Geobacter lovleyi SZ uid58713

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|189423266|ref|YP_001950443.1| Thioredoxin domain [Geobacter lovleyi SZ]
    MATASYLISCPSCGTGNRIPADKEGVRGRCGNCKSALPPLYCHPQQMTDRTFDSFINSYPGPVLAEFWAPTCPHCHTFAP
    VVRTVAEKLAGQAAVVQINTQDNPNLAARFGIRGIPVIVLLKQGRVVDQLPGAHPLDAVLAWFRRKV

    >gi|189423324|ref|YP_001950501.1| glutaredoxin 2 [Geobacter lovleyi SZ]
    MRRLILASILQLSVTTASAGYYADSAKGWWWYQKEPEKQAEKQEKKKKPPKSTPSLKDYSYEQVWEMHPDQFQEFAEVLK
    KKAVQKPSEENVKEYFEVQEIARKKALAFSNVAQFVWQKYPELTTKKDYPITTPGNLARISQINEERQRILRDNRDDFAL
    IYFQRPD
    CSYCDEQSRILDWFTNETGWTVKKVNISENPGLAAKFSVEITPTLILIQKGNQDYLPVSAGVISADEIEDKAY
    RAVRLLKGDISPEEYSLYEFQKGGSFDVKKRRLQEERP

    >gi|189423394|ref|YP_001950571.1| protein-disulfide isomerase [Geobacter lovleyi SZ]
    MKTANNKKLMVGGLMMFIVTAAGFSMANDNLRTEKETLMKTFPNMKLDGFRESPLKGLYEITAGEQVFYFSPEGYLFFGE
    IWTKDGKNLTAEMREKVVAERINSLPLDKALKIGNGPKKVIEFTDPD
    CPYCRKVDNFLSKRTDVTRYVYFVPLRRIHPDA
    EKKARYILSQSDRDKAFHEVFEGVLDGKPISIVDGAQQQQLEEMEKIAAGLGVRGTPALWIEGAHVNGADIQRITGLLDK
    GKEVSKPQTH

    >gi|189423425|ref|YP_001950602.1| Rhodanese domain protein [Geobacter lovleyi SZ]
    MNAKELQKQLKSKTPPTVVDVRSAMEYRLGHIPGALLLPFWKVLLRMTGSLPKDKQAQLVLYCESGARAEMVGSMLAKRG
    YSRIAYLDGDMPGWRQAGLPLEK

    >gi|189423498|ref|YP_001950675.1| nitrogenase-associated protein [Geobacter lovleyi SZ]
    MARITFYTKIGCLTSQKQLALLQEAGHQVVLQDLLAHPWTAEELRSYFGDLPVQDWFNPNATRIKSGEIDPEAYAADEAL
    AVMLQDHLLIRRPLMESGNSRRCGFDPAVIHDWVGLAKHGDAFVFRGDLSSCSNPGAVASACP

    >gi|189423546|ref|YP_001950723.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Geobacter lovleyi SZ]
    MSTCTLVTKAAPDFTADAVMADNSFGQVSLSSYQGKYVYLLFYPLDFTFVCPSEILAFNKKLDEFKQRNCELISISIDSK
    FTHLAWKNTKVEDGGIGQVQFPMVADLNKEITKAYGIEHSASVALRGLFLIDPKGVVRHCVINDLPLGRSVDEALRMLDA
    LQFTDTHGEVCPANWKQGEEAMKPTAEGVASYLAKHAK

    >gi|189423576|ref|YP_001950753.1| thioredoxin [Geobacter lovleyi SZ]
    MASDAVLTLSDANFDRDVLQSDLPVLVDFWATWCAPCKAIAPLIDAVAADYAGKVKVGKVNVDDNPATPGKYGVRGIPTL
    ILFKGGKVVDQVVGAVPKSQLDALIAKAL

    >gi|189423577|ref|YP_001950754.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Geobacter lovleyi SZ]
    MPFVSLQGCFRAVTLIVTALLLGLCPYNAEAAPRRGQPAPPFKTFSIKGQPVSTEGLKGSVVLLDFWATWCPPCRESIPH
    LAELHRKYSKQGLVIIGMSVDEGGERTVKEYAENHAIPYQIVMASGRISSDYGVRALPVLYVIDKNGLVREQIMGFSDQA
    GKVIENLVKKLLNEK

    >gi|189423601|ref|YP_001950778.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Geobacter lovleyi SZ]
    MRCALVFLLFVLNLLTLSVTPCLAVKLNTPAPDFTLKDLQGGRQTLSGYRGKLVLLNFWSTTCPPCVQELPSLNDLYKDQ
    KQAGLLVLGIALDPAEKPVHELAGKLRLEFPVVLDSNKDVYFDSYGLFGQPVSVIIDRTGLVREKMIGAVDWNSPQIRAK
    ITSYLKGR

    >gi|189423931|ref|YP_001951108.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Geobacter lovleyi SZ]
    MSRIGVFVCHCGENISRTVDVEQVAAQAAKMPGVAFATDYKYMCSDPGQGLLKKAINEHRLTHVVVAACSPRMHERTFRK
    AVEQASLNPFLCEMANIREHCSWVHEDRDEATQKATEIVGMLVERVKKNRVLPTITVPVTKRALVIGGGIAGIQAALDIA
    DAGHQVVLVEREPSIGGHMAQLSETFPTLDCSQ
    CIMTPKMVDVANHPNITMHTFSEIEQVDGYIGNFQVTVRKKARSVDE
    QKCTGCGVCMTKCPQKKIPNSFDRNLGMRTAIYVPFPQAVPNVPVIDRDNCTMFKSGKCGVCQKVCGPGAVDFEQEDRLV
    VEPVGAIVVATGFELYTIDKKPDDSAIVGYGEFGYGTIPDVIDGLTFERLASASGPTGGKILRPSDGKEPKQVVFIQCVG
    SRAREKGISYCSKICCMYTAKHTMLYHHKVHDGQAYVFFMDARVPGKNYDEFWRRAIEEEEAVYIRGMVSRLYQKGDKIV
    VMGSDIAVGVQVEVEADLVVLATAVMPRKGADTLAQKLGISYDKYHFYSEAHAKLKPVECATAGIYLSGACQGPKDIPDT
    VSQASAAAAKVMTLFAKDKLEREPIVARVKENSCVGCFACKKVCAYGAVEEKEIRDRQGNLIKTVAYVNPGVCAGCGTCQ
    ATCPSKSVELDGYTDEQIVAMIEAL

    >gi|189423937|ref|YP_001951114.1| protein-disulfide isomerase [Geobacter lovleyi SZ]
    MTQRFLLTLALLATMVFCSGTASAATIDLNKALVIGTGPKKVIEFTDPDCPFCRKAAAYFHNRRDITRYVFFNPLAMHPN
    ARSKAQYILSGHDKTRLYHEVMSGMVDRMDTKNLPVTAAGIKSQEEQQAIAKKAGIDSTPTFMIMGRIIEGFVQAKIEEL
    LGKP

    >gi|189423962|ref|YP_001951139.1| Methyltransferase type 11 [Geobacter lovleyi SZ]
    MGDKQDALATVKEYYGKVLTGSKKLQATACCLLEVCPPAHQAILAEIDDELLDRFYGCGSPIPAAIDGCTVLDLGCGTGR
    DAYLASKLVGQDGYVIGVDMTDEQLAVARKHLHSQTARFGLTQPNLEFRHGYIEDLADCGITDNSIDLVISNCVINLSPD
    KERVFSEIFRVLKPGGELYFSDVFVDRRLPVHLKNDPALYGE
    CLSGALYSEDFRRLLLGLGCRDYRVLSRRPVVLDNPAV
    FSWIGQAQFCSCVIRAFKLACLEDICEDYGQVACYNGTLPGLPHYFDLDDHHRFYTGKPMPV
    CGNSAAMVQETRFGKHFT
    VTGDRSVHFGAFPCGPAPAQAADSCAANGC

    >gi|189423989|ref|YP_001951166.1| Methyltransferase type 11 [Geobacter lovleyi SZ]
    MPFNHSDWIRLPLASSALYLAPGQPAWFVPTAEGDRLLCSAASGAVLQDSDSQLFLQRLPKGTPAVYPGRELLLPRSPAL
    RELWFHVTDACNMSCSHCLFSAGPGHYRQLPLDQLLQHAATAYGSLDCRLFALTGGEPLMYDGFSRLIEGLLEHQDAQLV
    ILSNGLLADRKLDPAWPRERIRLQISLDGSPEQHDAVRGKGSFALLQKQLLFLKENGWQFTLSMCPTQANHQDIPWLVDF
    AADMGAAAVHYMWYFIRGRGSEEQAVAPVQLLPLLAAAMERSHSRGVPIDNLEAIRQRIFSPPGTIHDGSSAGVESAAIG
    PDNRLYPTAATVGVRQLSTALEAGLAAAWQQSEVLAEIRRTTAASLNTPWRYLHGGGDFDHSYFHAGSYQGSDPYQPLIE
    SISLLLIEQAANRLPEPAGAAIRLKMGELLENCSSHGPVALCQSNCLLHDTRDSRSGVKQFYAEAAGDRRADILNPVSYA
    DPLLSHIPAEFRFRGYGCGSPILDAALQAGERVVDLGSGTGVECFIAARQVGAEGQVTGVDMLDPMLALANRGAEQVRAT
    LGFDNLRFVKGYLEALPLETGSVDVLVSNCVLNLSPDKRRTFAEICRVLAPGGRMVVADVVCEDQPPAAILNDDELRGE
    C
    IAGAMTHKDLAGIVAESGLWRYRIIRRLPYRTVQGHPFYSLTFVAEKPAGLHDLCTEKVIYPGPAEALKLSGQTWLRAGQ
    PALIAKQEAELFGDQLWRIDSFGFVDNVAMSGGSCCSQPPEAHQQSQPAKPAEPQHSSGCLVCSAPLVYTAAPQEMTCHY
    CGAGVSSHAACQNGHFVCDLCHIGDSLQRLEQLCSNSGTANPMELFLQIRNHPSFPLHGPQYHALVPGVFLAALRNAGHP
    VSDEQIRTAISRGAEVPGGSCGFMGVCGAASGIGIAFSVLLEATPLKVSQRQIVQQVVQQVLADIASQQAARCCQRDCWL
    ALRRGLLLAGQMFALPLEELKPLACRQLDRNSECSGNSCPLHPASIMQMHLSNLQEVLSKGYMQVEQLMQVVLQPTDVT

    >gi|189424011|ref|YP_001951188.1| Succinate dehydrogenase [Geobacter lovleyi SZ]
    MKRLWSSIASAALLVACALPAYAEKTMETDIAVVGGGLSGLSAATQATQLGAKVVVLEKQAKVGGTGLFCEGVFAAESKL
    QKRIGINVTKDFAYKLIMEYSHWKANSALAKHFVDRSAETVDWLDSMGIKIEYIGVGGHGGPLTWHVIAPGPDYLSGKNK
    KDYHCERIINVFSKYVTDKGGQILLQTPGTDLIMDNGKVVGVWAKDKSGEKIRINAKAVVIATGGFSSNKEMMKKYYPEY
    PDITPVGNIGKDGDGITMGIKAGADLEGMNTVQGYRPGLPGFHPADQMIALAVQPYFWVTPRGERYTDESNIVFWPYSNN
    SLVRVGGVAYAIYDDATRKMAVEQGIEMPLGEWVLAGTKLVKWEDAFNKELARKRGNVFKADTIEELAKQLNMKPEVLQA
    SVARMNTAADTRKDAEFGKDPKFLRKVATGPFYATKLTPRHLGTLGGMKVTANNQVVKTSGDPIPGLYAVGTDSGGMYGD
    SYDLLLGGGTAGYAINSGRFAAEHAVKYIKQ

    >gi|189424069|ref|YP_001951246.1| fumarate reductase/succinate dehydrogenase flavoprotein domain protein [Geobacter lovleyi SZ]
    MIDTLILQKVSKKTIRNVMLFAIMLVMVSPTVILAAEKGQQHDAIVVGAGIAGLSASWELAQKGFDVAVIEMQPLYGGTA
    TMSEGAL
    CIVGTPEQAKAGIIDSPQIAFKDFMTYGSDQGGPGPDVEWVRYYTNKSRHEIYDWLTGLGVTFEKSAVLMPGN
    SVPRWHKVIGKGRGLVEPIHRACKQSSRVTFFYGHKALSLIRGKSGRISGIRAQRLKDNVSIDYLAPVVILATGGFQGNM
    KMVQKYWPERQPFPERILKGAGINATGSGHEMAQAVGARLFNMQYQWNYATGLQSPSDITGSRGLNAFSQQSIWVNKAGS
    RFVNESQDTRMTFPELIKQPGGTYWAIFDSAARNSFFISGWSRESIEEGLFNNQQNSRFVKSAPTIAELAVAAGLPPQIL
    TETVNHWNAMVTAGSDTDFGRIGCCRTPWSNPNRIERAPFYAVQFYPLARKSMGGVSIDRSCRVLDDSGKHIPGLYAAGE
    LTGLAGVNGKASLEGTFLGTSIMTGRVAGRAAAAELSGQTKP

    >gi|189424119|ref|YP_001951296.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Geobacter lovleyi SZ]
    MTLIDNKAPDFDLEGSDGRRHRLQDYAGRRLLLFFYPRDNTSGCTKEAVGFRDLKPEFEKLGFVILGISRDSLASHQRFI
    DNHELNMVLLSDPDARVMKAYHAFGEKMMYGKQVSGVIRSTVLICADGIIRKHWTKVAKAEQHPAQVLEYIKDFHCE

    >gi|189424226|ref|YP_001951403.1| Rhodanese domain protein [Geobacter lovleyi SZ]
    MKLKIFALALITLFSMNSAALAISLVDADWLKKNMNNKNVKIMDVADKPNAFDKEHIPGAIQVKRYLDLSNTDRYPATAY
    PTKLQFEKFLSESGIENGSVIVAYDDKSSLFATRLLFLLEMFGHDPAKLKLLNGGIVNWKKLGNKVTDDVTKIKKSKYKI
    AKTKTDMTVTWSDIYRDVAQGAKPEVLLLDSRPENEFKAQNIRAIRGGYLPKAVLVTSSDANEKDSQLFKSLEDIKKLYE
    AKDVNGDRTIYTY
    CHSGDRSAHTYVILKYMLGYKNVKVYEGGWVEWANMVALPMAGQIWLWDAPKPVKKEEPKK

    >gi|189424235|ref|YP_001951412.1| protein of unknown function DUF395 YeeE/YedE [Geobacter lovleyi SZ]
    MTITLSPWVTIGFNLVIGLALGNMLYRGDFCIAGILRDQFLFQDRTLLRPLLLAVGLTLSLFTLARYIGLVSATPPPTFG
    LPSIASMTGGWLFGIGMVLAGG
    CVISTLYKMGSGNLSHGVAFVGIVTGSVFYAELQPLFKELLQTGGASENKLLIQHWPL
    TAETINIIVILLTFFFALRWYRGGLLQIVAAANGYLQPWKIAIGLALLNLSAYLINGWPLGISTAYLRIGLWLESQLFSA
    HVLHLEQLLQQTGLTTTSPTGTMSDPTLLTELPFMAGILGGALLTSLFLKEFRVYGLPPWRQGLTAFTGGILIALGARLA
    NG
    CNIKFLLGGLPLLSIEALLFVMSMLLGAWHGAQILPLVITQTKDSG

    >gi|189424248|ref|YP_001951425.1| hypothetical protein Glov_1183 [Geobacter lovleyi SZ]
    MRGAPYYFHGAQMERKYLELIGIAASIGSECPDCLDWHLNAAREAGATDNELKETIRMSQRVRTVTLDSHTRFTAKVMEL
    LKQLPNEATAEGTADHTTQGA

    >gi|189424249|ref|YP_001951426.1| redox-active disulfide protein 2 [Geobacter lovleyi SZ]
    MKLEVLGTGCAKCKTLLENVKKAVETSGKEAEIVKVEDIPSIMKYGVMSTPALVKDGKVLFSGKLATPEEIAGML

    >gi|189424250|ref|YP_001951427.1| Thioredoxin domain [Geobacter lovleyi SZ]
    MRIVLTLLCLLLTSSAFAELPSGNQFTIQAALASGKPTLVDFGARSCIPCKKMAPILEQLEKEYKGRANVIFVDVWQDNK
    IGGNYRVQMIPTQIFFDANGKESGRHIGFLDRQPIIDTFKKLGVK

    >gi|189424253|ref|YP_001951430.1| Rhodanese domain protein [Geobacter lovleyi SZ]
    MQRTFVLILLVLGLFVLPAAAAEEVFDRFLAGFDYDTRADMKTDSKRLIKLLEEKKAVLVDIRFPEETRAWRMGFGLFIP
    LNELPKRLAELPKDKIIVTA
    CPHKDRSSIAMAYLRTKGYNARYLTDGLIGLAENLRGDTAKDFLEDAGLAPAGKK

    >gi|189424270|ref|YP_001951447.1| rhodanese-like protein [Geobacter lovleyi SZ]
    MMQRFVMTRRSMLFSLAGLLLTTALTLWGCGGGGGTSSYTDPNASITTTKTATALIEPATLKQWMDEGKVNNPDPATRDR
    VVIVSVGTPANYATAHIPGSQLLDSGALNLTRLEGVTAIGTMVMDGPTIDGHIQRLGINQYTTIVIAPTGTDTAMNASRV
    YFTLRYWGFPKERVKILNGGQTAWTTAAATWPAAYAVTATVPTIPASTFSVKNLYNGTTTTNFNLRYSIGEMINLVDKIN
    AGTISTGATGVAIMDERGGVNVTTHPYIANAATYNNGTTTVLDSHMNYYGTVAGTFKDTAALTANLANFGITANKTMTYL
    Y
    CASGMRASTAFFVLDGILGWPVTLYDGSWGQWSGYTSLSTSPVATAWRTNVNTSATVAINRTANASLYDPAGTGNVKPA
    TLTIDPIANAIYSTITDPRANQMLNEDKAYFTSGGTTTGGGGGGGTGSGC

    >gi|189424311|ref|YP_001951488.1| peptide methionine sulfoxide reductase [Geobacter lovleyi SZ]
    MEKATFAAGCFWGVEEAFYDEAGVVATRVGYTGGTLENPTYQQVCSGTSGHAEAVEVSFDPAKISYDRLLKIFWQAHDPT
    QLNRQGPDVGSQYRSAIFYHSEEQRLQAESSREAVDHSGRYQRSVVTEVVPAGTFWQAEEYHQQYHRKNGGGCGF

    >gi|189424635|ref|YP_001951812.1| protein of unknown function DUF395 YeeE/YedE [Geobacter lovleyi SZ]
    MSLVHVFMLSGGLLLGAAAGFVMHRSGYCVAGMFRDLFMFRSTLLLKSLILLLAVSLPLFELIHLSGFVALPFPFFGPPS
    LANLLGGLLFGIGMVLAGG
    CVVGTLYKLGSGSFPALLALAGLVGGSTLYAFFHPTWAVFAKAVAFPTRAVTLSQLLLQPP
    WLLVVVLEVLLIPLLFVWFRQRRMERPAVVASYLQPWKAALLLALIGTASVLLVGMPLGITTSYSKMGAFLLQLVMPDVA
    AGVSYFKLLPLNYTPPLGGGVLVGGPGAAFDGVALVQYPLIIGIIAGSALSALLLGEWRMHFGLPWRQAVSVLLGGVIMG
    LASRMAPACNIWHLFGGLPILALQSMLFLLGLLPGAWLGGLLLTHWVMPADIE

    >gi|189424638|ref|YP_001951815.1| protein of unknown function DUF255 [Geobacter lovleyi SZ]
    MTNHELQTLLALDRSTLPEDGRPEFNRLIFSRSPYLLQHSRNPVDWREWGPAAQKEAQERNLPLFVSIGYATCHWCHVMA
    HESFEDDEVADILNHAFVPVKVDREERPDLDEFCMAACQSLTNSGGWPLNCFLKPDGTPFYALTYLPKEPKRGMPGFLEL
    LENIARVWQHKQEAVERNARSLMEALGQMAAAPVQTTAPDLKELADSAVATLRKIHDPRYHGFGKAPKFPMPPYLLFLLG
    RDNRIEQELALNTLQAMRQGGIWDQLGGGIHRYSTDQHWLVPHFEKMLYDQALVAYTALKAYALTKENRYLEMADNLLEF
    VLAELTAPEGGFYCGLDADSEGREGACYVWKKQELEQILGDQAAFFCQYYGVTEQGNFEEPGENVLFQALPAAEEPAAIK
    AAGQKLLQVRAMRQQPLRDLKVLSGWNGLMIAALARGAALTNNRRWLEAARRAATFISSALTRADGRLLRSWCGTPSTIA
    GFLEDYAFLGWGYLELFKAGGDAADLATAEQLCRDALHLFRTEDERLVTAGNDQEQLPLALSDNHDGVIPSGPAALVMNL
    VALAKCTAKPEWEKRTDEVLSSVLPSLVRQPVSGLWLLEAALKRPSQNVT

    >gi|189424670|ref|YP_001951847.1| dihydrolipoamide dehydrogenase [Geobacter lovleyi SZ]
    MSEQFDLIVIGSGPGGYVAAIRASQLGMKVAVVEKRATLGGVCLNEGCIPSKALLDSSEHFALARDKFALHGIEIDPPRL
    NLTAMLARKDELVKKLTDGVAYLFKKNKITLLSGSASLRGLDETGLQQVAVEQAFHLNFPNGDQQPVEVPQLLRAPKVLL
    ATGSEPLPLPGIPFDGELVVSAREALAFDQVPDHLIVAGGGYIGLELGSVWRRLGARVTVMEALQGIVPSCDRQVADYLQ
    RALKKQGVEFRLNTRVTGLRRLGNKAMIQYGSGLESGELDCDRLLVAIGRRPLLAGLGAEEVGIVCDQTGRIQVDENYQT
    TCAGIYAIGDLVPGPMLAHKASEEGVVCVERMQGKAAVVEYDYLPGVVYTWPEAASVGMTEEQLKENSVSYKSGKFNFLG
    NGRARAMDETEGFVKVLAHAETDRLLGVHIVGPRASDMIAEAVTAMSFMGTARDLGMQFHAHPTLSEALKEAALDIHKEA
    IHG

    >gi|189424755|ref|YP_001951932.1| Peroxiredoxin [Geobacter lovleyi SZ]
    METGQGCVKPAAGPLAAASPPPTTAQLAKEEQTMTVARVGHQAPDFEANVYYNGGFQTMKLSDYKGKWIVLCFYPGDFTF
    V
    CPTELTAVAVKHAELKELGVESFAASTDSRFVHKIWQAEELSKMVPGGVPFPMIADASGLIGQAYGVFEPAAGVDIRGR
    FIIDPDFNIRAMEVLTPEVGRSVNELIRQIKAFQHVRATGEVMPAGWTPGKPTLKPGPDLAGNVWKEWKPEMAF

    >gi|189425009|ref|YP_001952186.1| HesB/YadR/YfhF-family protein [Geobacter lovleyi SZ]
    MKITDAAKTALEPILAQNPGKLLRVVFEGFGCGGPRLGLALDEPGENDTRMTLNGIELLAEKSLNSFLDGQVIDFVNSGM
    REGFVISPEFGSSCS

    >gi|189425039|ref|YP_001952216.1| peptide methionine sulfoxide reductase [Geobacter lovleyi SZ]
    MWKIIYRCMLVCLILISCLRSTDAIAATTERAIFAGGCFWCMEQPFDTLPGVLSVMPGYTGGTKPNPTYQDVSAGGTGHA
    EAVEIIFDPSKISYQKLLQVFWHNIDPTVTDRQFCDTGHQYRAAIFHLSEQQQKQALASKENINKIKRFKEPVLTEIVPA
    GTFYPAEEYHRQYYKKNPFRYRFYRANCGRDKRLKELWGAVAGH

    >gi|189425040|ref|YP_001952217.1| methionine-R-sulfoxide reductase [Geobacter lovleyi SZ]
    MKIMPLLVGAILLPLLLACSNSTTSTATTAAKTASEATVKTIKLYSVADKGYIMSVKVIKTEEEWKKLLTPQQYNVTREK
    GTEAPFSGATWNTHEKGIYRCIGCGNDLFSSEHKFDSGTGWPSFWQAIAPENVTEKPDNSLFMRRTEVVCSRCDAHLGHV
    FNDGPKPTGLRY
    CMNSAALQFVKTP

    >gi|189425041|ref|YP_001952218.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Geobacter lovleyi SZ]
    MPAAPLILPDTPQNRQLSENVHPCHWVNPEPAERYNLVVIGAGTAGLICAAGAAGLGAKVALVERNLMGGDCLNTGCVPS
    KALIRAARAVYDARTVSEFGMQDSNLAGFDFKVAMERMQRLRAGISRHDSATRFRDELGVDLFIGEACFSGPDSVHVDGK
    TLQFKKAAICTGARAAAPPVPGLAEAGYLTNETVFSLTELPLHLAVIGAGPIGCELAQTFCRFGSKVTLIELAPAILGRE
    DRDAAAILQDALIREGIDLQLGVKISAVESRDDQKILHLEKDGHAIKITVDQILVGVGRAPNIEELALQTAGVAFDRSGV
    KVNDQLQTTNANIYAAGDVCSAYKFTHMADAQARILLANALFKGRQKVSDLIVPWCTYTDPEIAHVGMSEQDATAKGINV
    TTLTIPLSDIDRAVLDGETEGFARVHLHKDTDRILGATIVARHAGEMINELTLAITNNLGLGAIARTIHPYPTQAEVIKK
    LADSYNRTRLTPFLTRLLSGWLKWQRG

    >gi|189425044|ref|YP_001952221.1| Methyltransferase type 11 [Geobacter lovleyi SZ]
    MTFDPPRWTRFQVDNTAVWLCPDRPTWFVPTAHGDRLLQQMPTDTASQDLATATFLQRLPDPPANSYQGRQTLLGTTPKL
    RELWLHITDRCNLSCSHCLFSSGPDQGRQLSLQQLKQHIDDAAAQGCRLFALTGGEPLVHPDFAELIGHILAIPDSRIAV
    LTNGLSVADKLAADWPRQRIHLQISLDGRPEHHDLLRGAGSFKQLEQQLTWLQQQHWHFTLSCCVTKENARDLTWLVDYA
    ADQGAAALHLMWHFIRGRGSVAQHLQPPELLQPVLAALLRAEQRGITIDNIENLKAQIFSAPGTIHDGSSAGWEAGAIGP
    DNQLYPSAATIGLAELATPLDQGLVQAWQQSPILARIRQTSVAGLSDPWRFLLGGGDLDHCYHHNGSFVGTDPYQPLFEQ
    LSLLLIKQAANRLPEAAQPGLRLKMGELLVSCDSHGPVALCHTNCLLTLEPFADSRSRVGSYYAEAVGDKRLEILNPVHY
    DENMMQHIPAAFRFRGYGCGSPVLDACLRPGEQMVDLGCGSGVECFIAARLVGKDGMVTGIDMLEPMLDLAQKGAIEVQE
    HLGYNNLQFLKGFLESLPVADNSQDLVVSNCVLNLSTDKRSTFSEILRILKPGGRLVAADVVCETEPDAAILNDENLRGE
    CISGALTQKDLLGILDESGFTGFSVIKRLPYRVVNNHPFFSLTFCVRKPENSSETVLILYPGPAAGLLAPSGAWLQPGQV
    NRISRQDADLLGTQVWHLDSHGFVTNVTIEAGANCSRAPEGRTRTAAQPPSRHDSGCLVCGAPLVYHPFEQQIACHFCGK
    TLSANACCEQGHFVCDSCHTDDALSLIEHLCTTSGVSDPIQLMKEIRRHPSIPLHGPQYHALVPGVLLAGLRAAGHPVTT
    EQLFAAIRRGGEVGGGSCGFMGICGAATGTGIAFSVLLEATPLKAARRQTVQQVVQQVLAEIAGYEAARCCQRDCWIALR
    TGMRLAAELFSLKLPAVEPFCCTQMARNHECLGLDCPLWP

    >gi|189425106|ref|YP_001952283.1| methylated-DNA/protein-cysteine methyltransferase [Geobacter lovleyi SZ]
    MCASYVSRYITGQGVGAVLATDLGICRVWLPGDDLSDVDRIAASESELTRKAAQQLEQYFQGCLQQFDLPVDISSLTLFQ
    QRVLQLTMQIPYGNSRTYGDLAAEAGSPGAARAVGGALGANPVPVIIP
    CHRVVASNGALTGYSATGGIMMKKFLLSLEGV
    DFRAIKKI

    >gi|189425117|ref|YP_001952294.1| Rhodanese domain protein [Geobacter lovleyi SZ]
    MSIRTRLAASFVTLFAVALLAGCETGPEVKSEAPTPQTVATAAPKEGAKKTGPVLPKGVTVISTDELKALIAKGPEAGNY
    LLFDSRPASRFHAATIPTSIMLPDTEMVKLDKEGKAHPLLGQDKNKLHIFWCGGPT
    CPFSIKAAGLAVKYGYTNVKVFSG
    GDPAWAKAEQPFISSPKHVKEANILLLDLRSADKFAAGHIPRALNLPAANLDKYQENNWPSFKGAAIVFYSDNQADIDKA
    LELMRDYGMSKATYFPGGLANWQKLGNPVETGPKPAPANLVFVRVLGPQDITIPDFIKALDNPNVVILDVRNPTERATGQ
    FKGSIHIPSEEIGTRYSEIPKDKLVIVH
    CSTGIRAGIAYETLKAKGFTNLKALNANVKFENGKYKITE

    >gi|189425216|ref|YP_001952393.1| thiol:disulfide interchange protein DsbC [Geobacter lovleyi SZ]
    MIRTTLTTLSLVLLFAVSSFAMSPAKDGCGTQECSKCHSLSVKEATDLLSFAGVTVKSVKPAPSHGMHEVLFQKDGGVGI
    VFIDYGKKHLIQGVIIDLKTKEPVAAHEKDIPKPKQFSGLDPKLIPVQYAMVMGNPKAAKKLYVFTDPD
    CPYCRTLHPEL
    QKLEKMMPDLAIHIMLYPLQQLHPQAYDKARTVLSTKSRKNLDLAFEGKELPKPKGDAGKAGVDAVIQFAQEQGINGTPM
    VLLPNGKPYQGPRDAESIKKAIEGM

    >gi|189425296|ref|YP_001952473.1| hypothetical protein Glov_2237 [Geobacter lovleyi SZ]
    MKNLLLYLLFILAMTAFCPHQAEAVQPRTPQLLYPSSKRIVIFVADGCGYCTKAESYFATRNIPFESRDIQKSHQFYREW
    HDHFNGDIVPLIVFDNGRQVVDSFDPRAIKRALKVIGITSRNGKKP

    >gi|189425335|ref|YP_001952512.1| Redoxin domain protein [Geobacter lovleyi SZ]
    MKKLLVLLCCAVALTAGCSKDKSAAPSKAPAEKSQAPEISVVSLDNQQLTLAALKGKVVLLNFWATWCPPCREEIPSMIK
    LNTFMAGKPFQMVCVSVDEGGKQAVQEFLKNSGYSLPAYTDPSGQVAKTYGITGVPETFVIDKNGLIVKKVIGGLDWNSP
    EVIAFLEGLMK

    >gi|189425643|ref|YP_001952820.1| hypothetical protein Glov_2587 [Geobacter lovleyi SZ]
    MFRIVILLIFLVWVPSASAAADNSWLKKIPLHDAIRVGTGNKIVVEISDPDCRFSRRMARYWAMRKDVTRYIFLIALKNH
    PDAAQKAHYILSSPDRAAAYQQVFSGSLDFDEKLAARRYNDHGALKRHQAVAAKLDVVGTPTYFLSGARVNGAKVKELEL
    LLGGKSIPFDVEGESPYSQ

    >gi|189425817|ref|YP_001952994.1| selenide, water dikinase [Geobacter lovleyi SZ]
    MTNKKIKLTQTVKAAGCAAKLGPEGLADALAGLNRPADPRLIVGPETSDDGGVYCLTPEIALIESCDVITPPADAPRAFG
    RIAAANALSDIYAMGGRPLTAMNLAFFPACSLQPEVLGEVLAGGQDALNEAGCCLVGGHTVEDDELKYGLSVTGTVHPEQ
    VLRNSTARPGDCLLLTKPLGSGILSTAVKGEMATVEQEAEAVAWMSLLNRAAAELMLRYTPSACTDITGFGLIGHSCEMA
    LGSGVTIRLYLDAVPLMQGVTDQVADGMVPAGCYRNRSYYLSRIDAGDCDPERLLPLFDPQTSGGLLIALQPGAAALFQA
    EAAENSIFCVLIGDVLPRAELPVIVV

    >gi|189425973|ref|YP_001953150.1| heavy metal translocating P-type ATPase [Geobacter lovleyi SZ]
    MTKLSLQITGMSCVNCAGRIEREVSALAGVESAAVNFAIAQLTASFDETVISADNIMEKVKSLGYGVVKPEPPGELTFSI
    TGLH
    CANCVARLEKILREQPGISTAVVNLVAATGFVRFDPALLDKGAIFRIVIDAGYTPAEPEAGEEAEAEELAGQRNWF
    LFSLALSLPIMATMTLHHLRSVGWMNLILATVIQFSAGLAFYRGAWSALKSKSSNMDVLVALGTSAAWGYSLLAFFGLLG
    DSHEVFFETSAWLITFIRLGKYLEARARGKAGEALKKLLHLQADKARLVTAEGEKEVPASVIRVGDLVAVRPGETIPVDG
    EVVEGTSSVDEAMVTGESLPVAKQAGDTVTGATINKNGRLIIKATRIGEETLLAQIVRMVRDAQGDKAPIQRFADAVSAW
    FVPAVIVLALLTFVVWLLILKAPFLVAFKFGVAVVVIACPCAMGLATPTAIMVGSGVALSRGILVKKGSALETIAKLQVM
    LLDKTGTLTSGKLTMSDLVTAPGVDEQRLLECLAAAEASSSHPLAQAAVAAAKERGCIPGEVSDFHEAEGHGVTCSYNGI
    RLAVGNQRLMDAEKVKTAHLEAEAEELAAEGNSLMYVAAGQVLVGIAAFSDTIKPTSCQAVAELKQLGIRTVMITGDHAA
    VAATVAAQAGVDSFEAQVLPGRKQELVKEWQQKGQVVGMTGDGINDAPALAAADIGIAIGGGTDVAKETGDIVLIKDDLL
    DVVRAIKVGRATLSKVKQNLFWALFYNVIGIPVAAGLFAGYGIFLKAEFAGLAMAFSSVSVVLNSLFLKRIANRL

    >gi|189426009|ref|YP_001953186.1| Redoxin domain protein [Geobacter lovleyi SZ]
    MNERSGSITFKGNPMTLLGPELKVGDKAPDFLTVDTTLAPVSLNSHAGKIRVLSAVPSLDTPVCDTETRRFNQEAAGLPE
    NVVVLTISLDLPFAQKRWCGAAGIDRVITLSDYRDRSFGLNYGVLIKELLLLSRCIFVVDAEGIIRYIQQVPEVTSEPDY
    AAVLDAVKTLL

    >gi|189426019|ref|YP_001953196.1| protein of unknown function DUF395 YeeE/YedE [Geobacter lovleyi SZ]
    MTTDGKPWSPYLAGALAGLVSIGSVWFAGKYFGASTTFVKTAGMLEQLFSPERVAQMEYFIKEVPKVDWQSMFLVGIFGG
    ALIASLTDGSFRVQKIPALWEKRFGASLPKRSILAFMGGTIAMFGARLADG
    CPSGHGLSGSLQLALSGFISLACFFIGGI
    IMARMLYRGGDQ

    >gi|189426399|ref|YP_001953576.1| thioredoxin reductase [Geobacter lovleyi SZ]
    MAEMQHHRLIILGSGPAGYTAAVYAARANLNPVLIAGLQPGGQLTTTTEVDNWPGDFEGVQGPDLMERMRQHAERFNTQI
    IYDTIVSTDLTQRPFILQGDGGRYSCDALIIATGASARYLGLPSEEAFKGKGVSA
    CATCDGFFYRNKPVAVIGGGNTAVE
    EALYLANIASHVTVVHRRDQFRSEKILADKLKARAAEGKVTIEWFHVLDEVLGDAMGVTGMRIKDVRDGSTKEIKLDGVF
    VAIGHSPNTAIFDGQLEMKDGYLRTKGGSDGFATQTSIPGIFAAGDVQDYTYRQAITSAGTGCMAALDAERYLDGLGG

    >gi|189426522|ref|YP_001953699.1| OsmC family protein [Geobacter lovleyi SZ]
    MKIDISFEGGQKVAASFPDGLQMLTDQPGADGAPGEAPTPFAYFLGSIGTCAGIYVLEFCKARQIPTDRVSLTQHIEFEL
    DQQGKRRVSKVGLTINLPPEFPERYQKAIVKAAELCSVKKAIMHPPEFVVDYQVV

    >gi|189426743|ref|YP_001953919.1| alkylhydroperoxidase (AhpD family core domain protein) [Geobacter lovleyi SZ]
    MQTFQQIYQRAAKRKGGEETLRKMVPDNAEELTVVWQTINVEHNCTYCVPAHTGVAKMMKVDPALTEALRNQEPMPTDKL
    QVLQNTTLAVVRKRGELSKDEVEAFYAAGYGQRQLLEIILGLSQKVISNYVNHIAETPIDRAFEKFAWEKK