Geobacter bemidjiensis Bem uid58749

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|197116430|ref|YP_002136857.1| heterodisulfide reductase subunit A [Geobacter bemidjiensis Bem]
    MSRIGVFVCHCGENISRTVDVEQVARAAGKISGVAYACDYKYMCSDPGQNLLKKAVSEHKLDGVVVAACSPRMHEKTFRK
    AASAAGLNPYLCDMANIREHCSWVHEDKKLATSKASDIVKLMVERVKKGKSLAPITVPVTKRALVIGGGIAGIQAALDIA
    DAGHQVVLVEREPSIGGHMAQLSETFPTLDCSQ
    CIMTPKMVDVANHPNITLHTFSEVEKVEGYIGNFQVTLKHKARSVNE
    SKCTGCGICMTKCPKKKIPNEFDQGHGLRTAIYVPFPQAVPNTPVIDRENCTMFQSGKCGVCAKVCGPGAVDYQQEDRFS
    VEAVGAVVVATGFKLYSIDRKPEDSPIQGYGEFGYGAIPDVIDGMTFERLASASGPTGGKILRPSDGKEPKQVVFIQCVG
    SRAREKGISYCSKVCCMYTAKHTMLYHHKVHDGQAYVFFMDARTPGKGYDEFWRRAVEEEEAVYIRGMVSRLYQKGEKIV
    VMGSDIQVGVQVEIEADLVVLATAVQAQDGADQLAQKLGISYDKYNFYSEAHAKLKPVECATAGIYLAGACQGPKDIPDT
    VSQASAAAAKVMTLFSKDQLERDPVVAKVNEKYCVGCLACKKVCPYGAVEEKEIRDRQGNLVKVVAYVNPGVCGGCGTCQ
    ATCPSKSVELDGYTDEQIMAMIESL

    >gi|197116489|ref|YP_002136916.1| rhodanese homology domain pair protein [Geobacter bemidjiensis Bem]
    MAGKHLVRLLSVLALIISLAGTSWAKQQQGYKGYARGSALITAKELKQLIDAKDKKLVIIAAENDVEYRLGHIPGSFQVD
    RPAYEAPAATQNGVTGNLIDAAGFTKLAQELGINKDSKVVVYDTKYDATRLWWAFLYYGKGDVRVLDGGIKAWKDAGYDT
    AILAPDAARAGAFVAKVALPRSRVETPEILALKDPAKGQLWDNRDRKEYCGEELKKGAYRKGRIPWGKHSDWAIFKKKEN
    AGEWLTAAEAQAILKKLGVDGKKDQYFF
    CQSGVRSTQAMFTFYLLGYPLNKLHNYDSSWIGWSKDASLPIETGCDLNPAV
    ATAR

    >gi|197116554|ref|YP_002136981.1| peroxiredoxin [Geobacter bemidjiensis Bem]
    MSLTTLVTKEAPDFTAQAVLPDNSFAELTLSKYRGKYVVLFFYPLDFTFVCPSEILAFDKRVEDFKAKNCEVIGVSVDSR
    FTHLAWKNTSVENGGIGNVQYPLVEDLDKSIARSYGILLNESVALRGLFLIDTKGVIRHSVINDLPLGRSVGEALRMLDA
    LQFVETHGGEVCPANWQEGEESMKASTEGVAEYLKKKHGK

    >gi|197116621|ref|YP_002137048.1| peroxiredoxin [Geobacter bemidjiensis Bem]
    MFLEGQPAPNFSLQGSDAKTHTLKDYAGRILVLFFYPRDNTPGCTAEAVGFAKLQPLFEQLGAVLVGVSKDSLKSHAKFS
    ADFKLPFTLLSDPDASVMKAYGAYGEKQQYGKTTIGSIRSTVVISPDGMVIKHWPKIPKASEHPDKVLDFFKMLAKGR

    >gi|197116663|ref|YP_002137090.1| peptide methionine sulfoxide reductase (R-isomer-specific) [Geobacter bemidjiensis Bem]
    MRKATFFAGLLTVLVASVLVVLESGKDSAIVNAASRIKVFSAEKGTYVMSDEIVKSKDEWKKILTPEQYHVLREKGTERA
    FSGKYATSHEHGIYRCAGCGLDLFRSEDKFESGTGWPSFTAPIAKENVKTEVDRSLFSTRTEILCRRCGGHLGHVFNDGP
    KPTGLRY
    CMNSAALQFVATK

    >gi|197116664|ref|YP_002137091.1| peptide methionine sulfoxide reductase (S-isomer-specific) [Geobacter bemidjiensis Bem]
    MKRIRFAILTLTALFCAAGPTLAASATAPGGKGTQSAGHLEKATFAGGCFWCMEHPFDELPGVVSVTSGYTGGHKINPTY
    EEVSSGTTGHAESIQVVYDPAKIGYDKLLDVFWHNIDPLAKDRQFCDSGEQYRSAIFYHNEEQQRLALQSKKALESSKRF
    KEPIATQIVAAGVFYPAEEYHQHYYKKNPIRYFYYRSSCGRDRRLKELWGR

    >gi|197116801|ref|YP_002137228.1| thioredoxin-like protein disulfide reductase [Geobacter bemidjiensis Bem]
    MKRQIPSKKFAAKIIPLALAGLLLSTQPAAAILQKGEAAPPIKLVTTSGQPITLNNYKGYVLVMDFFATWCIPCKESIPH
    MNALRQKYGKQGLQVLGVSVDEGSDREVRSFIGEKRISYPVAIAGEEMQTDYGLRSIPTVYVINKRGVVAEKFQGFSDQT
    AKAMEDTIKRLLAE

    >gi|197116802|ref|YP_002137229.1| thioredoxin [Geobacter bemidjiensis Bem]
    MASENVHTFTDDNFEKEVLQSNIPVLVDFWATWCAPCKAIAPLIDTIASEYDGRIKVGKVNVDDNPGTPAKYGVRGIPTV
    ILLKDGKVVDQVVGAIPKAQLEALIKKAL

    >gi|197116855|ref|YP_002137282.1| mercuric reductase [Geobacter bemidjiensis Bem]
    MSDQFVFQPDTAENRELEANVCPKSWINPVPSGRYNLVVVGAGTAGLVCAAGAASLGARVALVERLALGGDCLNVGCVPS
    KALIRASRAVFDARHSGGFGVVGGDALLADFAAALQRMRRLRAGISRHDSALRFRDELGVDVYLGQGTFTAPDTLQVEGA
    ALHFAKAALCTGARAAIPPVPGLEEAGCLTNETVFSLTSLPARLAVIGSGPVGCELAQAFARFGSKVTLVERGSGILGRE
    DRDAAAILETAFRREGIELELGAKLVRAWSSGSEKRLLLERDGVGFEIAVDAILVGAGRAPNTEGLGLEAAGVEYDKSGV
    KVNDYLQTTNRRIYAAGDICSGYKFTHVADAQARIVIENSLFPGRRKNSSLTVPWCTYTDPEVAHVGMYQADALARGLKV
    ETLTIPFGDVDRAVLDGESEGFARVHLKKGSDVILGATIVARHAGEMIGEVALAINAGLGLSAIGRTIHPYPTQAESLRK
    LADSYNRGRLTPRVKKLMGAWLRWQRE

    >gi|197116973|ref|YP_002137400.1| rhodanese homology domain superfamily protein [Geobacter bemidjiensis Bem]
    MAKTTVSIIEISLIVLVAAALGVFWNRTLLADAWRGAPTRQAAPAQAGEQLPMPVGLAQVKEMLDAGQAVVVDARSAASF
    REEHIAGALPLPLEEAKKRTGKSPLLEKVGKDSVVIAY
    CNGFSCHDSMELAKLLIGSGYGSVYVFEGGLPEWRDAGYPLA
    KGER

    >gi|197117037|ref|YP_002137464.1| dihydrolipoamide dehydrogenase-like protein [Geobacter bemidjiensis Bem]
    MNQQPEIIIIGSGSTAFAAALRAQERGAASIMIERSALGGTCINWGCIPSKTLIHAALFRHEATLGERLGLGALSQALDF
    PLLDSHKLDVVQRLRTTKYLDVLKNVPGLTLVKGMAVFTSPDTVRVGERRLTGSRFLIAAGGVPRVPPIAGLDETPFLTS
    KSALMLKKIPVSLTIIGGGVIALELGQMFLRLGVKVTVLEHGQRVLPAIEAEPALALQDVLASEGMRIILNASVLSACRH
    GDGVRVEALVGGERTCLDSQQLLVAVGTAPATEGLGLEQAGVQVDQRGFIVVDEQMRTSSPGIWAAGDVTGRMQIATVGA
    REGIAAVDNMLETGCNCALDYQTLPMAIFTDPEVGTVGYTEEGARRAGFEVESHTIPASAIAKAHVTGALAGAVKIVAET
    GTGRILGVHLCLHRGADIINEAALAIRCRMTVAELADTLHVYPSMGEGLRLCAQAFSRNLDHLSCCAE

    >gi|308535184|ref|YP_003933680.1| 2-oxoglutarate dehydrogenase complex, E3 protein, dihydrolipoamide dehydrogenase [Geobacter bemidjiensis Bem]
    MAEEIFDLVVIGAGPGGYVAAIRAAQLGMTVAVVEKRGTLGGVCLNEGCIPSKALLDSSELFHLAGHRFSAHGIEVAPPT
    LNLGQMMARKDDVVKKLTDGVTYLFKKNKIRSVNGTARLAGSEAGGVHKVEVQGAQGGEQILAKKVLLATGSDAVELPSL
    PFDGEAVVSAREALSFGKVPEHLLVVGGGYIGLELGSVWLRLGAQVTVVEMLPRLIAGSDGQVAEALLRSLKKQGMRFLL
    GGKVAGVEKREGALLARVEVEGAVQEISCDKVLVAVGRRPLTEGLGLEELGVALGKGRVQVNEEYQTSVPGIYAIGDLIA
    GPMLAHKAMEEGAVCVERMRGEPSQVDYGCVPGVCYTWPEAASVGKTEDALKEEGIPYKSGKYNFMGNGRAKCMDETEGF
    VKVLSDAEGTRLLGVHIFGPRASDMIVEAVTVMSFGGSSEDIALIMHAHPTLSEAMKEAALDVDKRAIHG

    >gi|197117274|ref|YP_002137701.1| glutaredoxin family protein [Geobacter bemidjiensis Bem]
    MRRFMTTALAVFLLLPLSGLAAGQMPQSPLGQHAPAQKYPKVVLFSTSWCPHCKAAKEFFTRNDIPFINRDVELDSDAME
    LLTGKYKSQGVPVIVIGDDAQVLKGFDEGRVRKALDQYRKK

    >gi|197117479|ref|YP_002137906.1| carboxymuconolactone decarboxylase family protein [Geobacter bemidjiensis Bem]
    METYYAPKDLGNFAEIGKDAPELAGKFFAYYNEVFTEGELTEREKALIALAVAHTVQCPYCIDAYTRACLEKGSHLGEMT
    EAVHVATAIRGGASLVHAVQMRKIAEKLSL

    >gi|308535214|ref|YP_002137907.2| radical SAM domain iron-sulfur cluster-binding oxidoreductase , selenocysteine-containing protein [Geobacter bemidjiensis Bem]
    MPMAANPLGGGSFGEALAKHGLQLTREETRVLQVNVGLACDLSCRHCHLEAGPQRVEMMDRDTMDAVIDCARRFRFQSID
    LTGGAPELVPDLDRLVRSLAPLTDRLMVRTNLVALNSGEGSALCELYRELGVALVASLPASNAAQTEAQRGEGVWGRSVD
    ALKRLNTLGYGMPDSPLRLDLVSNPSGAFLPPPQQQAEQKFRSDLSRRHGISFNSLYTFANVPLGRFRSFLERSGNLEGY
    LAQLADGFNPCSVAGLMCRYQLSVDWRGRLFDCDFHLAQGGWYGGEETHISTLAELPAPGTMIPTADHCFACTVGAGFT
    C
    GGNIVA

    >gi|197117715|ref|YP_002138142.1| protein disulfide bond isomerase DsbC/DsbG-like protein [Geobacter bemidjiensis Bem]
    MWFTRRILAACLSAAVLLLLAGVSFAAPISPENAFRSAFPQVPFDSMTPTEIKGVYEVVSGPNIFYYYPEKDLILTGEIV
    GKDLKSRTAERKQALSSQVAAKAMEAVKELPLDKAVKVGDGKKTVIEFTDPD
    CPYCRKASEYFTKRSDVTRYVFFAPLAH
    PAAIKKIEYILSAENKAEAYDAMMLGEEIPASAKPASAEVKKLAQEHLALARKVGIQGTPTFFVKGEQVIGADTKKLDEL
    LK

    >gi|197117726|ref|YP_002138153.1| peroxiredoxin [Geobacter bemidjiensis Bem]
    MRLTSFTLLAALAISIATTPFPLAAAELQSQQVAKVGEPAPDFTLDAWVGTAPGKEFKQINLKELRGKWVVLFFYPMDFT
    FV
    CPTEIKGFNDALAQFEKLDAVVLGASTDSKFSHLAWVKRGDLGAVGYPLLSDIKKEAARKYGCLDEKDGVALRALYII
    DPQGVLQYQVVHNLDVGRSVDETLRVLEALQTGSLCPLGWKPGQKTLGKP

    >gi|197117834|ref|YP_002138261.1| polyferredoxin benzoyl-CoA reductase electron transfer protein [Geobacter bemidjiensis Bem]
    MNTAERNIGDVLIVGGGISGIQAALDLANSGFRVFLVDKSPALGGKMSQLDKTFPTNDCSMCIESPKFIECSRNPNIEII
    TYTEVDRVEGEAGDFKVTLTKKPRYISEEKCTGCNICVDYCPVKIPDPFNQNLSENKAVHIYFSQAVPLVTYVDPETCLY
    LKEGKCQICVGACKTNAIDLHQKPETFQIEVGAIILSPGYSTFDPKLRNDFGYGKMQNVVTSLDFERILCATGPYEGEVL
    RPSDKKHPHKIAWIQCVGSRQVIPGGNNYCSAVCCAYSQKQVILAKDHSPSLEATIFHNDVRAYGKDFERFHQRAEKLPD
    VRFIRSYVTVGREIESSKNVTIRYSTVDQGVKEEEFDMVVLSVGLNPPKDVEALATKFGIELTDQKFCKNNPYNPIETSK
    KGIFVSGAFQGPLDIPESVLTASGADALCGELLSYRRHKLERERVYPDEKDVSKEELKIGVVVCYCGANIGRVVNIPEVI
    EYAATLPNVSWAGENLFACSTENAKQISDAIVAKGLNRVVLAACTPRTHEPLFRDTCREAGLNQYFFEFANIREHCSWVH
    SREKENATEKAKEIVRMAVARAAHLEPLQEFQLPVDHTALVVGGGVAGMTAALNMAEQGFEIYLVEKDDDLGGLARRLHY
    TLEGTEIQPFLEDLVKKVYRHPSIHVWTDSTILDVTGYVGNFTTQVESQGRVREVKHGVSLLATGAAEYKPTEYLYGENE
    NVLTQLELEGEIVAESERVKAAQSVVMIQCVGCRQTDRNYCSRVCCSQAIKNALKLKKINPEIEVQIIFRDIRTYGLKEV
    YYREAANQNVKFIRYEADKKPVVEALGAGFKVTVPDPVLGQVMELEADLVVLAAAVIPSEASQEAGKLFKVSNNPDGFFQ
    EAHVKLRPVDFSADGVFLCGTAHYPKHLTETISQALGAAGRAVGILSRETVTASGSVCDVNENNCVSCGACITACKYGAI
    SFVDTPKGKKAHVEPILCKGDGLCNAKCPTQAIYLKHYTDDAIFAQIDAALH

    >gi|197117922|ref|YP_002138349.1| protein disulfide bond isomerase DsbC/DsbG [Geobacter bemidjiensis Bem]
    MSWFKGLKYLVAAASALAPLALVVPVFAMSGGCGGECASCHSITLQEAGSLLKGIGVVKDVKPAEVRGLYEVTFEQQGNS
    GVAYVDYSKKYIIAGQAFDIASRQPVGANAPAAKQQERLDPKTLSSNDALVMGNPKGKKKLFVFTDPE
    CPYCAKAHGELK
    KLAALEPDLAIYIKLFPLKMHPNAYDKSRVILAAKSLELLENSFAGKALPAATEATPKKPVDETIRFAAAAGINSTPTLV
    LPDGRVLPGFKDAATMQKLLTGTN

    >gi|197118135|ref|YP_002138562.1| hypothetical protein Gbem_1750 [Geobacter bemidjiensis Bem]
    MRNRLVKISLIPSLVLVANVAWAAPELSVEQGTYKFGTVTQGKKVQHSFKIRNSGDAPLQIKKIEVSCGCTAAKPSTSTI
    QPGKSAQIDVVFDSTEFGGKVLKSVTMLTNASKTPSYTFNMEGTVSEELQVTPRQLSLGSVTPGVAKLVTINVTNNGSNS
    IRLIAVNVNSNTLQIKSTIGKSELKPGETGSVNLSILGKSESKILSGYVHIVTSSAKKKEITVPVYGTLAK

    >gi|197118362|ref|YP_002138789.1| thiamin biosynthesis thiocarboxylate synthase [Geobacter bemidjiensis Bem]
    MKLSEEQITRYSRHILLKEVGGKGQKKLLEGRVLIIGAGGLGSPIALYLAAAGVGTIGIADADEVDLSNLQRQVIHTTPD
    VGKAKVLSAKETMLAINPELTVNAYQTWVSAENIAGLIADYDFVIDGTDNFAAKFLINDACVLAGKPYSHGGILQFDGQT
    MTVKPGESPCYRCIFPEPPPKDVIPT
    CSRAGVIGVLPGVLGTLQATEAIKYLLGAGDLLTGRLLTYNALRMRFREIPVKK
    SAKCPICGDHPTITELKDELDAMTVCDLGH

    >gi|197118551|ref|YP_002138978.1| copper/silver-translocating P-type ATPase [Geobacter bemidjiensis Bem]
    MSENNVLQDPVCGMDVREDAPHSATNAGVTYKFCSAGCKEKFEANPESYLTTKTPPAVEAPSAVATAAPEHAEQCEFPLL
    GMN
    CAGCAGRIEKTLSGSPGVARAAVNFATTRATIKYDPQVTSPQALKQVVRDMGYDILETGSGGAETDEAELLEAQSRV
    HEEQYLKNRGKFVVALALTIPVAVLAMAGHLVPSLADAFNFPGRAWVELALTTPVLFWAGREFFTGAWSAAKHRVADMNT
    LVSLGTLSAYLFSVVATVAPQWLSARTAAAGHGHEGAVGVYYEVAAIIVTLILMGRLLEARAKSKTSGAIHALIGLQPKL
    ARVLRDGTEQDIPIAEVQLGDTILVRPGEKVPVDGELVEGSSTVDESMLTGEPLPVRKSEGDTVIGATLNKTGSFRMRAT
    RIGKDTVLQQIVRLVQQAQGTKAPIQRLADLIASYFVPVVISLAIATFVVWFDVSPPDTRLNMAVLTFVSVLIIACPCAL
    GLATPTAIMVGTGRGAQGGILIKGGEALETAHKLTTIVLDKTGTITSGVPSVTDIETANFERQALMQLAAAAEAGSEHPL
    GEAIVRYADENGLERLSARDFNAIPGHGIEATVDGKRVVIGTALLLQKEGIVADTNAAHLLADQAKTPIFVAVDGAYAGI
    IAIADPIKESSAEAVKKLHDLGLEVIMLTGDNRRTADSIARQVGVDRVVAEVLPDAKGEEIKKLQAQGKVVAMVGDGIND
    APALAQADVGIAMGSGTDVAIEAADITLVRGDLNGVISSIALSRATIANIKQNLFFAFVYNIMGIPIAAGVLYPLTGWLL
    SPIIASLAMALSSVSVVTNALRLRGFTIERG

    >gi|197118555|ref|YP_002138982.1| rubredoxin reductase [Geobacter bemidjiensis Bem]
    MKTVIIGGVAAGLSAASQAKRLSPESEVIVLEKSGDVSYAACGMPYNLFFKEKPVEKLYALSLETIRKERGIDYRLRQEV
    TGIDPVGKIVSVTDLATGRSYEERYDFLVYATGNSAIRLTAPGFDDSDVFCFKTLDDTRHVKQFIYDKAPKHAVLVGAGY
    TNLEVADVLTNMKIKPVILEKAPTILPSFCEEARAKVMDKVKERGIELLTGVDIAEKAGGEVRSSAGVFPADLVVVAVGT
    RPNTALFAAAGGELGTAGAAKVDRFLRTNLDSVFAGGDCAEHYVRQLGANSYFPLGPAANKHGRVIGSNVANPDRMMEFW
    GIDQTAVFKFFELSVATTGLNERQLQALGKDYVKVAVDSPTRGEFPGGSTMRVILFCQKGDGLLLGAQIVGEDVVAKRLD
    VLATAIYKQMTVFEIAELDLAYAPPYSPVWDPILIAANVAVKKV

    >gi|308535300|ref|YP_002139164.2| cytochrome c with three rhodanese homology domains, selenocysteine-containing [Geobacter bemidjiensis Bem]
    MDSGIMRKTLTAVSLAALTMTPALWGAEPAPPAKQKDVKSCSVCHKPVDGQMRAFFDQVALKSDSIQLKLDNSFEVVKFD
    VDALKVINGSDPGNVKKSLKEIKKGHEVRVAYTVGSDGMKNISEISIKPAMKVPAEKQVKVEELEKLLSGKTKYTLVDAR
    PPVKFLEGSIPTAINIPLPAFQKNLDKLPKDKGELLVYFCAGVT
    CALSPSSAREAEKAGYTNVKIFHDGMPEWNKRNFTV
    LSAQSLKEGWLDKELSFVLVDLRSEKEAKAGHIKGAVNLTAAGINEALKPFKEQKPPIVLYDANGDGSAEKVAMTLVKAG
    FPGPRVLSGGFAAWQGAKLSVEGGAPATKVAYVPKPKAGAISAAEFKALAKAIPANVVIVDVRGDDEVEKGMIKGAKNIP
    ADEVASRLAEIPKDKELVLH
    CTTGARAEMAYNILKEKGYKARFLDADITVASDGGFRIK

    >gi|197118900|ref|YP_002139327.1| thiol oxidoreductase, DsbA family, FrnE subfamily [Geobacter bemidjiensis Bem]
    MSNVIEIVEFTDPVCTWCWGSEPVLHKLETRYGEQVKVSFIMAGLVKDITAFYDSYNDIGGDPVRSNRQIAKHWLEASQR
    HGMPVKIDGFGLFSRERVSSYPLNIAYKAAQIQDQTMANRFLRRIREASAAEAKLTNTTEVLVELASEVGLDVARFVEDF
    SSGAAQEAFEQDLATTERYNARGFPTFLVRFAGKETLLRGYRRYEDFKAVIGLMTEETIIERPTPASEEAIFAFIRRYGS
    VAPVEIATTFDLTGGELASTLASLVLKQTIVCREAGNGYFVSPKISSAACDTATGICKAV

    >gi|308535316|ref|YP_003933728.1| thioredoxin family protein, selenocysteine-containing protein [Geobacter bemidjiensis Bem]
    MTQYLVKCGSCGASNRIPAEKEGVPGQCGNCHAKLPALYLHPQQLNNGSFDAFISGYSAPVLAEFWAPWCPHCVSFAPAV
    RKVAELLAGEAAVVQINSDESPRLSARFKVRGIPVVHLLHKGISVDQLQGAQSPESVLNWFRRNEKSK

    >gi|197119298|ref|YP_002139725.1| hypothetical protein Gbem_2926 [Geobacter bemidjiensis Bem]
    MKNEHLYTQLPGSDEVPPPPDELFEQARRRRGESYRPRTRHLESGGEAKYMNRLFLESSPYLLQHAHNPVNWFPWGDEAF
    ELAQRLNRPVLVSIGYAT
    CHWCHVMEEESFEDEEVARFLNSNFIAIKVDREERPDVDTIYMTAVHAMGMQGGWPLNVFAT
    PDRKPFYGGTYFPPRDYAGGIGFLSLLQRIRETYRQAPDRVTHAGVQLTEAIRGMLAPMGGEPPQNEISLERVIEAYQER
    FDAKNGGVVGAPKFPSSLPLGLLLRDHLRRGDKNSLFMAQYTLRRMAAGGIYDQAGGGFHRYATDSAWLIPHFEKMLYDN
    ARLAAAYLEGYQATGDPQFAKVAREILRYLQRDMMSPQGAFYSATDADSLTESGHREEGIFFTWTPEELDAVLGTERARV
    VAACYGVTSEGNFEGRSILHREKSMQHLAEELMLPKEELERLLDEAREELYRARQRRPLPLRDEKILASWNGLAISAFAR
    GGLVLNDPALLDTARRAANFILQSMMSQERLCHSYQEGEAKGEGFLDDYAFFIAGLIDLFEATGELPWLKRALEVAQQVQ
    EQFEDSETGGFFMTGPRHEELISREKPAYDGVIPSGNSVMIMNLLRLNALTGEQWMLDQAQRALDAFSIQLASAPTALSE
    MLLALDYLQDLPREIVIVAPQGKREAAGPLLEKLRGVFLPNRALVVFCEGDELEQAGELLPLVREKKADGGLAMAYLCES
    RSCRRPTSDPEEFHRQLQETQSKVRG

    >gi|308535328|ref|YP_002139755.2| peroxiredoxin [Geobacter bemidjiensis Bem]
    MRKSILGTLATSAMVALGSIGAKAPAVGDPAPPFEAPSTAGEIRLTDYLGKKHVVLAFYFADFTPGCTTEVQAFQDGIHR
    FEELGAQVLGVSSDDLDTHAQFAKEHGLSFPLISDQGGAVQKLYAPGRVTFLIDKKGEIRQVQAGQPGIPRLLEELARL

    >gi|308535340|ref|YP_003933739.1| peroxiredoxin-like protein [Geobacter bemidjiensis Bem]
    MERDLRSQIDALEHSYRANSPEKAELLDKAYRDIAACASTAGAPKAGAEAPDFTLPNAVGIPVRLSDALANGPVVLTFYR
    GIW
    CPYCSLQLRAYQKILPQVLHLGASLIAVSPQSPDKTQATLLKNFLQYEVLSDLGNEVARGYGLVYRLPDWVRQLYIS
    LGVNLPDFNADQSWELPLAGTFVIGRDGRIILSYVDSDPRKRLEPQAILDALQARPG

    >gi|197119540|ref|YP_002139967.1| type 11 SAM-dependent methyltransferase [Geobacter bemidjiensis Bem]
    MKLSCCSVFCCSGTVSPYAKGMLDARISQDQIGSVYDRLSSIYDIWGNLAESRARHRAIELAEIEDGQRIVEVAVGTGLA
    FNEIVKRNPNGRNTGIDLSAGMLEKAKNRLKKLSGVHYDLTIGTAFDLPVETGCADLLVNNYMFDLIPYDDMDRVLAEFR
    RVLKSGGRLILVNMTVGESLPSRLYDFVYRLSPKTMGG
    CRGVRLADKLKQHGFTVEVREYHQQMLFPSEVILAHKAR

    >gi|197119702|ref|YP_002140129.1| methylated-DNA-(protein)-cysteine S-methyltransferase [Geobacter bemidjiensis Bem]
    MKKNHVTAIARSIYQAPCGFGVLAANENGLVAHHLPFGSACAGDALELAAALHPEATKESALTRDAAALMARYFAGEKVS
    FDFPLELEGFTPFQVAVYRFVAKIPYGKVLSYLEVAAACGSPKGARAVGGAMARNALPILIP
    CHRVVGASGVMTGFTAPG
    GVASKRELLAMEGAVLSDTGVLQGRCGGGFAQAFHGGD

    >gi|197119749|ref|YP_002140176.1| protein disulfide bond isomerase DsbC/DsbG-like protein [Geobacter bemidjiensis Bem]
    MNKGILQSLKQLAGVAVLAVATFFSTAALAQSDLDLDKAVKVGTGKTMVIEFTDPDCPFCRKAEAYFQKRNDVTRYIFFI
    PLAKHPASKGKVQYILSASDKVKAMCEVTSDDFDTKKLSQITAKGKKLQKEHEEIARANKMTSTPTFVIYGRIIEGFDLK
    KLEPLLK

    >gi|197119774|ref|YP_002140201.1| TlpA family-like protein disulfide reductase lipoprotein [Geobacter bemidjiensis Bem]
    MKRILAVLLLLLAVMASGCSKKEVPAQEGAAAPDFTLSDLSGKQVQLSSLKGKVVLVNFWATWCPPCREEIPSMVKLNQI
    MQGKNFQMLAISIDEGGKQAVQEFFRQNGVTLPALLDTDGSVSRRYGTTGVPETFIVDGKGMIRKKVIGGVEWSSPEVVG
    YLEGLMQQK

    >gi|197119822|ref|YP_002140249.1| selenide, water dikinase, selenocysteine-containing protein [Geobacter bemidjiensis Bem]
    MTDKVRLTTMVQAAGCAAKLGPAGLEEAIHDITRSDDPNLIVGVEGAEDAGIYRIGENLALVETTDIITPLVDDPFTFGR
    IAAANALSDVYAMGGRPVTAMNLAFFPACSLPTSVLAAILAGGSAALKEAGTCLVGGHTVEDDELKFGLAVTGLIDPARV
    VRNCTARPGDLIVITKPLGTGIISTAIKAEMIEPEVEAEATRWMTTLNAKAADLMVACRATAATDVTGFGFIGHACEMAL
    GAKVSFKIELARVPVIPGVPALIDDGMVPAGCYRNRQHYEQHVSGNSGDPLLPLFDPQTSGGLLITFAPDDARTFLSRAG
    KEGLFAACIGEVEPAGGTPIVFV

    >gi|197119891|ref|YP_002140318.1| hypothetical protein Gbem_3529 [Geobacter bemidjiensis Bem]
    MIAWESDMAKALARGKAEQKSVLVEFFSTECIGCKQMEEITFADPAVINFISDHVIPLRIPVTNAAHTSDYRVVWTPTII
    TMDYYGREHQRTVGFLTAEEMVGSALLGMGKVSLDYGQFSEAVIQFNTLLNGCPDCASAPEAVYLRGVARYKTSHAPSAL
    KDIYQQLLAQYPESEWTKRAHPFTLL

    >gi|197119945|ref|YP_002140372.1| protein disulfide reductase lipoprotein [Geobacter bemidjiensis Bem]
    MARLTCCFSLLFAITAAIFSSGCDRKMVKVGEQAPPVSGRDIRGNQVSPETLKGKVVVLYFWTNSCCGETLKEDLEPVYR
    RNKDRGLAVIAVNEFDEEKDLVSIAATNRLSVPIMVDAGSTLAKDFTVFAFPTAFILDRNGTLRQKVLGQISAAKLEQLI
    QQVN

    >gi|197120016|ref|YP_002140443.1| hydrolase [Geobacter bemidjiensis Bem]
    MNTKKVSFPNSRGEQLAARLELPDDEQPIAYAIFAHCFTCTKNLKAVVNITRAMSSKRIAVLRFDFTGLGESEGDFSRTT
    FSSELSDLVSAARFLEQEYAAPKILVGHSLGGAAVLAAAGEIPSAQGIATIAAPFTPAHLRQLLGESAQQIEREGEATVH
    LGGSDFTIRKSLLDDLEAHRPEEFLDRLEAAILVMHSPADRIVGIDNASRIFEAARFPKSFISLGEADHLLTDPADSRYA
    GEVIATWASRYLPPAENAQAVQRREPADNRLTARTAAQGFRTEIFANGFSMVADEPLQYGGSNEGPSPYEYVMAGLGA
    CT
    TMTLQMYARQKGWPLRDALVRLSHHKIHAEDCRECETREGRIDMFSREIELFGELDESQRQRLLEIAEKCPVHRTLSGEI
    RIDTRLRENG

    >gi|197120047|ref|YP_002140474.1| thioredoxin reductase [Geobacter bemidjiensis Bem]
    MEVTHHRLIILGSGPAGYTAAVYAARANLNPVLITGLQPGGQLMTTTEVDNWPGDPEGVMGPDLMERMRLHAERFGTQFI
    YDHISKAQVTKPPFVLEGDNGSYSCDALIIATGASAKYLGLPSEHAFKGKGVSA
    CATCDGFFYRGKPVVVIGGGSTAVEE
    ALYLSNIASHVTVVHRRDKFRAEKILTDKLIEKTKNGNVTIEWNHHLEEVLGDESGVTGVRLRHTSGSDKLISVHGCFIA
    IGHQPNTHIFDGQLEMDEGYIRTNCGYEGNSTSTNIPGVFAAGDVQDRNYKQAITSAGTGCMAALDADRYLEMLKA

    >gi|197120147|ref|YP_002140574.1| dihydrolipoamide dehydrogenase [Geobacter bemidjiensis Bem]
    MQETADVLVIGTGTAGFTLALACRKGGRQVAVVDDKPYGGTCGRNGCEPEKYLMQAAQVVHLTRQMSGQGITVPAAMDWP
    ALIRSKSAFSNGVPERTERAFQQAGIKMYFGTAHFLSPETVAIGSETTVRAETIVIATGARPAPLDFPGAGLVVETSDFM
    EMKNLPRRVLFIGGGCLALSFGHVARAAGADVTILQRGERVLKNFDLEMAQLAAKAARARGINIVTGITAAMAEKVQGAF
    MTYGKGGCTEAFPSDLIVNTSGRIPDLDPVDPEAGAVARSARGVTVNEFLQSVSNPRVWAIGDACDSPYLLSTVADMEAE
    VAADNILTGNRRRPDYQGVPSMAQAQPPLSFVGLTEAQARQSGKKFRINRGSTDSWPSSRRIGQQGGFYKVLIEEETGKI
    LGAHLLGQNAGETINIFALALKFGISNSELRQILWTYPTFISDVKDMIE

    >gi|197120208|ref|YP_002140635.1| rhodanese homology domain superfamily protein [Geobacter bemidjiensis Bem]
    MRVFAVLFSLVLFAVAPSFATGAVNVSSAQARALLAKNAKMVVLDVRTPEEYRQAHLKGSLLIPLGDLGKRVQEIPRDRP
    VLVY
    CAVGARSQTAASFLASKGYRDVYNMADGLVGWYKNGLPLQTGSSR

    >gi|197120371|ref|YP_002140798.1| peroxiredoxin [Geobacter bemidjiensis Bem]
    MAQVTFKGNPVTLVGSQVKVGDAAPDFSVVDNSMGAVSLANYQGMVKIVSAVPSLDTPVCDTETRRFNQEAAKLPGDVVV
    LTISADLPFAQKRWCGAAGIDKVVTLSDYRDRSFALAYGVLIDELKLLSRSIFVIDKQNVIRYIQHVPEVTQEPDYEAAL
    RAARELA

    >gi|197120375|ref|YP_002140802.1| UDP-galactopyranose mutase [Geobacter bemidjiensis Bem]
    MSRFDIVVVGAGISGATLAERYASLGKKVLVLEKRNHIGGNCYDFHNEHGILVSKYGAHLFHTEFEDVWQYVNRFSRWYP
    YEHHVLAKVDGKLVPIPVNISTVNTIFNLRIRTETEMQRFLSEVQVKPPHEEPRNGEEAALARVGLVLYEKMFKHYTKKQ
    WDKYPHELDASVLLRIPVRTNFDDRYFNDPYQALPLNGYTRLFEEMLRHPNITVRLSTDYFDVKESPEVRECSKVFYAGP
    IDRYFDYRHSRERKLQWRSIRFEWITLDQEFFQQNSVVNYPDPKDGDFTRIVEYKHFTRQKHPKTTISREYTTDEGDPYY
    PVPNSENEAISQRYREEAEKLSDVYFVGRLANYKYFNMDQAFKNALDLFHRIEGKH

    >gi|197120391|ref|YP_002140818.1| rhodanese homology domain pair protein [Geobacter bemidjiensis Bem]
    MSEKMMRKSKGMLAALLGIAMAALTIWGCGTDSYTTPSQSIVTTKTATALITTGDLKGWMDAGLVNKQGGYDRVVILDVS
    NNESDGTNKYNTVGHIPGAQLISAGSAAFMDNTRAEGPMTVVGSMVCTGSAIDSIVQNAGIDGNTTIVLTNNAAGFVNVT
    RAYTTFRYWGFPKERLKVLQGGNAAWAASNALTTAVPTVARSTYGVAQNGATRVNTDMRVSLSEMITYVKAIVAGNTDKV
    TLVDTVRGATNVSSTTDLFETTKYTPFDGAIKGSYSYVATAMTSPAGSLTFKDAATIKSDLAAAFGTDGTTALSAATRDA
    TKTFIVF
    CRAGNYASVGYFALDGIAYYNNSNVDVKWYDGSLGQWNLLAPSNRTAVDTTGATVNAGGKLKVGSIWDTTALM
    DNLIFNVQRTISATNLTQRPIVDYGARMYPVEPSFADGNQIESADRAYRSSVSGTTGGSTSGGGGGC

    >gi|197120374|ref|YP_002140801.1| hypothetical protein Gbem_4013 [Geobacter bemidjiensis Bem]
    MQATNFTSTIIPSRRGRDSRSAAAPLPPLPHRLRCLARFWLAACLALLLLLPPGARAAASELSATLYFFWGVGCPHCTKA
    KPFLEELKRKYPTLRIESYEVLEKRENIPLLVAMARARHKEATGVPVFIIGQEMFSGFSAETAAEVEQAVRLALQPVAPQ
    KQAAPKPAPPVRLPLLGPVDAQSLSLPVFTVAVALLDSLNPCAFFVLFFLLSLLIHAHSRRRMLLIGGLFVFFSGLVYFV
    FMAAWLNLFLITGGLPAITFAAGIVALFVGAVNVKEFFYFGQGVSLSIPEQQKPKLFARMRRLLRADSLPSLLAGTTVLA
    LAANSYELLCTAGFPMVFTRMLTLRELPTYSYYAYLAFYCTIYALPLAVIVALFTVKLGERKLTQWQGRVLKLVSGLMML
    GLGLVLLIDPALLNKPLASAGLLAGTLAAAALLAAFARKRGAG