Geobacillus kaustophilus HTA426 uid58227

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|56418737|ref|YP_146055.1| protein-disulfide isomerase [Geobacillus kaustophilus HTA426]
    MKIEVWSDFVCPFCYIGKRRLEQALEQFPHREDVEVVFRSFELDPNAKKETPLTIHEIIANKYGISIEEAKRANADVGRQ
    AEAVGLTFRFETMKPTNTFDAHRLAHYAKEKGKLNEMVERLFYAYFTESKRISDRDVLLAIAEATGLDRAEAEEVLASGR
    YTEEVRRDEEEAAALGVRGVPFFVLNGKYAISGAQPVDVFRRALEKVWEEEQQASPLRSLAGEGGMCADGSCSID

    >gi|56418887|ref|YP_146205.1| cadmium-transporting ATPase [Geobacillus kaustophilus HTA426]
    MSEQQAKLSKSEAKTYRVQGFTCANCAAKFENNVKSLPGVQDAKVNFGASKITVWGTTTIEELEKAGAFENLKVREDKEK
    SVKREPFWKQKENIKVYISAVLLVISWFLGKQYGEEHIFATIGYAAAILIGGYSLFIKGFKNLVRLNFDMNTLMTVAILG
    AAAIGEWGEGATVVILFAISEALERYSMDKARQSIESLMDIAPKEALIRRGNEEMMVPVDDIQVGDIMIVKPGQKLAMDG
    IIIKGTSTLNQAAITGESVPVAKTVGDEVFAGTLNEEGLLEVKVTKRVEDTTLSKIIHLVEEAQAERAPSQAFVDRFAKY
    YTPAIIIFALLLAVIPPLFMGADWSEWIYRGLAVLVVGCPCALVISTPVAIVTAIGNAAKNGVLIKGGIYLEEAGSLKVI
    AFDKTGTLTKGVPSVTDVVTYNGDENELMTITAAIEKGSQHPLASAIIRKAEEDGLNFNDLSVEEFQSITGKGVKAKVNN
    AMYYVGSPGLFEELLPNGIQSEIKEQITTLQTQGKTVMALGTEKEILALIAVADEIRESSKEVIRKLHQVGIEKTVMLTG
    DNQRTAEAIGKQVGVSDIKADLLPEDKLNFIKELRDKHQSVAMVGDGVNDAPALAASTVGVAMGGAGTDTALETADIVLM
    SDDLSKLPYTIKLSRKALAIIKQNITFSLGIKALSLLLIVPGWLTLWLAIFADMGATLLVTLNSMRLLKVKE

    >gi|56418971|ref|YP_146289.1| hypothetical protein GK0436 [Geobacillus kaustophilus HTA426]
    MDAGWKFDNSYARLPERFFSKVLPTPVRAPKLAVLNRSLAVKLGLNEEALRSEDGVAVFGGNQIPGGAEPLAQAYAGHQF
    GYFTMLGDGRAVLLGEHVTPSGERVDIQLKGSGRTPYSRGGDGRAALGPMLREYIVSEAMHALGIPTTRSLAVVTTGETI
    MRETELPGAVLTRVASSHLRVGTFQYAAQWGTIEELRALADYALWRHFPGFEEAENRYLFLLEQVIERQAELIAKWQLVG
    FVHGVMNTDNMTISGETIDYGPCAFMDTYSLETVFSSIDTEGRYAYGNQPYIGGWNLARFAESLLPLLDENEEKAIALAQ
    GALDEYPKRYHHHWLSGMRAKLGLAEEQEGDQELIADLLRLMEAHRADYTNTFRALTLGEYTGMALFDSAEFREWQERWQ
    TRLSQESVSREEAYERMRRHNPAVIPRNHRVEEALAAAVHDGDYSVMERFLEALSDPYAYSPEQEKYAELPPPSDRPYRT
    F
    CGT

    >gi|56419012|ref|YP_146330.1| bacterioferritin comigratory protein [Geobacillus kaustophilus HTA426]
    MTIAIGQPAPDFTLPASNGKMVSLSDFRGRYVVLYFYPKDMTPGCTAEACDFRDRHAQFAELNAVILGVSTDPMNRHEAF
    IEKYELPFLLLSDERHEVAELYGVWKKKKNFGKEYMGIDRSTFIIAPDGTLVQEWRGVKVKGHVDEALAEVARLASSR

    >gi|56419102|ref|YP_146420.1| hypothetical protein GK0567 [Geobacillus kaustophilus HTA426]
    MKKLLAFGGIIVVLFAAIAFITMYEQKEAASNNPYHKSELNPATIAQLDDPNYRNIILPAELKQQLADGKTLTVYFYSPT
    CPHCQRTTPIVVPLAKELGIDLKLFNLLEFEDGWDAYHIEATPTIVHYENGKEIKRIEGYHDEQTFRNWFSSLHSDK

    >gi|56419103|ref|YP_146421.1| putative disulfide oxidoreductase [Geobacillus kaustophilus HTA426]
    MEREKRAENLLLAAWATALIATLGSLYFSEVLGFIPCDLCWFQRIFMYPQVVILGIAIVRKDAAAARYSFTLSLIGGGIS
    LYHYGLQKIPLLQEYAIS
    CGRIPCTGQYINWLGFITIPFLAFTAFMIIMLLSWTVMRQQRKESER

    >gi|56419120|ref|YP_146438.1| cadmium-transporting ATPase [Geobacillus kaustophilus HTA426]
    MSEQQAKLSKSEAKTYRVQGFTCANCAAKFENNVKSLPGVQDAKVNFGASKITVWGTTTIEELEKAGAFENLKVREDKEK
    AVKREPFWKQKENIKVYISAVLLVISWFLGKQYGEEHIFATIGYAAAILIGGYSLFIKGFKNLVRLNFDMNTLMTVAILG
    AAAIGEWGEGATVVILFAISEALERYSMDKARQSIESLMDIAPKEALIRRGNEEMMVPVDDIQVGDIMIVKPGQKLAMDG
    IVIKGTSTLNQAAITGESVPVTKTVGDEVFAGTLNEEGLLEVKVTKRVEDTTLSKIIHLVEEAQAERAPSQAFVDRFAKY
    YTPAIIIFALLLAVIPPLFMGADWSEWIYRGLAVLVVGCPCALVISTPVSIVTAIGNAAKNGVLIKGGIYLEEAGNLKVI
    AFDKTGTLTKGIPSVTDVVTYNGNENELMTITAAIEKGSQHPLASAIIRKAEEDGLNFNDVSVEEFQSITGKGVKAKVNN
    AMYYVGSPGLFEELLPNGIQSEIKEQITTLQIQGKTVMALGTEKEILALIAVADEIRESSKEVIRKLHQVGIEKTVMLTG
    DNQRTAEAIGKQVGVSDIKADLLPEDKLNFIKELRDKYRSVAMVGDGVNDAPALAASTVGVAMGGAGTDTALETADIALM
    SDDLSKLPYTIKLSRKALAIIKQNITFSLGIKVLALLLIVPGWLTLWLAIFADMGATLIVTLNSMRLLNVKE

    >gi|56419127|ref|YP_146445.1| arsenite S-adenosylmethyltransferase [Geobacillus kaustophilus HTA426]
    MNHVNNDQIRQNVRSRYKQIALQEVNSRSCCSDSSGCCGTPNEVSAKLGYSDEELSAVPEGANLGLGCGNPLAIAELNPG
    DVVLDLGCGAGFDCFLAARQVGETGRVIGVDMTPEMISKARNNAAKGGFTNTEFRLGEIEYLPVADGSVDVIISNCVINL
    SPDKPQVFKEAYRVLKPGGRLVISDVVATAELPSEIKNNMDVLYSG
    CVSGAASIGELESMLQQSGFTQITIEPKDESKEF
    IKDWVPGANIEDYIVSAIIKAMKP

    >gi|56419161|ref|YP_146479.1| thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein [Geobacillus kaustophilus HTA426]
    MNERYSRQQLFAPIGEEGQKKIRGKHVVLVGAGALGTGNAEALVRAGIGKLTIIDRDYVEWSNLQRQQLYSEADAKERLP
    KAIAAKRRLEQINSEVEIEAIVGDAGPEELETIALKQRPDLWIDATDNFDTRLVINDVAYKYNIPWIYGACVGSYGLSCA
    FIPNRTPCLYCLLETVPQGGLT
    CDTAGIISPAVQMVVSYQMAEALKILVEDWSALRGKLVSFDLWTNEYASIRIDGVKKD
    GCPTCGRHPSYPFLSYEQRTKTAVLCGRDSVQIRPPAPRQYDLNELAELFRRQGLQAEANPYLVSVSLGDKRLVVFRDGR
    ALVHGTKDVQEAKAIYYRYLG

    >gi|56419285|ref|YP_146603.1| cation-transporting ATPase [Geobacillus kaustophilus HTA426]
    MGNEQTLDRLEAKTYRVQGLTCTNCAAKFEQNVKSLPGVKEAKVNFGAAKLTVWGEATIDELEQAGAFERLKIREERERT
    IRREPFWKKKENRNVLVSAVLLLIGIAADAADKGMLAIAMYLAAIVIGGYSLFWTGLRNLARWQFDMKTLMTIAILGAAA
    IGEWQEGAVVVILFAISEALESYSMDRARRSIASLMEMAPAAATIRRGAEEVTVPVEDVRVGDVMIVKPGGKIALDGIVI
    SGASTVNEAAITGESLPVEKAVGDAVFAGTLNGEGFLEVEVTKRADETTLAKMIDLVEEAQAERAPSQAFVDRFARYYTP
    FIIVTALLIAIVPPLVMGGEWLDWIYRGLAVLVIGCPCALVISTPVAIVTAIGNAARRGVLIKGGVHLEQIGRLRAVAFD
    KTGTLTKGKPAVTDVVVYEGTREQLLAIAAAIEKRSQHPLASAIVRKAEEEGAPFLDVAVEEFQSLTGQGVKAVIAGNTY
    YIGSPALFTSWIGKLPDEAEKQISAFRDEGKTVMAVGTADRLLGLVAAADQLRPSAPETVAALRRLGVAEVVMVTGDHEQ
    TAQAIGRQAGVSDIRAELLPEQKLAAIRELKERCGMTAMVGDGVNDAPALAAADIGVAMGGAGTDAALETADVVLMADDL
    RQLPYTVHLGRRTLAVIRQNIAVALGLKVLALVAAVPGWLTLWLAVFADMGATLLVTLNSMRLLRVKE

    >gi|56419352|ref|YP_146670.1| transcriptional regulator Spx [Geobacillus kaustophilus HTA426]
    MVKLYTSPSCTSCRKAKAWLEKHNIPYVERNIFSEPLTVEEIKEILRMTETGTDEIISTRSKVFQKLNINLEALPLQDLY
    ELIQKNPGILRRPIIIDEKRLQVGYNEDEIRRFLPRKVRAYQLREAQRLVNG

    >gi|56419394|ref|YP_146712.1| thioredoxin [Geobacillus kaustophilus HTA426]
    MKRIETVEQFEAVISGDKPTIIKFYTTWCPDCVRLNMFIDDIVRDYRQYDWFEIDRDQFPELGEKYQVLGIPSLLVFRNG
    KKIAHLHSADAKTPEEVRAFLQSLPE

    >gi|56419434|ref|YP_146752.1| cytochrome c biogenesis protein [Geobacillus kaustophilus HTA426]
    MTQLALGVMMVSIAVASIFNNQQEEGKIKPKPVVSTSLDSGKIGTNKGEVAPDFELLSITGDKIKLSDLRGKTVILNFWA
    TW
    CPPCRAEMPEMQKFYENNKDSNVEILAVNLTNSERGSNAVSDFVEAKGITFKVVLDEQGDIGNLYGAITIPTSYIIDK
    NGVIRNKYVGPMSYETMDRMISGIQ

    >gi|56419437|ref|YP_146755.1| heavy metal-transporting ATPase [Geobacillus kaustophilus HTA426]
    MSEQKHVTLRVTGMTCAACANRIEKVLNKMDGVEANVNLAMEKATIKYDPSKQNIADIEMKIENLGYGVATEKVTLDIEG
    MT
    CAACATRIEKGLNRMEGVTSAAVNLATNSAVVEYKEGVTSVEDILEKIKKLGYRGQIRNEEQDHAGRKEERLKQKQRQ
    LAISIILSLPLLYTMLAHMPFDIGLPMPHWLMNPWFQLLLATPVQFYIGGPFYVGAYRALRNKSANMDVLVALGTSAAYF
    YSLYEAWRTLGNPDYMPRLYFETSAVLITLVLVGKYFEALAKGRTTEAISKLVSLQAKEATVIRNGEEMKVPLEEVVIGD
    TILVKPGEKIPVDGTVISGASSVDESMITGESIPVDKKEGDYVIGATMNTNGVLTIRAEKVGKDTALANIIKIVEEAQGS
    KAPIQRMADTISGIFVPIVVGIAVVSFLIWYFFVAPGDLAKALEVAIAVLVIACPCALGLATPTSIMVGTGKGAEQGILF
    KGGEYLEGTHKINAVLLDKTGTVTKGKPEVTDVLAFREDMLDYAVSAESASEHPLAHAIVEYGKKQAISMKPLEHFSAIT
    GHGIEAVIDGKSILIGTRKLMKERSVAISVHEDKMVELEKQGKTVMLVAIDGQLAGIIAVADTVKESSKEAIQTLKQMGI
    DVYMATGDNQRTAEAIANEVGIEHVYAEVLPENKANIVEELQKQGKRVAMVGDGINDAPALAKADIGMAIGTGADVAIET
    ADVTLVGGDLRHIPKAIELSRQTMKNIRQNLFWALFYNTIGIPVAAFGLLEPWIAGAAMAFSSVSVVANALRLKRVKL

    >gi|56419438|ref|YP_146756.1| mercuric ion-binding protein [Geobacillus kaustophilus HTA426]
    MTITLQVQGMTCGHCKAAVTNALQALDGVSRVEVHLQEGTVDVEYDETKVSVEKLKEAIEEQGYDVK

    >gi|56419480|ref|YP_146798.1| methylated-DNA-protein-cysteine S-methyltransferase [Geobacillus kaustophilus HTA426]
    MTIEYAVYRSELLGDIYIASDGDAIVKVELFPEEWRAFAGEHPAVKSWSPLLERALRQLDEYFHGRRQAFDLPLKWKGTA
    FQEEVWAALCRIPYGETATYADIAAQIGRPKAVRAVGQANRANELSILVP
    CHRVVGKNGALIGYAGSRTDVKAKLLELER
    RLRR

    >gi|56419596|ref|YP_146914.1| dihydrolipoamide dehydrogenase [Geobacillus kaustophilus HTA426]
    MVVGDFAIETETLVVGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKALISASHRYEQAKHSEEMGIKAEN
    VTVDFSKVQEWKASIVKKLTGGVEGLLKGNKVDIVKGEAYFVDANTVRVVNGDSAQTYTFKNAILATGSRPIELPNFKFS
    GRILDSTGALNLGEIPKSLVVIGGGYIGIELGTAYANFGAKVTILEGAGEILSGFEKQMVSIIKRRLKNKGVEVVTNALA
    KGAEERADGVTVTYEANGETKTIDADYVLVTVGRRPNTDELGLEQIGIKMTNRGLIEVDQQCRTSVPNIFAIGDIVPGPA
    LAHKASYEGKVAAEAIAGHPSVVDYIAIPAVVFSDPECASVGYFEQQAKEEGIDVITAKFPFAANGRALSLNDTDGFLKL
    VVRKEDGVVIGAQIIGPNASDMIAELGLAIEAGMTAEDIALTIHAHPTLGEIAMEAAEVALGTPIHIIAK

    >gi|56419906|ref|YP_147224.1| hypothetical protein GK1371 [Geobacillus kaustophilus HTA426]
    MEMTAQQDVRAKQAANAPKNPTAWIIAVSCFVLIGGALFLYSRVSWQQALLYLLGAFGGFVLYQAHFGFTSAWRKFILYR
    QGEGIRAQMIMMAVASALFLPLLVKGSALGHPVSGYVFGVGVSVIVGAFLFGIGMQLGDG
    CASGTLYHIGGGDANGIVTL
    IGFIAGSVIATTHFDVWAKMPQWKPFSFIGEFGALGGFLLQLVLLAAVYYVVTVAEKRRYGQLVATSLENRHGWKAIYKG
    PWSLLVGALLLAVTNALVLMISGKPWGITSAFALWGAKFVQLFGVDPTAWAYWQDEAKRQALANPLYYDTTTVMDISLMV
    GALLAAALAGRYTKPIQWKRPTRMTIGALIGGLMMGYGARLAFG
    CNIGAYFGGIASFSAHGWAWFVFAFLGSLIGVKLRP
    YCAYKN

    >gi|56420091|ref|YP_147409.1| thiosulfate sulfurtransferase [Geobacillus kaustophilus HTA426]
    MASLVSHEWLLRHLHDENTRILDCRFWLGDPAKGAAVYQEDHIPGAVYMDLERDLSGPVGEHGGRHPLPSAEQAADVFGR
    VGIDETVTVVAYDDQDGAMAARCWWLLRYFGHAHVYVLDGNYSEWKKKGHPVTNVVPAVASRPFRPRPDRSWLATVEDVR
    AAVRDRSVVLIDSREWKRYAGLEEPIDRRAGRIPGAVHRFWKDGMTEGGYWKSAVEQAARFADFDRGQPLIVY
    CGSGVTA
    CPNVLALHEAGYHNVRLYVGSFSDWISYPDHPIETGDPSSDA

    >gi|56420093|ref|YP_147411.1| hypothetical protein GK1558 [Geobacillus kaustophilus HTA426]
    MRKWLVVLLFLAVAGYGLWNVMAADKPNEANGAGPEVDQTAPDLTLPALGGQSVKLSALRGKAVVLNFWTSWCPPCKKEM
    PELAKFYERHGREVALLAVHLTTQDTLDNAERFAKANRLVFPVGLDVRGEALRQYRIQTIPTTYIIDPNGVIRRKIVGPV
    TAKRLEQETALFR

    >gi|56420170|ref|YP_147488.1| hypothetical protein GK1635 [Geobacillus kaustophilus HTA426]
    MEERVLGMPAVESNMFPLGKQAPPFALTNVIDGNVVRLEDVKSDAATVIMFICNHCPFVKHVQHELVRLANDYMPKGVSF
    VAINSNDAEQYPEDSPENMKKVAEELGYPFPYLYDETQEVAKAYDAACTPDFYIFDRDLKCVYRGQLDDSRPNNGIPVTG
    ESIRAALDALLEGRPVPEKQKPSIGCSIKWKPSA

    >gi|56420200|ref|YP_147518.1| hypothetical protein GK1665 [Geobacillus kaustophilus HTA426]
    MPKLTFSSDVKWSGEGVRSVADINGKQVIIDEPPALGGTDQGPNPVELVLAALGGCINVLISLFASHHGVELKGVQVHVE
    GDLDPDGFMEKADVRPGFLEIRYHIDIDSPSDPKNVQALIEHVERV
    CPVKDTLRGVPTVSIANQKTS

    >gi|56420300|ref|YP_147618.1| hypothetical protein GK1765 [Geobacillus kaustophilus HTA426]
    MKTTVVWNGNMSFSGQSASGVVIPIDAAKDVGGNDSGARPMELLLHALAGCTGIDIVLILRKMRLDVRAFSMEVEGTRAD
    DHPKRFTEIHIHYALEGDLPEDKVVRAIRLSKEKYCSVSHSLNAAITASYSINGVRGKETI

    >gi|56420320|ref|YP_147638.1| glutathione peroxidase [Geobacillus kaustophilus HTA426]
    MSVYEFSVKTIRGEEQPLSAYRGKVLLIVNTASRCGFTPQYKELQELYDEYRDRGFVVLGFPCNQFGGQEPGTEAEIEQF
    CQLNYGVTFPLFAKVDVNGDHAHPLFQYLKEEAPGALGTKAIKWNFTKFLVDRHGRVVARFAPQTKPSELKEDIEKLL

    >gi|56420398|ref|YP_147716.1| hypothetical protein GK1863 [Geobacillus kaustophilus HTA426]
    MQPLYQTSVKAQGGRNGKVVSNDGVLSLDVKMPKELGGPGGGTNPEQLFAAGYAACFDSALNLVIRQRKVKVEGTEVTAQ
    VTLGKDEADGGFQLAVVLRVRVLGVDRKTAEELVHAAHQV
    CPYSKAVRGNIDVTLSIEE

    >gi|56420403|ref|YP_147721.1| assimilatory nitrite reductase subunit [Geobacillus kaustophilus HTA426]
    MKRKLVLIGNGMAGVRCIEEILKLDREAFEITIFGSEPHPNYNRILLSKVLQGDTRLDDITLNSWEWYERNGIRLFVGET
    VTEVDIKRRLVRTDRGRVVEYDELIFATGSNPFILPVPGADLPGVTAFRDIQD
    CERMIEYAKTYKKAAVIGGGLLGLEAA
    RGLLHLGMDVDVIHIFDYLMERQLDPTASKLLQRELEKQGMNFLLRKETAELFGNGRVEGVRFKDGTSIAADLVVMAVGI
    RPNVELARKSGIEVNRGIVVNDYLETSVPHIYAVGECAEHRGVVYGLVAPLYEQGKVLAQAICGRKGKPYEGSVVSTQLK
    VSGVDVFSAGEFMDVEGTESIKLYDEARSVYKKVVVREGKIVGAVLFGDTSEGRKLFDMIQRGDSLEALSLSLLAPASSG
    GKGSLVAAMADTDVVCGCNGVTKGAICQAIAEHGLKTVAEVRDYTNASRSCGGCKGLVAELLEHMLGEEANRYAVKETIC
    GCTDLSREEVLEAIEQRRLMTVKEVMSVLGWKNEEGCSKCRPALNYYLGMLYPGEYDEEAESLFVNERLHANIQADGTYS
    VVPRIYGGVTTAEQLRNIADVAEKYNVPMIKITGGQRIDLLGVKKEDLPRIWADLGMPSGYAYAKALRTVKTCVGKQFCR
    FGTQDSTGLGIRMEQTFERLKTPHKVKMAVSACPRNCAESGIKDVGVVGVEGGWEIYVGGNGGTHLRAADLLCTVKTEDE
    VIEMTGAFLQYYRESAHYLERTSKWVERVGLEHIREVLFDVETRRALLERLHKALSATKDPWREIVENERLQQLLFRDIG
    DKEPVPVE

    >gi|56420600|ref|YP_147918.1| hypothetical protein GK2065 [Geobacillus kaustophilus HTA426]
    MVKEMTVQQMTEKVLNKESLFILDVRNESDFRDWKIEGENFAYLNVPYFELIDGVDSIVDRLPKDQDIVVVCAKGGSAAF
    VAEQLTEAGVDNVYTLAGGMQAWSEHLHQAKVYEDDQLKIYQFIRVGKGCLSYMVISGSEALVVDPLRFIDVYEQVAQQE
    GVKITHIVDSHLHADHLSGGKALAERTGATYYLMKSEGAVFDFEPLEQHETIDFENVHLEVLAVKTPGHTPGSVSFFVNG
    KWLFSGDTIFVGGLGRPDLGGKVAEWAADLYDTVYEKVAAMADDVIVLPAHYANLDEEINAEGYVGDTLGRIRARNEMMQ
    NKPKDEFIDLVIQSANTETPPNFEDIVAINRGLKTVDIETQRELEIGPNRCALHHTHA

    >gi|56420601|ref|YP_147919.1| hypothetical protein GK2066 [Geobacillus kaustophilus HTA426]
    MIKVDMTVDAKGLSCPMPIVRTKKAINELQPGQVLEVQATDKGSKADIKAWAESTGHQYLGTIEENGVLKHYIRKSAEHE
    TRKETTFPHVVSNEELQEKLHDPDSFVLDVREPAEYAFGHIPGAVSIPLGELENRMAELPKDKTIYVV
    CRTGTRSDLAAQ
    KLAEKGFDRVRNVIPGMSQWNGPLDSAQS

    >gi|56420602|ref|YP_147920.1| hypothetical protein GK2067 [Geobacillus kaustophilus HTA426]
    MKTITPKEVEERLRAGEPLRIIDVREPDEVAAGKIPGAVNIPLGLIEFRMHELDKNEEYILVCRSGGRSGRAAEFLDSRG
    YRVVNMTGGMLAWEGPIE

    >gi|56420603|ref|YP_147921.1| hypothetical protein GK2068 [Geobacillus kaustophilus HTA426]
    MSQTIINIVLFVLLAWFLASRFIPPKGVRMITTAELKRRLKEPDVQYIDVRTPMEFRSFHLPGFRNIPLHELAARARELS
    KEKEVVVI
    CQSGIRSQKASKLLKKMGFQHVTNVKGGLSAWQ

    >gi|56420609|ref|YP_147927.1| hypothetical protein GK2074 [Geobacillus kaustophilus HTA426]
    MAKTISVKEIANKIMRGEELFIVDARNPEDFADWRIEGKGVEVVNIPYFEVLDGIEPYLDRLPKEKSKTIYAVCAKGGSS
    EFVAEQLEAAGYTDVYSIEGGMKAWSEHLEPVKIGELKSGGTIYQFVRLGKGCLSYLVESNGEGALIDTNRMTDAYVRFA
    NEHGITIKHVLDTHLHADHISGGRKLAEELGATYYLPPKDAEEVTFTYTPIQDGDRIHVGHVVIEALYSPGHTIGSTSFI
    VDDQYLLTGDILFVDSIGRPDLAGKAQDWVDDLRETLYRRYKQLADDLIVLPAHYMGPNEMNKDGSVAERLGVLYEKNHG
    LNISSDEEFRRTVTENLPPQPNAYKEIRQTNMGKLHPTEEEQREMEIGPNRCAVR

    >gi|56420611|ref|YP_147929.1| hypothetical protein GK2076 [Geobacillus kaustophilus HTA426]
    MKVAIIAANGGLFDAYKVFNIATAAAAADAEVGVFFTFEGLNLIHKEAHKQLPIPEGKEHFQQGFQKANVPSIAELLQMA
    QEMGVKLIA
    CQMTMDVMGLDKDQFVDGIEVAGAATFLQFAKDADITLAF

    >gi|56420614|ref|YP_147932.1| thiol:disulfide interchange protein (thioredoxin) [Geobacillus kaustophilus HTA426]
    MVLVLLILTGWAIYDTLSKNMASSVKDGGKSEGQVAEGIEVGNRAPDFVLRTLNGEEVRLSDFRGKRVIVNIWATWCPPC
    RAEMPDMQKFYEQYKDERVEIVAVNLTQSERQPEHVARFIQEYGITFTVVLDEKGEVSRQYEAQAIPTSYLIDSKGIIRK
    KMIGPMSYDWMVDQMESIQ

    >gi|56420623|ref|YP_147941.1| hypothetical protein GK2088 [Geobacillus kaustophilus HTA426]
    MFFRSFFYEQLAHMSYLVGCQRTGEAIVIDPGRSIDWYIDTAKKEGLRIVAAAETHIHADFVSGAKELAKRCGAKLYLSD
    EGDENWKYQYLNEVDYELVKEGSIFTVGNVEFQVIHTPGHTPEHISFILTDKGGGAKEPMGIFTGDFVFVGDVGRPDLLE
    KAAGIFGTADIGARQMFQSLKKFKALPDYLKVWPAHGAGSACGKALGAVPSSTVGYEKLTNWALKIEDEEEFVKLLLAGQ
    PEPPKYFAMMKQVNKIGPEYLNEEEVPALPTREQLEEYQSNGVFILDVRPPQEFANAHYAGSINIPFNKSFTNWAGWFIN
    YDQDIVLIASQEDVQAIRKALAYIGLDRIVAYIEPVVALSGEVERYEEIDVQQLRQYLQDEHYHLIDVRNQAEWDEGYIE
    GAQHIMLGTLADRLNEIPEGKTYIVQ
    CQSGARSAIGASILQAKGVKQVLNLKGGYLAWVQEKLPIARKA

    >gi|56420626|ref|YP_147944.1| hypothetical protein GK2091 [Geobacillus kaustophilus HTA426]
    MRKIVIVGGVAGGATAAARLRRLSEADHIVLFERGEYISFANCGLPYYIGGVIEERSKLLVQTAEVMSKRFCLDIRPLNE
    VTAIHRDRKTVSVRNVKTGEEYEETYDILILSPGAKPIVPPIPGIEEAEALFTLRTVPDTDRIKTYIDEQKPRRAVVIGG
    GFIGVEMAENLIHRGIHVTLIERANQVMAPIDYEMAAIVHGHMREHGVELLLEDGVRALEERGRRVVLTSGRVIETDMII
    LAIGVEPESWLAKEAGLELGVRGAIKVNEHLQTSDPSIYAIGDAVEVRHYIHGFETFVPLAWPANRQGRLVADHIHGFDV
    KYSGTLGTSIAKVFELAVAATGLNEKMLRALGVPYDVVHIHPLSHAGYYPNAEVMTFKLVFDRETGRIYGAQAVGKEGVD
    KRIDVIATAIKGGLTVRDLPDLELAYAPPFSSAKDPVNMAGYVASNIMDGLVETVQWHEIDRIVDDGGVLIDVRTEQETS
    RGMIRGSIPIPLDELRDRLHELPKEKPIYVT
    CQVGLRGYIAARILRQHGFRAINVDGGYRLYAVVKQ

    >gi|56420817|ref|YP_148135.1| thiol-disulfide oxidoreductase [Geobacillus kaustophilus HTA426]
    MKKQQRLVMRTAILLVLLAAIGYTIYTNFFTEKTAVAVGSTAPDFVLTDLKGHEHRLSDYRGKGVFLNFWGTWCKPCERE
    MPYMNELYPIYKKQGVEILAVNVGEPKLSVEKFAERFGLTFPIVIDRQDQVLNAYNVGPLPTTFLIDKNGEVKQIITGTM
    TKEDIERHLESIKP

    >gi|56420861|ref|YP_148179.1| hypothetical protein GK2326 [Geobacillus kaustophilus HTA426]
    MSLYITFTDAAKRALASIVAESGRQLKLMFDTDGCGCLVDGVPALWLVDKADEDDVVVETNFAPVLVERSRLIFFDETMT
    IDVKPGTTVFQLKSPGQTLNGHMPFVEVKSGHER

    >gi|56420914|ref|YP_148232.1| dihydrolipoamide dehydrogenase [Geobacillus kaustophilus HTA426]
    MAKEYDVVILGGGTGGYVAAIRASQLGLKTAVVEKGKLGGTCLHAGCIPSKALLRSAEVYAQTKNGEAFGVIADGVRLDF
    AKVQARKAAIVEQLHKGVQHLMKKGKIDVYAGTGRLLGPSIFSPLPGTVSVEMNDGSENEMLVPKFVVIATGSRPRTLPG
    LEPDGEFVMTSDEALQMETLPSSILIVGGGVIGMEWASMLNDFGVDVTVLEYADRILPTEDEDVSKEMEKLLRRRGVNIV
    AGAKVLPETLEKGNGVTIQAEHQGERKTFTADKMLVSVGRQANIEGIGLENTEIVVEKGYIQTNEFGQTKESHIYAIGDV
    IGGLQLAHVAAHEGIVAIEHLAGHNPAPIDYTMVPRCIYTRPEAAAVGLTEQEAKAKGYDVKVGKFPFKAIGKALVFGEA
    EGFVKLIADRNTDDLLGVHMVGPHVTDLISEAGLARVLDAAPWEVAHAIHPHPTLSEAMAEAALAVDGKAIHF

    >gi|56420956|ref|YP_148274.1| hypothetical protein GK2421 [Geobacillus kaustophilus HTA426]
    MEALLIILGAIIVYSVITYFWQKRIVKALTEEEFRAGYRKAQLVDVREPDEFAAGHILGARNIPLTQLRMRMKELRKDQP
    IYLY
    CQNGLRSGRAAQMLYRKGYRDLYHLKGGFKTWTGKVKKKA

    >gi|56421109|ref|YP_148427.1| NADH-peroxiredoxin reductase [Geobacillus kaustophilus HTA426]
    MLLDADIKAQLAQYLQLLENDIVLTVSAGDDNVSRDMLALIDELTAMSSKIKVEKAKLERTPSFSVNRVGENTGITFAGV
    PLGHEFTSLVLALLQVSGRPPKVSQDVVDRIQQIRGKHHFETYVSLT
    CHNCPDVVQALNIMSVLNPDISHTMIDGAAFKE
    EAEQKGIMAVPTVFLNGKLFASGRMSLEDILAKLGSAPDASSFADKEPFDVLVIGGGPAGATAAIYAARKGIRTGIVAER
    FGGQILDTLGIENFISVKYTEGPKLAASIEEHVKQYNVDIMNSQRAKRLEKKDLIEVELENGAVLKSKTVVIATGARWRN
    LGVPGEEEFKNKGVAY
    CPHCDGPLFEGKHVAVIGGGNSGVEAAIDLAGIASHVTLLEFAPELKADAVLQDRLYSLPNVTV
    IKNAQTTEITGTDKVNGLTYIDRETGEEHHIELQGVFVQIGLVPNTEWLEGTVERNRFGEIIVDKRGATNIEGVFAAGDC
    TDSAYKQIIISMGSGATAALSAFDYLIRH

    >gi|56421110|ref|YP_148428.1| peroxiredoxin [Geobacillus kaustophilus HTA426]
    MSLVGKKVQPFRAQAYHNGEFIEVTEQDFMGKWSIVCFYPADFTFVCPTELEDLQDHYATFKELGVEVYSVSTDTHFTHK
    AWHDTSPAISKIEYVMIGDPSHQLSRMFDVLDEEQGLAQRGTFIIDPDGVIQAVEINADGIGRNASTLIDKIKAAQYVRN
    HPGEVCPAKWKEGAETLKPSLDLVGKI

    >gi|56421220|ref|YP_148538.1| thioredoxin (TRX) [Geobacillus kaustophilus HTA426]
    MAIVNATDQTFAAETKDGLTLVDFWAPWCGPCRMIAPVLEELDREMGDKVKIVKVNVDENQETASKFGVMSIPTLLVFKN
    GELVDKAIGYQPKEALVQLVGKHVS

    >gi|56421245|ref|YP_148563.1| peptide methionine sulfoxide reductase [Geobacillus kaustophilus HTA426]
    MEKATFAGGCFWCMVMPFEELDGIYGIVSGYTGGHVENPTYEQVKTGTTGHYEAVQITFDPDVFPYERLLELYWCQIDPT
    DDGGQFHDRGPQYRTAIFYHNEKQRQLAEQSKRALEESGRFSKPIVTKILPATTFYPAEEYHQNYHKKNPEHYKQDRAAS
    GRDEFIAKHWGTKR

    >gi|56421322|ref|YP_148640.1| thiol peroxidase (superoxide-inducible protein 8) [Geobacillus kaustophilus HTA426]
    MAYVTFKGQPVTLVGNEVKVGDKAPDFTVLDQNLQEVTLADTKGHVRLISVVPSLDTGVCDAQTRRFNEEAAKLDNVKVL
    TISVDLPFAQKRWCGAAGIENVQVLSDHRDVSFGQAYGVLIKELRLLARAVFVIDSNDTVTYVEYVPEVTNHPNYEAAIE
    AAKAAK

    >gi|56421371|ref|YP_148689.1| hypothetical protein GK2836 [Geobacillus kaustophilus HTA426]
    MGYDVIIIGGGPSGLMAAIGAGEEGAKVLLLEKGTKLGRKLAISGGGRCNVTNRLPVDEMVRHIPGNGRFLYSAFSVFNN
    EDIIRFFERLGVPLKEEDHGRMFPKSDSAQSVVDALVRELSRLGVDVRLESPVADVLYEQGKTVGVTLKSGETIHARAVV
    VAVGGKSVPQTGSTGDGYPWAEKAGHTVTELFPTEVPIVSHEPFIKERTLQGLSLRDVALSVLKPNGKPIITHRMDMLFT
    HFGISGPAALRCSQFVVKALKKAADGAVEMSIDALPDVTQEELFQHFAKLCKEEPKKAMKTIAKTVLPERYAVFLLERAG
    IDPHASAGTVGHEALRAFVRQCKQFTFYVHGTLPLEKAFVTGGGVSVKEIEPKTMASKCMAGLYFCGEILDIHGYTGGYN
    ITAALVTGRLAGVNAARYALAEKNGASGSAGQTATN

    >gi|56421376|ref|YP_148694.1| hypothetical protein GK2841 [Geobacillus kaustophilus HTA426]
    MEEIKEITPAEVKEKLERGEKLNIVDVREDEEVALGMIPGAKHIKMGDIPDRLEEFDRNEEYIFVCRSGRRSENVCRYLQ
    ELGYRVRNMTGGMLEWEGETAPKQ

    >gi|56421491|ref|YP_148809.1| hypothetical protein GK2956 [Geobacillus kaustophilus HTA426]
    MAEAVITLTEAAAFQIKDMMKEQEEEGAYLRVGVHGGGCSGLSYGMGFDHERREDDIEFEQHGIKILVDRDSAPILRGTV
    IDYKQSLLGGGFTINNPNAIATCGCGSSFRTATNAGTPEQC

    >gi|56421531|ref|YP_148849.1| hypothetical protein GK2996 [Geobacillus kaustophilus HTA426]
    MNNGTYASVESALRHYKEGLGAFTQKLPNVAERFNAFTEACFAEGALSKKEKQLIALGISLATQDEYCTIYHAKGCLDEG
    ASEQEILEACAVAAAFGGGAAMSQAVTLVQECLRELRAAH

    >gi|56421536|ref|YP_148854.1| thioredoxin [Geobacillus kaustophilus HTA426]
    MKAIDRNDVMRVVEVEPLLALYLYTPLCGTCQLARRMLTVVEQLFPALPFYETDINYIPEQAVAWKIESVPCLLLFRDGT
    VAGKWYAFHSVPYLYEVIQACLPSR

    >gi|56421540|ref|YP_148858.1| arsenate reductase [Geobacillus kaustophilus HTA426]
    MALTLYWYPKCGTCRKAKKWLDEHGIEVQTVHLVDEPLTKEQLARLHRQSGLPLKKFFNTSGMKYRELGLKDKLDRASED
    EMLDWLASDGMLVKRPILTDGERVVVGFREQEYEAFFAAGT

    >gi|56421595|ref|YP_148913.1| hypothetical protein GK3060 [Geobacillus kaustophilus HTA426]
    MHIRLYTKTNCPLCDKAKAVLTELLADYSFTLEEIDIYKDDELLEKYQLMIPVVELDGEEIGYGAIEKEAVRKRLRRAQN
    S

    >gi|56421603|ref|YP_148921.1| thioredoxin reductase [Geobacillus kaustophilus HTA426]
    MADEKIYDVIIAGAGPAGLTAAVYTSRANLSTLMIERGVPGGQMVNTEEVENYPGFETILGPELAAKMFEHAKKFGAEYA
    YGDVKEIIDGEAYKTVIVGDKEYKARAVIIATGAEYKKLGVPGEAELGGRGVSY
    CAVCDGAFFKGKDLVVVGGGDSAVEE
    GVYLTRFANKVTIVHRRDKLRAQKILQDRAFANEKIDFIWNHTVKQINEKDGKVGSVTLVHTQTGEEREFPCDGVFIYIG
    MVPLSKPFANLGITNENGYIVTNEKMETKVPGIFAAGDVREKTLRQIVTATGDGSIAAQSAQHYVEELKEKLNKQGVS

    >gi|56421631|ref|YP_148949.1| mercuric reductase [Geobacillus kaustophilus HTA426]
    MKTYRMTVQGMTCTGCEQHVARALEAIGAKLMDVSFRRGEVVFALPEGTDVDMARQAVKNAHYEPGEAEEITASARSVID
    GEGEYDYMIIGSGGAAFSSAIEAVKYGAKVAMVERGTVGGT
    CVNIGCVPSKTLLRAGEIYALARNHPFLGLHTSAGPVDL
    APLVKQKNELVEQLRQAKYADLIGEYGFDFIQGEARFIDRQTIEVNGQTLSAKRFLIATGASPAVPDIPGLHDVDYLTST
    TLLELKKVPKRLAVIGAGYIGMELGQLFHHLGSEVTLMQRSSRLLKEYDPEISEAVARALTEQGIRVITGASFERVEQDG
    NTKKVYVNVDGRTRVIEADELLVAAGRTPNTAALNLPAAGVEVGARGEILIDEYTRTTNPSIYAAGDVTLGPQFVYVAAY
    QGAVAAANAIGGLNKRWDTAVVPAVTFTHPAIATVGLTEQRAKENGYDVKTSVLPLEAVPRAIVNRETTGVFKLVAEART
    GKLLGAHIVADNAGEVIYAAALAIQFGLTIDDLRHTLVPYLTMAEGLKLAALTFDQDVSKLSC
    CAG