Geobacter metallireducens GS 15 uid57731

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|78221317|ref|YP_383064.1| methylated-DNA-(protein)-cysteine S-methyltransferase [Geobacter metallireducens GS-15]
    MKRYCTIKTPLGDMVALAEGDELSGLWFTDQKYVPADAGDRMHDQDHPLFAELRRQLDAYFAGMLQTFDLPLAPQGTPFQ
    MAVWELLRTIPPGTTTSYGALAVRMAQGRGGRITSARAVGSAVGRNPIDIIIP
    CHRVIGADGSLTGYAGGLKRKAALLAL
    ERGGGLPPG

    >gi|78221401|ref|YP_383148.1| mercuric reductase MerA [Geobacter metallireducens GS-15]
    MPDDTHDLVILGSGSTAFAAALRAQSYGTRVLMVEKGVPGGTCINWGCVPSKTLIHAALFYQEGKLGARLGLGECGGTVV
    LERLMARKDQVVGHLRQTKYLDILQDVPGLQLVKGTGRFLGPDRLEVGDREIRSERFLVAVGGDPRVPRIPGLESTPFLT
    SRGTLLLKTIPQSLVIIGGGVIAVEMGQMFQRLGAKVTILEHGPRILGPVEPEPALAVRDFLRAEGMKIVCRTTICLAAQ
    DGAGVRVEAERDGERVSFTAEKLLVATGTAPATNGIGLELAGVETDPRGFVTVDERMRTTAPGIWAAGDCTGGMMIATVG
    AREGIVAVDDMLNPGCGCSMDFLSAPMAIFTDPEVGMVGHTEEGAKAAGFDVVVNVMPVAAIPKAHVTGHTAGVIKMVAD
    KATGRLLGVHLACHRGADIINEAALAIRFRATVEDLANALHVYPSMGEGLRLCAQGFSRDISRLSCCAE

    >gi|78221407|ref|YP_383154.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Geobacter metallireducens GS-15]
    MQERPGIITFKGNPMTLLGPALAVGDKAPAFIAVDTGLAPVSLADFAGKVKIISAVPSLDTPVCDTETRRFNQEAATLPD
    NVVLLTVSMDLPFAQKRWCGAAGIDRVKTLSDYRDRSFGLAYGVVIKELMLLSRSLFVIDATDTIRYLQHVPEVTSEPDY
    AAVLAAAKSLL

    >gi|304570566|ref|YP_383193.2| bifunctional methionine sulfoxide reductase B/A protein [Geobacter metallireducens GS-15]
    MTILVFVVACLILAVVARPPRFGGRTAEKETTMTARKYSDEELKQRLTPLQYRVTRKSGTEPPFDNTYWNEHREGLYVDI
    VSGEPLFSSRDKFDSGTGWPSFTRPVAPNSVKEETDIGFGTVRTEVRSKEADSHLGHLFTDGPRDKGGLRY
    CVNSAALRF
    IPVDDLEKEGYGSYLPLFGRKAPAAAVKQVATLAGG
    CFWGMQDLLRKQPGVIATEVGYTGGSVPNATYENHEGHAEAVRI
    EFDPTKTSYEALLRFFFRMHDPTTLNRQGNDIGSSYRSAIFYHDAEQKRIAEKVKAEVDASGKWKRPVVTEIVPAGPWWR
    AEEYHQDYLVKNPGGYTCHWVRE

    >gi|78221491|ref|YP_383238.1| methionine sulfoxide reductase A [Geobacter metallireducens GS-15]
    MDETPELEKATFGAGCFWHVEAEFRRVSGVVATHAGYMGGWKDHPTYEEVCSKETGHAEVVEVVYDPARVSYDELLRIFW
    TIHDPTQLNRQGPDIGTNYRSVIFFHTPEQEQAARLSMEKEGGSGRYSRPIVTEIASASAFWWAEEYHQQYLEKRGGGSC
    NW

    >gi|78221738|ref|YP_383485.1| thioredoxin-related protein [Geobacter metallireducens GS-15]
    MRFLTLLFLLLTATVARAELPSATDDAINKALASGKPAVIDLGARYCIPCKKMAPILESLATEYRGKATVLFIDVNENQA
    APKRFRVQMIPTQIFFDARGKEVKRHMGFMDKADIVKELNALGVR

    >gi|78221739|ref|YP_383486.1| redox-active disulfide protein 2 [Geobacter metallireducens GS-15]
    MKIEVLGTGCAKCKTLYENAKKAVEMSGKEAEVIKVEEIQKIMKYGVMRTPALVVDGVVKFSGKVASPDEIRGML

    >gi|78221752|ref|YP_383499.1| rhodanese-like protein [Geobacter metallireducens GS-15]
    MAKQAWRKGRIILSGMLGVVALAMLTLWGCGGGGGKSYDTPSLNGPAPVATKTATPLVDAVTLKGWLDAGLVNKAAGSER
    VVILEFSGSYVDTSVTPNVTKLRYNDGHIPGAIRVDLTAELMANRVEGPAEFAQMVASGAQMDALIKRCGIDENTTIVFT
    TSEAEMNSNTLWNITRPYTTFRYWGFPKERLKVLDGGNKAWVAAAYPMTTVAPTITASTYNVTPLNTNRVKANLRASLSE
    MIAAVNAGTGLIIDGRTDGVPGSTTDLVESSKYVVFEGRMTGGSGYSHVNLVDATTKKFKDPAVVAADMTTKGLDLTKNT
    IYAM
    CRAGNIASALFFYFDGILYNDGSKNVVWYDGSWGQWGLMSDNAAKGGKLPVGSAWATDSLTLPITYDADLGRTVVD
    ITYRLDPTVSHATATANQIEDADKAYLSPVTSGGGGAGGGGGGGC

    >gi|78222230|ref|YP_383977.1| alkylhydroperoxidase AhpD core [Geobacter metallireducens GS-15]
    MRIEYVKVVPDVYRAMMCLEHQVEKSGLESPLLDLIKMRASQINGCAYCIDMHSKDARARGETEQRLYELDAWRESPFYT
    EREQAALAWTEALTLVTNGHVPNGVYEEARKQFTDVELVNLTLAVVAINGWNRLGIAFRSVPGGYHPASGLSR

    >gi|78222233|ref|YP_383980.1| rhodanese-like protein [Geobacter metallireducens GS-15]
    MRGGPRRRCLMKYGFEISAAEVKARMNAGEQLFFVNLRHHQDWDLAVMQVRGALRIDDDKVEAHLEEIPRERTVVVYSTC
    PGDEPSARVARLLQEHGWKDAHSLIGGFEAYCQEGLPVEEIGEGSSVRKIMML

    >gi|78222249|ref|YP_383996.1| hypothetical protein Gmet_1031 [Geobacter metallireducens GS-15]
    MIRHPLHTLAVVAFLILTLSLPAFAAPVLEVDRPVFDFGSISQGKKLEHVFKLMNKGDSPLTINRTKTSCGCTVANVSTK
    TIAPGKSADLKISFDSANFGGKVTKTITVESNDPASPTTTLTIKGNINEELVVTPHQINLGQTKAGSSKEASVALENHGE
    RTVKILSVTTPMPQVKATIKKHALKPGERTQLSVTVSPRPEDRFLSGFIIIATDIPGKPEITLPLYGSVAK

    >gi|78222364|ref|YP_384111.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Geobacter metallireducens GS-15]
    MAKEKLVVIGGDAAGMSAASQAKRRRPELEIVVFERSPHTSFSACGIPYYVGRVVDKEEKLVIRSPEKFREKYGIDARAL
    HEVVEIDAAQGKVRVRDLQRGGSAWESYDQLLIATGAVPLCPDLPGSDAVDICGVNTLESGLEIRRRLDKGGMKKGVVVG
    GGYIGLEMAEALVRHGLEVSLVNRAPQVMGTLDYDMGAMVSQALRDVGVSLYLEETLTAFETKGGKVTGVVTDRRTLPAD
    IVILGLGVRPNTALASAAGIPLGEKGSIRVNERMQTGVAGIWAAGDCAESFHLVSRKPVHIALGTVANRHGRVAGINLGG
    GYATFPGVVGTAVTKICQVEVARTGLQEEELRELGIEWISAVIKSRTRAGYFPGAGGITVKVLAERGSGRLLGGQIVGME
    GSAKRIDTLATALHAGFTVEEMINLDLGYAPPFSPVWDPVVIAAREVAKEL

    >gi|78222366|ref|YP_384113.1| hypothetical protein Gmet_1150 [Geobacter metallireducens GS-15]
    MRLQLLRFVGALSLTACLAAPTAFAAPKEQAKGETPEAAVKRLFPKLPATAVKKTDIDGFYEVVADGNILYVNVKTGHVF
    VGDIFTREGKNLTAEARTRLTAERYKLITEADKEKAVKVGNGKHVVIEITDPD
    CPFCRKMHEYWGNRPDVTRYVFFLPLA
    MHKDAEKKARYILAADNKEQALWEVYSGELDNNREKLNKPYDDKGLLSAHKAVVAKLGIQSTPAFWVDGTFVNGANIPLI
    EKIIGKCNLRQGTAPGEPKVCDDEQGK

    >gi|78222592|ref|YP_384339.1| DSBA oxidoreductase [Geobacter metallireducens GS-15]
    MSFKFVKTIAKSLALVALFAGSCFAFTEGTDYVKLAKPIPNAQGTLIKVFSYDCPFCYKYDKKITPNLVPKLPSDLKFRP
    FHLKTKGKYGVQGSELFAVLLLKDQKAGLSDRDLYGPKSLLKKAKMAYYTAYHDKKERWDAGPDAYLKTGLDAVGMSKAE
    FDKAKADPKVKALLKEWDASYDVAKVQGVPGFVVNGKYLIMTKSITSIDGMLKLINELKTK

    >gi|78222593|ref|YP_384340.1| putative disulfide oxidoreductase [Geobacter metallireducens GS-15]
    MFGNFRSDPAGTISQWQDKRFLWIFMAVLSLFMVILAHSVFQIWLYMRPCEQCVYIRLAFFAMAFGGVVAAIKPSNPGLK
    IVGYLFAIWGSFKGVLYSIKLNKIHHAAHSDDIFGVQG
    CSPEPTFPFHLPLDKWSPEWFKPTGDCGYDNPIIPDGVQLSA
    MQKAITDFYSEGWYLWPPSHFMNMAQCTLITFGVILLFLVVAAACWIVTLVRRKRQSATHEETSSCSGKLA

    >gi|78222595|ref|YP_384342.1| thioredoxin family protein [Geobacter metallireducens GS-15]
    MNQLLRYICACLFTLTVLAVAAPGKAESDAPLVRTGALAPNFKLPTLSGENKSLAQYRGKIVLVNFWASWCPYCRDEMPS
    MDRLVKSFPKGDLVVLAVNVEKRFPEKYRRAPVSFNFLSDATGQVQQRYGANRLPDTFIVDRKGIIRQRVTGGIEWDAPK
    VVSYLKSL

    >gi|78222668|ref|YP_384415.1| peptidylprolyl isomerase, FKBP-type [Geobacter metallireducens GS-15]
    MNRTATSKIVAMMLVVAVAIPALAAEPRNGESAGADAVLTKAIEDALGNGTGSVTVDLPQAEGKAKAGDLVTLRYTMTTA
    DGALVATTEESVAADKGRPRSVAFTARSRYRPEEIVAGGEGNLPGVAEAVIGMAPGEKKHLSLSADKAFGARDPQRVVTM
    ATVKSLPRTVAIPAADYVKNFGALPVVGKELPVVPYFPARVIEVTEQQAKLQLLARDGERFTESFGAVETKVDGESVKIR
    LVPTIGAPFEFRGARGTITAAGEENFTVDFNHPLADRSVVLDLEVVSLTKGEKLAAISVPWLENHDQGLEKAKQEEKPAV
    LVLYADW
    CQWCKKLFGETAEDPRIKAVSDRFVWIRVNSDKEKAYKEQYGQDGYPLIVLLDRQGKVAKKLDGFRDAAGLRE
    ELNALL

    >gi|78222767|ref|YP_384514.1| heavy metal transport/detoxification protein [Geobacter metallireducens GS-15]
    MRRGQISKIFRLVMVAALGVVLGAGAALSSGSPEAVTELKSTGISCGGCVSKITKSLETVPGVASVDVNIEAGLVSVWHD
    NTATPQKLAATVSDAGYQSTVQETMSADSYREKTRMSGPTQARSGGCGCCDKSKKPERN

    >gi|78222768|ref|YP_384515.1| heavy metal transport/detoxification protein [Geobacter metallireducens GS-15]
    MRKRTVGTGILVACAVGLLVYLAFNVRLAPIPNAVAALKTVGMTCGSCAGKIEKALKPMKGVAGVEVDVKGGWVLVGYDT
    NSANPETFAGAVRKAGFQSWLMEQMSLADFRRVTGRDFGAKVVRSGGCGTGGCDSGGCGNAI

    >gi|78222778|ref|YP_384525.1| UBA/THIF-type NAD/FAD binding fold:MoeZ/MoeB [Geobacter metallireducens GS-15]
    MFTEEQIERYSRHIILKEVGGKGQKKLLEGKVMVIGAGGLGAPIALYLAAAGVGTIGIADADVVDLSNLQRQVIHFTPDV
    GKPKVESAREKMEAINPDVTVRTYQEWISAANIARIIADYDFVIDGTDNFAAKFLINDACVMAGKPYSHGGILQFVGQTM
    TIKPGESPCYRCIFPAPPPKDAIPT
    CSQAGVIGVLPGVIGTIQATEAIKYLLGKGALLTGHIMMYDALEMNFRKVKLNRN
    RKCPVCGDNPTVTELVDELDALNVCDLEK

    >gi|78222988|ref|YP_384735.1| hypothetical protein Gmet_1779 [Geobacter metallireducens GS-15]
    MGRGVVRLFILAGVLIVLLMTLTATGAAGSIGPKGEVTLYFFWGEGCPHCAKARPFLDDLRRKHPGLQVCDYEVLSNRKN
    VDILMAMAKKRGFEATGVPVFIIGNHVIAGFSEEKARDIEQKVSVELAGREATAPPATNSPPAGETITIPGICTVNPAAM
    SLPVFTVVIAALDSFNPCAFFVLFFLLSLMIHAHSRNRMALVGGTFVLFSGLVYFLFMAAWLNLFLLTGTLAAVTTAAGI
    IALMVAVINIKDFFFFEKGISLVIPEEKKPKLFERMRHLVHTGTLPSMLAGTVVLAVAANSYELLCTAGFPMVYTRLLTL
    RALPSSEYYLYLAFYNLIYVIPLAVIVAIFTATLGSRKLTEWQGRVLKLLSGIMMLMLGLVILLKPTLLNNALASLVLMA
    VALSVTAIIAVVAHRMSRQTEKPRP

    >gi|78223103|ref|YP_384850.1| dihydrolipoamide dehydrogenase [Geobacter metallireducens GS-15]
    MKSFDVVIIGGGPGGINAGIMLSKAGKNVALIQEEAVSFGGTCLNSGCMPTKSLLKAATAYRYAKQAERYGLDLQAGPVD
    LGKLCAVTETDLNMLRGAIKGMLAETSITAFRGNGSFASEHEVTVTMAGGEQETIWGETIIIATGSSPRELPSAPFDGLH
    ILSSDQMLTNTDLPKKLLIVGGGAIGCEFATLYKTFGSEVVLIEAMETLLPREDRDAGKKLQAAFEAQGITVRTGTSIDR
    LIVVDEKIRIQFDNGDSIDSIDKVLVGIGRAPNIEGLNLEAAGLRTEHGAVKVNELMQTNVPHIYAIGDVTGGLTLAHAA
    QREAQLLVQNLLHGSSHALKELAVPRVAFSYPEVAAVGASQEGNGIRAYTLPQVPNGRSVVDKVAPAFVKLFLKEQTSEI
    AGAVIIGEAATEIIHEMALAVENGLTLQQVGNTVHVHPTHSKNILYAIQSCG

    >gi|78223253|ref|YP_385000.1| hypothetical protein Gmet_2046 [Geobacter metallireducens GS-15]
    MDSDSLIRNEFARNIGLLTVEEQKRLLASRVAVAGAGGVGGIHVLTLARLGVGCFTIADHDSFDVVNISRQFGAFHSTLN
    RNKAQVLAEMVKDINPNAEVRVMEEGVTEDNINAFLDGVDVYVDSIDFFEIDMRRLIFNSCRAKGIYALTAAPLGFGATL
    QVFDPEGMSFDDYFGIDDQTPPLEKIAAFAAGLTPNPYHLSYMDASRVSFKRRTGPAVSPA
    CTLAASLVATEIVKILTGK
    GELRPIPCYLQFDMLLNKVKMGKIALGAKSPSQKKKRRLIMENLLMKSED

    >gi|78223291|ref|YP_385038.1| 4Fe-4S ferredoxin, iron-sulfur binding protein [Geobacter metallireducens GS-15]
    MNTSDRNIGDVLIVGGGISGIQAALDLANSGFRVFLVDKSPALGGKMSQLDKTFPTNDCSMCIESPKFIECARNPNIEII
    TYTEVERVDGEAGDFRVTLTKKPRYISEEKCTGCNICVDYCPVKIPDPFNQNLSENKAVHIYFSQAVPLVTYVDPETCLY
    LKEGKCQICVGACKTKAIDLHQKPETMVVEVGAIILSPGYETFNPKLRGDFGYGRMQNVVTSLDFERILCATGPYEGEIL
    RPSDKKHPHKIAWIQCVGSRQVNEGGNNYCSAVCCAYSQKQVILAKDHDADLQATIFHNDVRAYGKDFERFHQRAEKLSD
    VRFVRSYVTIGREIESTKNVTIRYSTVDDGVKEEEFDMVVLSVGLNPPKDVEALASKIGIELTDQKFCKNNPYNPIETSR
    KGVFVSGAFQGPLDIPESVVTASGAGALCGQLLSYRRGRLERERVYPPEKDVSQEELKIGVVVCYCGANIGRVVNIPEVI
    EYAATLPNVAWAGENLFACSTENAKQISDAIVAKGLNRVVLAACTPRTHEPLFRDTCREAGLNQYFFEFANIREHCSWVH
    SREKESATQKAKEIVRMSVARAAHLEPLQEFQLPVDHTGLVVGGGVAGMTAALNMAEQGFEVYLIEKDDDLGGMARRLHY
    TLEGMDVQSFLADLVKKVYRHPRVHVWTDANITDVSGYVGNFVTTVTSQGRNREVKHGVAVIATGAQEYKPTEYLYGESD
    RVLTQLELEGEIVSQSEKVTGAQSVVMIQCVGCRQADRNYCSRVCCSQAIKNAHKLKEINPEMEIQIIFRDMRTYGLKET
    YYREASEKNVKFIRYEAETKPVVEAAGDGFKVTVPDPVLGQMMELEADLVVLAAAVIPAESSQDAGKLFKVSNNPDGFFQ
    EAHVKLRPVDFAADGVFLCGTAHYPKHLSETISQAYGAAGRAVGILSRETVTASGAVCDVTESDCVSCGACITACKYGAI
    SFVDTPNGKKARVEPILCKGDGLCNAKCPTGAIYLKHYTDDEICAQIDAAFPEH

    >gi|78223455|ref|YP_385202.1| hypothetical protein Gmet_2250 [Geobacter metallireducens GS-15]
    MHQMIRFFWGGNMKWLMRILLPFAFVSTAYGFGTGTEGCSGNCIACHTIKKEEVVALVKNVDPATTVESVGPSPVRGLFE
    IIIRHNDSTGIIYLDFSKKFLIAGRILDTGSKKDVTATALNRVRRIDPSKLPLDNALVLGNATGSRNIYVFTDPE
    CPFCA
    KFHRELVALTKEDPQLGVRIILTPLDIHPRASAVTNSILCAAQDGMDKGLRLLEESFNGTAIADITCGRDYAEEGKTLFK
    ELRIRMTPTTVLSDGRVVDGVKTGAEIEKLFDDTEHGVITEKPQ

    >gi|78223604|ref|YP_385351.1| hypothetical protein Gmet_2401 [Geobacter metallireducens GS-15]
    MKEHTSNGGEARLKRIVSADRDALPPDGGPGFNRLVFASSPYLLQHADNPVAWYEWGDEAFARARAEDKPVFLSIGYATC
    HWCHVMAHESFGDHEVAAVLNRDFVAIKVDREERPDIDDTYMRVAQLMNGSGGWPLTVCMTPDREPFFVATYIPKHSRGG
    MPGLVEILGRIAEVWKTRRELVHQNCTAILDSLRNLSVAKPGEIPGAEPLRAARSQLAGMFDPVNAGFGQAPKFPMPLNL
    SFLLRYGRRFGDPGATVMVVATLEALRRGGIFDQLGFGLHRYSVDSRWLVPHFEKMLYDQALVAMAAVEAFQATGQESLR
    EMAEQLCDFVLRELAAPEGGFYSALDADTEGEEGRYYLWTPAQVRSVLGETEGELFCRLFDVTGKGNFEGANILNLPVLL
    HEFAQREGMSPENLEEKVEGWRLLLLAERAKRERPFRDEKIVTAWNGLMIAALARLFLAGGGERFLVAAEAALVRILRDL
    RRADGRLLRSIHRGEGEVPAFLEDYAALLHGLLALHDATLDPRYREEACSLARDMLRLFSGEDRGLYDTGNDAETVLMRS
    RVDYDGVMPSGNGLAATGLVRLGRMADEERFVEAGEEIIRAFMAGAGRQPVAHLQTLMALDLLRGPQVEVAISGGSRGKV
    QGMLAEIGKRFIPGFVLRGEPDQGRRATAQVCAAGACHIPVESPAALGGILDRVLDEGYPPPQQKP

    >gi|78223616|ref|YP_385363.1| glutaredoxin-like protein, YruB [Geobacter metallireducens GS-15]
    MKKISALIPLLMLSLAAVSGQAAEAPAAGQSKIDAVATKQQAYPKVVLYSVAWCPHCKEAKEYFTRNNIPFINKDVELDE
    KAMDELTKTYKSQGVPVIVIGDDKKVLKGFNPELFEKAVKDIQSKK

    >gi|78223655|ref|YP_385402.1| thioredoxin family protein [Geobacter metallireducens GS-15]
    MRKIFLILPILFLLALTGCSKESKPPVEENPAPDFTLNTLNGEVVKLSDLKGQVVIVNFWATWCPPCREEIPSMMRLNAA
    MAGKPFRMLCVSIDEGGKVAVEEFFRKTGFTLPVLLDADKRVGKLYGTTGVPETFVIDRHGVILKKVVGAMEWDHPEVIA
    FLNNELSKAR

    >gi|78223660|ref|YP_385407.1| radical SAM family protein [Geobacter metallireducens GS-15]
    MVAVFKERLREIDPMYVTFEGLQTLQVNLGNICNQTCAHCHVNASPAGDRIMGPAVMEKIVGLLTRRPGITLDITGGCPE
    MNPHFRALVEKTRGHSPRRMVRSNLTIMTEPGMEWLPGFYRDQELVVIASLPCYQEENVERQRGPGVFARSIEALRILNG
    LGYGGTLELNLVYNPGGPLIPGSQRELEEAYKIELLTRYGIRFNNLYTIANAPIGRFREYLEAKGAYERYLAMLATRFNP
    EAARNIMCRTLVSVDWKGFLYNCDFNQAIGLPITSGSGEILKIDDLEEAATTGAELFLAQHCYCCTAGEGSS
    CTGALS

    >gi|78223842|ref|YP_385589.1| alkylhydroperoxidase AhpD core [Geobacter metallireducens GS-15]
    MARLTTVEVSAVSGETAAIFKEIEGAFGMVPNLFKSYAHHPPLLKANWNKVKAVMMEGTLSQKVKQTIAVLVSRDNGCTY
    CVAAHTGALKAIGISDEEIGIIMQSIEQADFSAKEKALIGFARKANTNPTRIEDAEFDALRQAGVSDAEIVEALGVMELF
    TAFNKFLDSLQVEIDF

    >gi|78223848|ref|YP_385595.1| thioredoxin-related protein [Geobacter metallireducens GS-15]
    MKKTLPQLVIMSVLCLLAALPALAQEEIPAAAKERFKAGLALIEKADKSADFLAALAEFEAAAALAPTWPDSHYNLAQLA
    AESDKPAKAIKEYRAYLALKPDAADRGAVEAEMARMKELIALKRKVGLPGVTFAAMADGIWVLQVLPGAGIEKTGLRKGH
    QIVGVGGKPLAGNKLEDLFKAIEANNITDTMSRGSSERMYSRMTRDTKTQGPVVVLNVKQSRQQEKPFLILCKKEMFRSK
    IIEIEEDEFEDEVLKAPLPVAVTFWGDS
    CEPCKEFVPVLEAESAKYAGKVKFVNINVDGNRKLADQLAVKEVPALMVYKG
    GSAVATATGKLPREKVAEMLQDAAGR

    >gi|78223850|ref|YP_385597.1| thioredoxin-related protein [Geobacter metallireducens GS-15]
    MKKAIRQLVITSLFALLTVSPLLAQEEIPEAARERFKAGFAIIEKADSPAGFRAAMDEFEAAAALAPRWPDIHYNLAKVA
    AETDKPAKAINEYRAYLALAPEAADRAAVEGDIARMKEMIARKRKLGLPGVVFAAMPDGIWVMELAPGSRVGKTLLRKGY
    KILAVEGESVVGAKLDGFFRAIETQSAKVAAAKSEEKKQPGQIPAGFRSEMGFIRSQKFMRTTQPNAAGNAVEETGPAIA
    FTVISPGSTDTGKLFFKQSMFRSSVIEIEEDEFEDEVIKERLPVVVTFWGSD
    CGPCQDFVPAVEAQSARYAGKVKFVNVN
    VNENRKLAGQLAIKGVPAMMVYKGGSPVSTTTGRIDNAKLAELLQGVAAN

    >gi|304570572|ref|YP_385666.2| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Geobacter metallireducens GS-15]
    MNRITALLAAILATSLFAGPACAAPEKADDMTKATELMVQHHKGMVRTAPEMAKVGEPAPPFTLDAVVDKEFKKVSLGDY
    RGKWVVLFFYPADFTFV
    CPTEITGFNKAMDRFTELNAQLLGASVDSKYSHLAWIKRGDLGDLKYPLLADNKKEATARYGI
    LDEKEGVALRGLFIIDPNGVLQYQVVNNLSVGRSVDETLRVLEALQTGELCPLGWKPGEKTIK

    >gi|78223960|ref|YP_385707.1| dihydrolipoamide dehydrogenase [Geobacter metallireducens GS-15]
    MSEELYDLIVIGAGPGGYVAAIRAAQLGMSVAVVEKRSALGGVCLNEGCIPSKALLDSSELFALARDRFAGHGIAIDPPR
    LDLARMMARKDDVVKKLTDGVAFLFKKNKIARVQGTARLTGERDGAHGVDVEGGDQGPGTGDREKQTLRGKRVLLATGSE
    AAVIPFMPFDGELVVSAREALSFDRVPEHLLVVGAGYVGLELGSVWRRLGSQVTVVEMLPKMLPNTDGQVADTLMGSLKK
    QGIVFRMETKVTGFAKRDGKAAVTVEAGGATEEIVCDRVLVAAGRRPLTAGLGLEELGVRLEAGRIAVDDNYQTSLRGIY
    AIGDLIHGPMLAHKAMAEGEVFAERLTGQASVVDYAYIPGIVYTWPEAAGVGRTEEELKTEGVEYRVGKFPFMANGRAKC
    MDETEGFVKILATPDTGRVLGIHVIGPRASDVIAEAVTVMTYGGSAADIAMTFHAHPTLAEAMKEAALDVEKRAIHA

    >gi|78223968|ref|YP_385715.1| copper-translocating P-type ATPase:heavy metal translocating P-type ATPase [Geobacter metallireducens GS-15]
    MHKTMFGITGMHCAGCAARIEKEIGLMDGVVMAVVNFATEEMAVEYDEAKTSEDVIDSRVKELGYGTRRAAAAGELRFGV
    RGLH
    CASCVANLEKKLLSNPAVTAAVVNLAQEEALVRFDPARLGQADIFALVTEAGYTPVEPEQGGAEAASELLSQRNWF
    ILSAVLSLPIMFTMAQHDNRAVGWMNLVLATIVQFSAGLTFYRGSWFALKNKSANMDVLVALGTSAAYFYSLLAFFGAFG
    EHGGHVFFETSAMLIAFIRLGKYLEARARGKAGEALKKLLRLQADKARLVTPEGEREVPASAVRVGDLVRVFPGEALPVD
    GEVVEGSSTVDESMVTGESVPVTKKPGNPVTGATVNRGGVLTVRATRIGEETLLSQIVRMVREAQADKAPIQRFADRVSG
    VFVPVVIALAVITFAVWYWGLHQEFLFAFKLAIAVVVIACPCAMGLATPTAIMVGSGVGLNRGILVKRGSVLENISRVQA
    ILLDKTGTLTRGEPALTDIVPVPGETEERLLTLLAAAESRSTHPLAQAAVAGAAERGVMLAETADYREIEGGGVVCTVAG
    EPVMAGNARFLEEAGIVTAPLATDAARLGGEGKSLVFVAAGGRPVGVAALADRLKEGSAAAVAAMKAMGIATFMITGDHR
    AVAAAVAREAGVDGFEAEVLPGRKQEVVKEYQAKGLFTAMVGDGINDAPALARADVGIAIGGGTDVAKETGDVILVRDDL
    MDVVRAIRLGRATLAKVKQNLFWALFYNILGIPVAAGILYYPFGITLKPEYAGLAMAFSSVSVVTNSILLRKVGKKFE

    >gi|78223987|ref|YP_385734.1| arsenite S-adenosylmethyltransferase [Geobacter metallireducens GS-15]
    MDKQRNEEIRGAVRENYGKVAVSGGAGCGCSSSSCCGTPNGATTEDISLGLGYSGEDVAAVPEGANLGLGCGNPQAIASL
    QLGETVLDLGSGGGFDCFLAARAVGHTGHVIGVDMTPEMITKSRRNADKANFGNVDFRLGELENLPVADGIVDVIISNCV
    INLSPEKAKVFSESFRVLKSGGRLAISDVVATAEMPGDIKNNMAFHTG
    CIAGASSIEEIESMLERTGFVNIRINPKTESR
    AFIRDWMPGSKIEDYVVSATIEAIKP

    >gi|78224051|ref|YP_385798.1| UBA/THIF-type NAD/FAD binding fold:MoeZ/MoeB [Geobacter metallireducens GS-15]
    MLTAEQSERYARHLILENVGEVGQERLLAGRVMVIGAGGLGSPVALYLAAAGVGTIGIADSDRVELSNLQRQIAHHTADL
    GRPKVVSAREKMAAMNPDVTVIPFETRVEASNIAEIIADFDFVIDATDNFAAKFLINDACVAAGKPFSHGGILRFNGQTM
    TVLPGESPCYRCIFPEPPESDEVATA
    CSRAGVIGVLPGVIGTIQATEAIKYLMGIGELLTGRLLTYSALALKFREVPIKK
    KLTCPACG

    >gi|78224103|ref|YP_385850.1| selenophosphate synthase [Geobacter metallireducens GS-15]
    MIKLTSLVKAAGCAAKLGPAGLEDALSGILGKGDDPNLLVGPETADDAGVYRIGEGLALVDTVDIITPLVDDPFTFGRIA
    AANALSDVYAMGGRPVTAMNLAFFPACTLPGQILADIMAGGLDAVREAGACLVGGHTVEDHELKYGLSVTGLISPGRIVR
    NSTARPGDRLILTKPLGTGIVSTAIKADMVAPGVVDEAIRWMALLNASAAGLMLECEASACTDVTGFGLLGHACEMARGA
    GVTLEIALDAVPLMGGVEDLVADGLVPAGCYRNRDHYTPLVSVSAGAGGRLIPLFDPQTSGGLLITLSPQFADSFLSMAR
    DRGLFAVAVGGVLPPREHAVVIA

    >gi|78224115|ref|YP_385862.1| glutaredoxin [Geobacter metallireducens GS-15]
    MILRIIVALLTVVLAVALLAGCTPARPAVPPVPSGAAAENRHEVVVYVRTGCSFCQEAREFLAARGVPVRERNVAADRSA
    LVEMLDIHVRRFPDEEPLVPLIVIGDRVVRGFDRQEVEAALAEVERTSTAGSKQ

    >gi|78224154|ref|YP_385901.1| glutaredoxin-like protein, YruB [Geobacter metallireducens GS-15]
    MPTRTLLSILILHLSCSLAGAEMYQWVDGKGTVVITDTPPPPSKKRKKVKVYNDGDFAPAPPPQPTPAKRSAKGAAAAEA
    QPASPKKEHFTGTVEMYVTSW
    CGYCRRAESYLKSKGIPYVAYDIEKDSAARQRHRELGGNGVPLIIIGSNKMSGFSPETL
    EYYLNNGR

    >gi|78224211|ref|YP_385958.1| rhodanese-like protein [Geobacter metallireducens GS-15]
    MKSDAKRLAAEMAAIVLIAAVIGIAWNHRLLLNVFRGEGVKAQQTPAAPKGAPAAAPTAAAALPLGLMQVKELFDTGEAI
    IIDARDREAYRKGHIKGAMSLPVGEAGGLITPFADRTPKDKLLVVY
    CGGYDCHDSKLLGEKLLAAGFTQVFVYEGGYPEW
    QDAGHPVTKGDK

    >gi|78224262|ref|YP_386009.1| thioredoxin reductase [Geobacter metallireducens GS-15]
    METTHHRLIILGSGPAGYTAAVYAARANLNPTLITGLQQGGQLMTTTEVDNWPGDPNGVQGPDLMERMRQHAERFNTTMV
    FDHIGKANLRERPFRLEGDNGIYTCDALIIATGATARYLGLPSEDAFKGKGVSA
    CATCDGFFYRGKPVAVIGGGSTAVEE
    ALYLSNIASHVTVIHRRDKFRSEKILADRLIEKTKGGNVTIEWHHVLDEVLGDATGVTGIRIRHTSGSTKDIPVHGCFIA
    IGHAPNTQLFEGQLEMDNGYIRTLCGGEGNVTATSIPGVFAAGDVQDQYYKQAITSAGTGCMAALDAEKYLETLLS

    >gi|78224314|ref|YP_386061.1| rhodanese-like protein [Geobacter metallireducens GS-15]
    MVMKQIAIFPMIVLALAVTVLAAGYRDIKASEAKSLLAANKKVFLLDVRTPEEFGQGRLQGAVLIPINEVERRIGEIPRN
    RPVVVY
    CAVGSRSGLVAGFLSRKGYREVYNMADGIVGWYRNGLPILR

    >gi|78224377|ref|YP_386124.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Geobacter metallireducens GS-15]
    MCMCTLVTKEAPDFAADAVLPDNTFATIKLSSFRGKYVILFFYPLDFTFVCPSEILAFNKKLDQFKAKNCEVIGVSVDSK
    FTHLAWKNTKVEDGGIGNIQYPLVSDLKKEIATQFGVLFENGGVALRGLFLIDTKGIVRHAVINDLPLGRSVDEALRMLD
    ALQFVETHGDQVCPANWREGDEAMKPTAAGVADYLAKHAAG

    >gi|78224420|ref|YP_386167.1| thioredoxin-related protein [Geobacter metallireducens GS-15]
    MRIVPVLRAFVAAAGFTMAVASPSLAIPQKGQPAPPLKVVSTSGQQISLANYKGYVLVIDFFATWCPPCREAIPHLNGIS
    RKYGRQGLQVLGLSLDDGDEGAVKDFIASKRIVYPVALAGQDVQTDYGLRSLPTVYVIDKRGNVADRFMGGSDATLKNME
    TLIKKLLAEK

    >gi|78224421|ref|YP_386168.1| thioredoxin [Geobacter metallireducens GS-15]
    MASEKVLTFSDDNFDTDVLKATVPVLVDFWATWCAPCKAIAPVIDAIADEYDGKVKVGKVNVDDNPGTPGKYGVRGIPTV
    ILFKDGKVVDQVVGAVPKAQLEALIKKAL

    >gi|78224567|ref|YP_386314.1| ADP-ribosylation/crystallin J1 [Geobacter metallireducens GS-15]
    MEQRDREGAAKHRETKGVPTVADRFRGAVWGQFVGDAACLGSHWIYELAELERRFQGGVVGFETPADGHYHTGKHSGELT
    HYGDGALVMLRSVAERGHFDPQDFGRRFVELFGSDSYRGYLDHATRDTLTHWRAFTETHPGDPYNFQDGADDDQPATATR
    LVPVVIAHWRDASLLRVVETATRVCQNNDGAVDYLKCHALILRELFNGTDLHEAFHRAATEMERGSGFGPEVADGIRKAC
    ASLTLSVRDATLAFGQS
    CPLSSSFPAAVHCALRHSVDFAAAVLDTANAGGDSAGRAALIGSWLGAFHGIAGISAAWRHRL
    AARYEIERHLEELVQKAQ

    >gi|78224616|ref|YP_386363.1| heterodisulfide reductase subunit [Geobacter metallireducens GS-15]
    MSRIGVFVCHCGENISRTVDVERVAAEAARLPGVAYATDYKYMCSDPGQNLLKNAVTEHRLDGIVVAACSPRMHEKTFRN
    AAKSAGLNPFLCEMANIREHCSWVHEDRDEATAKASDIVAMMVARVKKDKRLVPITVPVTKRSLVIGGGIAGIQAALDIA
    DAGHQVVLVEREPSIGGHMAQLSETFPTLDCSQ
    CIMTPKMVDVANHPNITLHTYSEIEAVDGYIGNFQITVRKKARSVIE
    EKCTGCGVCSAKCPQKKIPNTFDKNLGTRPAIYVPFPQAVPNTPVIDRANCTWFKTGKCGVCQKVCGPGAINYEQEDQLI
    VEPVGAIVVATGFELYSITEKPKGSPIKGYGEFGHGTIPDVIDGLTFERLASASGPTGGKILRPSDGKEPKQVVFVQCVG
    SRAREKGISYCSKICCMYTAKHTMLYKHKIHDGQAYVFFMDARTPGKSYDEFWRRAVEEEEAVYIRGMVSRLYQKGDKVV
    VMGSDISVGVQVEIEADLVVLATAVQPRAGADTLAQKLGISYDSYHFYSEAHAKLKPVECATAGIYLAGACQGPKDIPDT
    VSQASAAAAKVMTLFAKDELEREPIVAKVNEKNCVACLYCKKVCPYGAVEEKEIRDRQGNLIRVVAYVNPGVCGGCGTCQ
    ASCPSKSVELDGYTDEQIMAMIEAL

    >gi|78224640|ref|YP_386387.1| hypothetical protein Gmet_3453 [Geobacter metallireducens GS-15]
    MFVSPTVIVTAIGLMLGLIAGFVMHRADFCIAGMFRDLFLFRSTARLRALVLYLAVAMVLFEGARLLGLLPLYPFPLLGP
    ASLAGTLGGVLFGIGMVLAGG
    CVVGTLYRLGAGNRPSLVAFIGLIIGSALYAEFHPFWKSLLTATTLFSGSITIPQYFSL
    SPTPLIAVAVAILGGLVTFWCRHGQLSRRLYAKGALQLWQAALVLAGVSLASYLLIGMPLGITNAYAKIGAMGEQLVFPD
    HVADLGFFASQPLSCRNPLTGMMLTGGPGPALDGIALIQFPLIAGIILGSTVSALSLGEFTLGHPAPWRQYLSAAVGGIL
    MGLASRMAPA
    CNVWHFLGGLPILAFSSIFFLAGILPGAWLGACILTRWVVR

    >gi|78224667|ref|YP_386414.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Geobacter metallireducens GS-15]
    MKLRVVVIGANAAGAKAASKAKRMNPHAEVTLIERGNFISYGACGIPYFVSDTVADVKELMSTPVGVVRDAAFFNKVKGV
    HVITGTEVVSLDRQSRTVQLFEKESAKAFSLEYDRLVLATGSSPSLPPLKNRDLGNILTVKAIEDAELLKERAVTGKRAC
    IVGGGLIGLETAEALRQKGLEVTIVEMRDQLLPGILDPEMASLVERHIRQNGVEVETSCRVAGFDGTGVVNKVLTERGEI
    PADVVVLAPGVTPNVKLAKEAGLEIGPTGAIAVDSRMGTSDPAIYACGDCCETTHLVTGKKVHVPLGSTANKQGRVAGIN
    ASGGEATFAGILGTSILRVFSVNAGKTGLTESEARAQGYDVETVLSPAPDKAHFFPGAKPIALKLVADRATGRILGLQAV
    GEGAVDKRVDAAAAAITFGATADQLSHLDLAYAPPYSAAMDNLIVAADILKNKLAGHARGISPRKVRQMLDDGDDFILLD
    VRSPAEHAEVGIEGATLIPLGALREKLESLPKDKEIVTF
    CKISLRGYEAQKILDAAGFRDVKFLDGGIMTWPYELRRGGG
    A

    >gi|78224699|ref|YP_386446.1| AhpC/Tsa family protein, selenocysteine-containing [Geobacter metallireducens GS-15]
    MDGEQPTFIFELQKELDAIRENFRATASPDVVTAMDRSAEELIRAGIVERALQVGSPAPDFALPNAVGREVRLSSVTARG
    PSVITFYRGAW
    CPYCSLQLRAYQKILPQLKLLGGELLAISPQTPDKTQATLLKNFLEYEVLSDVGNRVAKRFGLVYPVGA
    EVRRIYLGFGVDLAEYNGDDSWELPLPGTFVIDRTMTVRLSFVDADYTRRLEPAAILDTLRAMRDVGGIP