFEWAKAGFGTDHVPQLSAPELNQRISCGDGLVLVDVRSVGEFGAAHVEGAIHIPAPQ
    LRTRHTELDPDRDIALV
    CSTGHRSSLAASILKRNGFSRVWNVAGGMTGFNAAGFAPECPLCVVPHGPRFMGR

    >gi|39997408|ref|NP_953359.1| YeeE/YedE family protein [Geobacter sulfurreducens PCA]
    MISFLTMTEWSPYAVGIGIGLLSCFAFVLSDKPIGCSTAFARTSGMLEQLVRGQKVREMPYYRQFVPEIDWEWMLVAGIV
    LGAFTSSWLSGEFRLQWVPSLWAATFGPEHLPRLVTAFAGGIIMGFGARWAGG
    CTSGHGISGTLQLAVSGWLAVAAFFAS
    GAATAFVKYALGG

    >gi|39997541|ref|NP_953492.1| 2-oxoglutarate dehydrogenase complex, E3 component, lipoamide dehydrogenase [Geobacter sulfurreducens PCA]
    MAEQTFDLIVIGAGPGGYVAAIRAAQLGMTVAVAEQRETLGGVCLNEGCIPSKALLDSSEFFAQARDGFAGHGILIDPPR
    LDLARMMARKDDVVKKLTDGIAYLFKKNRITWLKGTARLAGRNGDLLRVEVGGNGTAPAHLLEAGKVLLATGSEAVPVPG
    LAFDGETVVSAREALAFDRVPEHLLVVGAGYIGLELGSVWRRLGSQVTVVEVLAKPLPATDGQVADALVRSLKKQGISFR
    METRVTGIEKREGTAVVTVESSAGGRDAIACDRVLVAAGRRPVMAGLGLEPFNLAMEGGRIRVDDNYLTSAPGIYAIGDL
    IHGPMLAHKAMAEGEVFAERLTGEASVVDYEYIPGIVYTWPEAAGVGLTEEQLKEQGIPYAAGRFNFMANGRARCMGETE
    GFVKILAKPDTGRVLGIHVVGPRASDLIAEAVTVMTYGGSAADIAMTFHAHPTLAEAMKEAALDVEKRAIHA

    >gi|39997546|ref|NP_953497.1| PilB-related protein [Geobacter sulfurreducens PCA]
    MKRKIEKTDAQWRGQLTPEQYEITRRKGTEPAFTGAYWDCHDRGTYRCVCCGAPLFDSADKFDSGTGWPSFTAPLDGDGV
    ESEEDRSFFMHRTEVHCASCGAHLGHLFPDGPAPTGRRY
    CINSASLVLDRAGEGEKE

    >gi|39997547|ref|NP_953498.1| copper-translocating P-type ATPase [Geobacter sulfurreducens PCA]
    MRKVLFPITGMSCAGCAARIEKELGGVAGIASAVVNFATAELSVEFDERVIDEDAVVARVEALGYGVVRTAAGELRFGVR
    GLH
    CASCVANLEKKLLADPAVSAAVVNLAQEEALVRFDPSRLGKADIFALVVAAGYTPVEPEAEGGEAAAELKGQRNWFI
    ASLLLSLPIMATMTLHDNRAVGWMNLVLASAVQFSAGLTFYRGSWFALKNRSANMDVLVALGTSAAYFYSLFAFFGAFGE
    HGGHVFFETSAMLIAFIRLGKYLEARARGKAGEALKKLLRLQADKARLVTGDQEREVPASAVRVGDLVRVRPGETIPVDG
    EVVEGTSSVDESMVTGESIPADKGPGAAVTGATVNRSGVLLVRATRIGEETLLSQIVRMVREAQADKAPIQRFADRVSGV
    FVPVVIALSALTFALWFWGLHQEFLFAFKLAISVVVIACPCAMGLATPTAIMVGSGVGLSRGILVKRGSVLENISRVQAI
    LLDKTGTLTRGEPSLTDLVPAPGVTEERLLAVLAAAESRSNHPLAQAAVSGAAGRGVVPAPVDGYRETEGGGVACVLDGE
    PVTAGSARFLVGAGIDTSPLEQAASRLAGEGKSLILVAEAGRLLGVAALADRLKESSPRAVAELKRMGIATCMITGDHRE
    VAAAVAREAGVDSFEAEVLPGRKEEIVREYQAKGYFTAMVGDGINDAPALARADVGIAIGGGTDVAKETGDVILVRDDLM
    DAVRAIRLGRATLAKVKQNLFWALFYNILGIPVAAGVLYYPLGITLRPEFAGLAMAFSSVSVVTNSILLRRAGKKLG

    >gi|39997611|ref|NP_953562.1| rhodanese-like domain-containing protein [Geobacter sulfurreducens PCA]
    MKQIVQRALACAVLALGILAGGAGWAAGDYPVVTTDHLKAMIDEKRDFLLIDARTPEEYAEAHIVGAVNVPEKTFDSASA
    QLPADKAKLIVLY
    CNGIKCGKSKRVAKKVEPLGYTAIAVYNEGMPVWEERGLPIVKGAGYGRKIETTIVPAAELDRMIRS
    GSQDYVLIDVRDDMEFEEGHIPTAINIPAEQLAARSDQLPKEKKIIVY
    CNTGSRSYMAYKKLIGLAYPSIFQSLFVEWKE
    AGLPVAR

    >gi|39997612|ref|NP_953563.1| rhodanese-like domain/cysteine-rich domain-containing protein [Geobacter sulfurreducens PCA]
    MSHSPWSAGDVATRCTACGICVAECAFLREHGTPKALAASFDPRRLDQSHLPFGCSLCGLCRAVCPEGVDPAALFLAMRR
    ATADAGTLQLSPYRGLLSYERAGTSRLFTWYGLPDGCRTIFFPGCALPGTRPRTTLKLFDLLRGSEPSLGMVLDCCTKPS
    HDLGRSGHFTAMFGEMKAYLLAQGVKTVQVACPNCHEVFSRYAPELEVVTVYEVLARAGISFKQTEGAVTVHDPCVSRDN
    AGVHAAVRTLLGAAGLRVREMPHHGVRTLCCGEGGAVRCTAPRLAGAWTSLRAAEAGGSTTITYCAGCASYLGPHTPTSH
    VADLLFEPEAALAGRVKVASGPRTYLNRLLLKRRLRRSLPVASSRERTFRSAADGVGSAVGGRRAAVLILLMLAAAVLVV
    MLAVSGASARDFGLMEPQTLARAPGTWVVLDGRPRSDWQAGHIPGARSFSWENYTRTDDKGVPYKLWPPRDLARALGSMG
    IDERTPVVVYGDADKSWGGEGWAAWVLAWLGHKGPVRMLNGGIQAWTAAGLPLTRGHERYSGGTLTYRSAVRPEEDITTA
    ELERSLGAVTIIDTRSFFERLAGRIPGSVHIPWNKFFTGKERRPLAPAEVRRLLARNGVDADRPVVYY
    CAGGIRSAYALM
    VHELAGLGPARNYEGGMEEWKRLHR

    >gi|39997683|ref|NP_953634.1| alpha keto acid dehydrogenase complex, E3 component, lipoamide dehydrogenase [Geobacter sulfurreducens PCA]
    MQTFDVVVIGGGPGGMTAGMMLKQAGKSVAIIQENHDSFGGVCLNRGCMPTKSMLKAAKVYRDAQNSEKYGLDLSVNPVD
    LTRLRAVADADLNMLRHMVQGKLTDARIAVFRGKGSFLSEHELQICQADGSSEQIRGEKIIIATGSVPAELP
    CAPFDGHS
    ILSSDQILKNTDLPHKLLIIGGGAIGCEFATLYNTFGSRVTLVEAMDSLLPREDKEAGKTLQSTFEQQGITVKTGAAIKS
    ISVEAGTVHVHYDGSCATEEFDKVLVGIGRTANIAGLNLDAAGVATEQGAVKVNEMMQTTVPHIYALGDVIGGMTLAHAA
    EKEGYLLAQNLIQGTRHPLDHRAVPRVVFCHPEVAAVGTHEARAGIKAFTMPQAPNGRAVVDKVAPAFVKLFIEEDTSQI
    AGAIIIGEGATEMIHEMAVAVENRLTLEQIGKTVHAHPTHSKNVLLAVQHFN

    >gi|39997807|ref|NP_953758.1| hypothetical protein GSU2713 [Geobacter sulfurreducens PCA]
    MRQRLAPLLTIMLLLQCVTAAFAAPTLSVDKPFFDFGTIPQGKKLDHVFTLKNKGDSPLSIVRTKSSCGCTVISLPRKTI
    EPGGSVELKTTFDSTTFGGKVTKTITVETNDPANPNYTLTLTGVVSEVLVVAPRQLNLGQIKAGTSGTFTVTVDNKGNRP
    VKITSATSPMPQVKVTAGKQSIKPGESTSITISVAPRPEDRFLSGFIIIKTDMPGKPEITVPVYGSVSK

    >gi|39997881|ref|NP_953832.1| hypothetical protein GSU2788 [Geobacter sulfurreducens PCA]
    MSQTTVVNGVNVDQLMATIEQIKAKPEIAQFKFRATNQWMGGTHNQATIKDFYGACAEDDTRKPMVFDLDEPPVLLGENR
    GANPVEYLLVALSG
    CLTTSLVAHAAARGIALRGVKSRYEGDIDLRGFLGLSEEVPVGYREIRVFFSIDADLTDGQKEELI
    RMAQKYSPVYNTVAKPVPVAVLLDRG

    >gi|39997905|ref|NP_953856.1| glutaredoxin family protein [Geobacter sulfurreducens PCA]
    MTASYRFVLMTLLAGMFALPAAGTAAAGSAPQSAVTPQQKEATEFPDVIIYTLSTCPHCAEAKAYLAKRGIPFTNREVDT
    DDEYMAELIKIFDDMKVPDERRGVPLFVVAGKTRLQGFDKAKLEEAINGGAEK

    >gi|39998031|ref|NP_953982.1| putative lipoprotein [Geobacter sulfurreducens PCA]
    MAKQAWRKGRVMLASMLGVVALTLLTLWGCGGGGYDQPATSAVTMQTANALVTAEQLKAWIDAGLVNKASGSYDRVVILD
    VSSNETDGSNKYNTVGHIPGAQLISAGANAFQDNTRAEGPLSVTGNMVCTGATMDALIQNAGIDGNTTIVLTNNANNTIN
    VARAYTTFRYWGFPKARLKVLQGGNPAWVAAGYSLTTAVPTIQKSTYGVAQNGTSRVNTDMRVSLPEMIAYVQGVVAGNA
    NKVFILDTIRPGTVSSTTDLLDGNFYTPFDGAIKGSYRFPYANVVSPASTLYFKDAATLQTDISAAVAGDGVTTLGDANR
    DSAKTFIVF
    CRAGNAASVAYFALDGIAYYNSNVDVKWYDGSLGQWNLMASSSHTATDTTGATVNAGGKLAVGSIWDTTLL
    TDNLTWNVGRTISTTNLAQRPIINYTSRVFGVEPSFAQGNQIEDADRAYRSTVTGTTGGGGSTGGGGC

    >gi|39998047|ref|NP_953998.1| redox-active disulfide protein 2 [Geobacter sulfurreducens PCA]
    MRIMKIEVLGTGCAKCKTLYENVQKAVEMSGKEAEVVKVEEIQKIMKYGVMSTPALVIDGVVKFSGKVPAADEIKGML

    >gi|39998048|ref|NP_953999.1| thioredoxin family protein [Geobacter sulfurreducens PCA]
    MRSLAALSLLLIATVAHAELPSASDAAISQALASGKPAVIDLGARYCIPCKKMAPILESLAAEYRGRANILFIDVNGNQA
    AAKRFRVQMIPTQIFFDARGTEVKRHMGFMDRADIVRELSVLGVR

    >gi|39998251|ref|NP_954202.1| methionine sulfoxide reductase A [Geobacter sulfurreducens PCA]
    MGENTSLEKATFGAGCFWHVEEEFRRVPGVVSTLAGYMGGWKEHPTYEEVCSKTTGHAEVVEVTFDPAAVTYDHLLRVFW
    DCHDPTQLNRQGPDIGTNYRSVIFYHSPDQERAARASLEHEQRSGRHARPIVTEIVPAATFWWAEEYHQHYLEKRGGGSC
    RW

    >gi|39998336|ref|NP_954287.1| thioredoxin peroxidase [Geobacter sulfurreducens PCA]
    MCMCTLVTKEAPDFTADAVMPDNTFGTVKLSSYRGKYVVLFFYPLDFTFVCPSEILAFNKKLDQFKAKNCEVIGVSVDSK
    FTHMAWKNTPVENGGIGNIQYPLVADLKKEIATQYGVLFEGAGVALRGLFLIDTKGVVRHAVINDLPLGRSVDEALRMVD
    ALQFVETHGDQVCPANWKEGDEAMKPTASGVAEYLAKHSVG

    >gi|39998369|ref|NP_954320.1| thioredoxin-related protein [Geobacter sulfurreducens PCA]
    MKVTGVLGVVSAAAFVIVSGFTSPSFALPKKGEPAPPLKVVSTSGQPISLANYKGYVLVVDFFATWCPPCRDAIPHLVTL
    NRKYGKQGLQVLGLSLDEGDEKGVKDFILSKRINYPVALASGDIQTDYGLRSLPTVYVIDKKGNVAEKFMGGSDETLRKM
    EDLVKKLLAEK

    >gi|39998370|ref|NP_954321.1| thioredoxin [Geobacter sulfurreducens PCA]
    MASDKVLTFSDDTFDSEVLKSPVPVLVDFWATWCAPCKAIAPVIDAIADEFDGKVKVGKVNVDDNPGTPGKYGVRGIPTV
    ILFKEGKVVDQVVGAVPKAQLEALIKKAL

    >gi|39998513|ref|NP_954464.1| mercuric reductase [Geobacter sulfurreducens PCA]
    MSDKHDLIILGSGSTAFAAALRAHSRGARVLMVEKSVLGGTCINWGCVPSKTLIHGALFYQEGRLGARLGLGECGNAVDL
    APLMTRKEEVVKHLRTTRYLDILRNTPGLELAKGTGRFLGSGRLEVVDQVYRCDRYLVAVGGTPRIPKIPGLESTPFLTS
    RGALLLKRFPASLIIIGGGVIAVELGQMFQRLGTRVTILEHGPRILAPIEPEPALAIRNVLRDEGMEIICHSPVCAVSGD
    GSAVSVEVEREDGRRTYTAEKLLLAVGTTPATRGIGLELAGVETDGRGFVTVDERMRTTAPGIWAAGDCTGGMMIATVGA
    REGIIAVDDMFATGCGCAMDHLSVPMAIFTDPEVGAVGYTEQGARDAGLDPIVSILPVSAIPKAHVTGHTAGVIKLVAER
    ATGRLLGAHLACHRGAELINEAALAIRLKATFEDLANALHVYPSIGEGLRLCAQGFTRDVSKLSCCAE

    >gi|39998535|ref|NP_954486.1| thioredoxin family protein, selenocysteine-containing [Geobacter sulfurreducens PCA]
    MAESGQSFLVACPACGTSNRVPASREGVAGRCGSCRGVLPPLYFQPVPLTDRSFDPFVAGYHGPVLVEFWAPWCPHCRDF
    APVVREVARELAGTAAVVQVNTQENPQLAARFGIRGIPALVLLRRGQVLATWSGALPREAVLSRVRDALR

    >gi|39998536|ref|NP_954487.1| AhpC/TSA family protein [Geobacter sulfurreducens PCA]
    MSLEGKKAPDFTLEGSDGKKHSLKDYAGKTVVIYFYPRDNTPGCTKEACGFRDLHQDLMARGVVLLGVSKDSLASHDKFI
    KAFGLPFTLLSDPDAAMMTAYGAFGEKVQYGKTTMGTIRSTVVVGPDGTVVKHWSKVAKAEAHPAQVAEFLAKQG

    >gi|39997222|ref|NP_953173.1| thioredoxin-related domain protein [Geobacter sulfurreducens PCA]
    MRWPLMAAAMLSLSVSASASYYTDSATGWWWYQKEPEKQAEKPARKKKPAKPVPSLKDYTYEQIWEMHPDQFQEFAEALK
    KKAVQKPSEENVKEYFEVQEIARKKALAFSNVAQFVWQKYPELTTKKDYPITTPGNLARISQINEERQRVLRDNRDDFAL
    VYFQRPD
    CSYCDEQSRILDWFTNETGWTVKKVNISENTGLAAKFSVEITPTLILIQKGNQDYLPVSAGVISADEIEDKAY
    RAVRLLRGDISPEEYSLYEFQKGGGFDVKKRRLQDKNQP