Gemmatimonas aurantiaca T 27 uid58813

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|226225512|ref|YP_002759618.1| thiosulfate sulfurtransferase [Gemmatimonas aurantiaca T-27]
    MTSSISLPTPLVSTAWLADHLDHPALRIVDASWYMAASGRKGGVDFGTAHIPGAVYADIDWLSDEAAPYPHTLPSPETLA
    SKLSALGIGNTHAVVVYDGSGQHFSAPRLWYMLRALGHDAVAVLDGGFVKWRAEGRPVSDAVPTPVPATFVPHVDAARWR
    DISSMRANVESHAEQVVDARSPGRFSAEEAEPRAGVRGGHIPGAKNAHYASLVGANGEMLSPDVLRARFADAGVNLDAPI
    VCS
    CGSGITACAVALGLEVAGAKQVAVYDGSWTEWGSQTDTPVETGSTR

    >gi|226225570|ref|YP_002759676.1| hypothetical protein GAU_0164 [Gemmatimonas aurantiaca T-27]
    MAVEYLSPAEVVARLNGDTQLQIIDVREPWEYGIAHIEPSELIPLSELPGRVQSLDPERPYALLCHHGMRSEMAANWLVQ
    QGFQQLINIEGGIDAWSHQVDPDIPRY

    >gi|226225635|ref|YP_002759741.1| methylated-DNA--protein-cysteine methyltransferase [Gemmatimonas aurantiaca T-27]
    MPNSRSSSSPAIRPAPSPEVAARMRHVAEYIASHADEPLPLARLARQADMSATHLQRTFTQVIGVSPKAYQSAQRLEQFK
    RRLREGDAVLDATFGAGYGSTSRVYEQVTGGLGMTPSAYRSGGAGESIVYAVRETGMGLLLMAATTRGVCLVEFGDSDAA
    LVARLTDEFPRAQLEPAGDTARAPLDAWMAALDAHMVQGAPRPDLPLDVRGTAFQVKVWRFLMHVKPGEVVSYTELAAGI
    GHPRAVRAVGSACGANRLAVLIP
    CHRALRGDGSLGGYRWGLDRKRTLLDRERRSAAEHSSRSHAQSSGALADG

    >gi|226225854|ref|YP_002759960.1| hypothetical protein GAU_0448 [Gemmatimonas aurantiaca T-27]
    MTDTTSGAPHDHGRGEESNALAEFRQFRERMNTRILGENNLVMNRFFNLDGRAYEGGALDVKTKELLGLVASMVLRCDDC
    ITYHIVRCGEEGVTRDEVFETMSIGLIVGGSIVIPHLRRAVDRWDEVERMRG

    >gi|226225882|ref|YP_002759988.1| dihydrolipoamide dehydrogenase [Gemmatimonas aurantiaca T-27]
    MTSTTSQTADVLVLGGGPGGYVAAIRAAQLGFSVTCIEADKTLGGTCVTVGCIPSKALLQSSEHYEWLRLHAAEHGVKVE
    GATVDLPAMMARKTDVVAQNTKGIEFLFRKNKITWAKGFGTLKTGNVVEVKDTDGNVTSWQGKHVIIATGSVPVQLPFLP
    FDEQRVLSNVGALQIPEVPKHLIVIGGGVIGLELGSVWRRLGAKVTVVEFAPTILPGNDDDVIKEADKILRKQGLEIHTG
    TKVTGADVRADGVTIHAEKDGAALSFDGDYVLVSVGRKPSLSGVDAAALGLALGQRGEIAVNDQMRTNLPNVFAIGDVVG
    GKLLAHKAEDEGVIAAEVIAGKPVHMHYRTMPGVVYTWPEIATVGLTEQEVKASGRAYRVGKFPFSANGRARTMGETQGF
    VKFVVDKDSDEILGCHMIGPHVADNLAQVVLAMEYRGSAEDIAITVHSHPTLSETVKEAALSALGRALHM

    >gi|226225948|ref|YP_002760054.1| hypothetical protein GAU_0542 [Gemmatimonas aurantiaca T-27]
    MRLVSLLPAATEIVALLGATDSLVGVTHECDYPDILGSRARVTKSALPDTHDPAAIDDAVRSQNAEGLALFTLDETKIRA
    LHPDVLLTQALCDV
    CAVRETDVRALADRLAPVPTVVTLGGTSLDGIYDDIRAVAVVMDALDEAEELLAGLHDRVRHVHET
    LKAAKAPRPRVALVEWTSPVYLAGHWGPEQIRRAGGVDVLGVAGAHSVPIGMDALREADPEIVVFAQCGYGVSAAADEAR
    ACLSNPEWSWLAGRAVWAMDANGLTTRPGPRVVDGIEAMARIFNPSLFSPIDRRHAVRVS

    >gi|226226026|ref|YP_002760132.1| thiol-disulfide oxidoreductase ResA [Gemmatimonas aurantiaca T-27]
    MTVKQQWLVVVGIIALLGGGAFTASHFLKDELTSVTVGSDAPGFIAQTLDTPAQTKSLTNYRGDVVVLNIWATWCIPCRK
    EMPSMEALYKELGPKGLKIVAVSVDDAGAGQKIREFVAEYGLTFEILHDGAGTIQGIYRTTGVPETMVIDRDGVIRKKWI
    GEDDWSSAGNRKLLEQLLAQPKS

    >gi|226226109|ref|YP_002760215.1| putative methyltransferase [Gemmatimonas aurantiaca T-27]
    MTTPVDVSDVVRSKYGEAARRVLNAEGAAAESCCGPVNSCCGGSAFNGMVDPITSNLYVNGESDVLPSAAMLASLGCGNP
    TALAQLNPGEVVLDLGSGGGIDVLLSARRVGPTGKAYGLDMTDDMLTLARKNATEAGVTNVEFLKGQIEHIPLPDASVDV
    IISNCVINLSGDKRRVLAEAFRVLKPGGRFAISDVVVRGEVPEAVRRSMELWVG
    CVAGALEETQFKALLTEVGFVGPDVE
    PTRMYKSEDARVFLNDAGIDVDANLDQIDGRFMAAFVRATKPVSTSPTSGACCGPDCCP

    >gi|226226132|ref|YP_002760238.1| putative oxidoreductase [Gemmatimonas aurantiaca T-27]
    MPSTRRLTVLALLAGTLSFVTSACNQARTEDGKAPPAAQTAAANANAGAPAGPTTTSTGLTPTGTDSALTLRADSGRLMG
    TGAMWVVMISDYQ
    CPYCKSWHDSSMANLERDYIKTGKIRFAYLHLPLEGIHPHARAESEAAMCAGAQGKFWPYSNALFAA
    QGTVRTMNDVSPLLTRIAREQSLDLTAFNACRQSPAIRSLVEADIRQASQANVQSTPSFVVGEFMLRGALPYPDFAKAID
    TALVRFKQRTAAQAAGAPPGPGR

    >gi|226226151|ref|YP_002760257.1| dihydrolipoamide dehydrogenase [Gemmatimonas aurantiaca T-27]
    MASFDVIVLGGGPAGYVCAIRCAQLGMQVAVVEREALGGTCVLWGCIPAKSLLESAGLAQKIGKAAEHGITIDGVKLDFG
    PAMKRSRSVSQQNSKGVEFLFKKYKVQWLRGEGQLEKGKKVSVTIDGKKETHDAKKAVVIATGSRVKGLPQIGLELDKNV
    VLSSDDVLVAEKAPATMAVVGAGAVGVEFADVFAAFGTKVTILEVAPTILPIEDADCSAELAKAFKKRKIEVLTGAKISN
    VKVGKAGATMSVEAGGQTQTLEVEKVLVAAGRAPNVEKIGLEAVGITKSERGFVKINEKFETNVPGYYAIGDVAGNQMLA
    HKGQREGHVLADLLGGLHAHPVNYKNVPSCTYCHPEVASIGLTEQACKDQKLDYKVGKFPFSANGRARTSGETDGFVKII
    RDAKYGEILGAHIVGAHATEMIHELVVARENEFTVEEIDLAMHAHPTLSEAIGEAVLDSLGKMLHA

    >gi|226226358|ref|YP_002760464.1| putative oxidoreductase [Gemmatimonas aurantiaca T-27]
    MMHNTTSHDVLVIGGAFAGMAAATYLARARRSVCVLDTGKPRNRFAEASHGFLGQDGRAPQEILDTARAQLLGYWNVQVV
    QQEAVTARRADEGFVVTLASGEEHEARKVILAFGLRDTLQNIPGLEERWGRSVLH
    CPYCHGIEFSERALGVLYRTPMSVH
    QALLIAEWGPTTLYLHGEELAAEDAEKLAVRGVQVEPARIAQLVGNGHTLHAAQFADGRERTLEALYVAPRSCLSSPIAQ
    QLGAAIDDGPMGEMIRTDTNRMTTVDGLYAAGDIARAPHSVSWAVADGVTAGTSVHRALVFG

    >gi|226226412|ref|YP_002760518.1| putative vitamin B12 transport periplasmic protein [Gemmatimonas aurantiaca T-27]
    MSRFDGQVVLLVNVASQCGFTPQYEGLERLWRRFGDRGLVILGCPCDQFGAQEPGDEAEIARFCSLTYDVTFPLSSKLDV
    NGDAADPLWQWVKAEEPGVLGTTSVKWNFTKFLIGRDGTVLERFAPTVTPDELVAPVEQALAAPPVAG

    >gi|226226640|ref|YP_002760746.1| putative cytochrome c biogenesis protein [Gemmatimonas aurantiaca T-27]
    MSSLTPFPAPRLLWIAATTFVATAAMAACGGDAVPHDTTTVAASTIAFDSAHTLSAVTQVGAAPILALAPDGRHATAWVS
    APDGGTDGRLHVLVARDGDTTQVLRELTDPLGPIEPHGEAPPKLAWSTRAGGSSTLGALYVVGKLVPGRRFPASALRFVR
    SDDGGATWSSPVTVTDDTTKGLANGADFGSHNFHALHAAPDGTFYVAWLDGRAGKSAVYMTHSIDGGATWAANVRVVPMT
    STLTEACPCCRTAIAADADGTVYLSWRAVIADTSAPASSAAPATGGAADAHAAHGAASPQTIRDIVVARSTDHGATWSEP
    VRVHADNWIFDGCPHAGPSLAVDPSKRLHVAWWTGKPGAAGVFYTQSSDRGATFAAATSLGVAEASQPAHVQLAVAGTGA
    SSTVFATWDDGTKRVPQVTLRVSRNGGTTFDSATVVSAPGRSATFPVLTVDQAATALTIAWAEQTLETVAAAAPRPNMKD
    PNASMPLPRVGNTQVMVRRAKLGGVPAAQAATVDDAFRPLQTGDQAPSYGVRLVSGAQRGDSLQIVEPGRVTLLNVWATW
    CTSCREEMADLDALFARYRAQGLRVVAVSVDQGDPGKVVRFTEKEKLAMSIGHDPQGIVQRTYSVVGVPETYLIDGNGRV
    LWKTAGNIHGALDGARTAIEQALVKPVALAR

    >gi|226226656|ref|YP_002760762.1| thioredoxin [Gemmatimonas aurantiaca T-27]
    MANAVEVKDDTFATEIEQHEGLAVVDFWATWCAPCRMIAPIVEQLATDYAGQAKVAKLDVDNNQRTAARFNVRSIPTILF
    FKDGKLVDQVVGAVPRPALEAKFKEHV

    >gi|226226674|ref|YP_002760780.1| putative methyltransferase [Gemmatimonas aurantiaca T-27]
    MTDSAVTNIVREKYGEAARRVLQSEGSANCGPASSCCGGTAFNGSVDPITSNLYVSGETSELPDNAVLASLGCGNPTALA
    ELAEGETVLDLGSGGGIDVILSARRVGATGKVFGLDMTDDMLALARQNAEEAGVTNVQFLKGHIEAIPLPDNSVDVIISN
    CVINLSGDKEMVINEAFRVLRPGGRFAVSDVVVRGTMPDDVRRSMELWVG
    CVAGALEEAEFYRLLAGAGFTDADIEPTRV
    YRVEDAQQFLTESRLDTAHVAAMDGKIMAAFVRATKPKSCCGPDCCP

    >gi|226226756|ref|YP_002760862.1| hypothetical protein GAU_1350 [Gemmatimonas aurantiaca T-27]
    MAKEQHMHAESKPANWLSRTTDAGLILLVMLMAVLLLRREFGERGGQATSSDTRNTPTYSALVDSNTTTGHLSGSVDAVA
    KFVVFNDLE
    CPFCAAFHKTLGEARARHRGSVSVRFVHFPLNSHRFAKPAALAVECAGKVGRFDSMVDVVFKKQDSLGLAS
    WRSLAAEANVSPLDEFERCLAAGTGQFLDIEAGVRLGRSLNAPGTPTIYVNGWKLLAPPDSSEIDDMISRIHSGKSPVS

    >gi|226227393|ref|YP_002761499.1| thioredoxin reductase [Gemmatimonas aurantiaca T-27]
    MTDTRTENLVIIGSGPAAWTAAIYAARANLNPLVFEGEPVGTELPGGQLMLTTDIENFPGFPEAVSGPELMDRIKAQAVH
    HGARVVSELVKSVDFSQRPFRITPNYAEPLTAHTVIVATGAAAKWIGLESEMRLAQSGGGVSA
    CAVCDGAMPFYRQKRLI
    VVGGGDTAMEEAMYLTKFASEVVIVHRRDSFRASKVMANRVLTHPKVRVIWNSRVTEVVGSDFITGVRLEDVSTGATSEL
    EAGGLFVAIGHTPNTRFLNGQLETTEHGYIKVAPWRTATTVDGVFAAGDVIDDYYRQAITSAGTGCMAALEAERWLAHHG
    IGESPVLETGESTISTAPGGHSA

    >gi|226227407|ref|YP_002761513.1| putative iron-sulfur cluster insertion protein ErpA [Gemmatimonas aurantiaca T-27]
    MVVLTPVAAGEVVKFMEAEGVTAEKGGLRVSVMPGGCSGFKYGLVIEDAQAEDDITVDVGGIKIFVDPFSAQYLSGTTID
    YVSSMQGSGFTFKNPNSTGGCGCGSSFSA

    >gi|226227423|ref|YP_002761529.1| putative thiol-specific antioxidant protein [Gemmatimonas aurantiaca T-27]
    MTANTTAPLTAGTVAPDFTVASTSGQNVVLSGYRGQKNVLLAFFPLAFTSVCTSELCGFSDDFDAFTQGNVEVLPMSVDA
    VPSLKEFRSKYAMKVELLSDFKREVSAAYGVLREDTGFSNRAYFLIDKEGVIRWAHVEETPGQKRENAEILEAIKNVIV

    >gi|226227547|ref|YP_002761653.1| thioredoxin [Gemmatimonas aurantiaca T-27]
    MGARAKERRQPSYAITTRAGGLLTPDSLRGRVVLVNIWATWCPPCRAEMPLLQQLAEAYASDSVVVLGLSVDRGPARTVD
    AFLAERGITYPVAIVSDEVVRAFGGVRGYPTSLLLDKQGVVRHTVMGPVGPVTLRPALRRLIAEPRDAASPPPRH

    >gi|226227906|ref|YP_002762012.1| bacterioferritin comigratory protein [Gemmatimonas aurantiaca T-27]
    MPIAAGQPAPDFTLLADSGKPLTLSSLRGKWVVLYAYPKDSTATCTVQACDLRDGVPRFRRRKTVVIGISPDSVTSHQRF
    KAKNTLPFTLLADPEHVVLQAYDVWKEKLLYGRRYMGVVRTTFLIDPSGQIVRVFERVKARGHAEELLAAIAELA

    >gi|226227956|ref|YP_002762062.1| hypothetical protein GAU_2550 [Gemmatimonas aurantiaca T-27]
    MFFRQLYDQSLAQASYVIGCQATGEAIVVDPLRDIAPYLEVARAEGLRITHVTETHIHADFVSGARELRAATGAQLFLSA
    EGGTDWQYGYAEADGATLVRDGSQIMVGNLRFDVMHTPGHTPEHIAFVVTDTPRAAGPMGILTGDFVFVGDVGRPDLLER
    AAKVANTMEAGARTLLHSLDRFRALPDHLQVWPGHGAGSACGKALGAVPSTTVGYEKLANWAVAETNEALFVEQVLAGQP
    EPPRYFADMKRINREGPALLDTRTPLEMLDPADVLDRLPSDEVWVIDLRTASAFADAHVPRTLSVPYGRSFSGWVGSLVP
    IARDVILLSTIADAVDDTGQAVAGAHTPADVRQAAHDLMAIGFDRVQGWTSAQGLLGAWDSRGHSPSRIPQLTSAALSEV
    PAERAPTIIDVRGLSEWSGGHLPDARHIPLGALPDHLGNIPAGPVVVQ
    CQSGARSAVATSLLHRAGRTDAVNLVGGYQAW
    RAAGLTTV

    >gi|226227965|ref|YP_002762071.1| putative thioredoxin [Gemmatimonas aurantiaca T-27]
    MSASSVLPAVTDADFVDLVLGAPDLVLVDVWAAWCTPCLTLSPVLERLAEAYRGRMRVVTLDADANVETVVKYDVRALPT
    VLAFRGGVLVARQSGAQSYGTYTALVDRLLEASAAAPVAAPAVREAWDAPVADQDPAMAEAQALSAAAEPMVLFKHSATC
    SISVSVKREYDAFVAANPDVPTRLVIVQDERPLSNALARVLRVQHESPQAIVVRQGEVLWHASHRRVTAAGLTNAVRG

    >gi|226228008|ref|YP_002762114.1| putative oxidoreductase [Gemmatimonas aurantiaca T-27]
    MAKPSPKKKSNTAFLAVILVVLVAGGAGIWTAMKNSKPTPIELAPGTPLPQAQGYLYGDPNAPITIIEFADFECPGCGQF
    ATVQEPDLRKRVFDAGLANFRFYDFPLTSIHRNTLAAHLAASCANEQGKFWEYHDLLFEGQYDWNSQAASNPRKIFDGYV
    TKLGLDAAKFGECYDSQRNLAQIQANAAAGSERGVNSTPTIIIGNKVYSPAPTADQLKQIVDSIRATLPATTPAPATDTT
    KK

    >gi|226228030|ref|YP_002762136.1| putative peroxiredoxin [Gemmatimonas aurantiaca T-27]
    MSIRSRFAALAASIAFVPALVGAQSAPAGPAPLKVGDAAPDFTVATATAAGLSAKPFKLSEHRGETVILAFFPKARTRGC
    TVQMESYRDRYAELFKSGQKVTLVGVSVDPDSALTSWAKDAKFPFQFAADVDRKVGVAYAANTGEGFHKRLLYVIDPQGK
    IAYVAAPFNQMSADAYTDLGSAITKAGHGAH

    >gi|226228068|ref|YP_002762174.1| putative hydroperoxide peroxidase OsmC [Gemmatimonas aurantiaca T-27]
    MERTATAVWNGSIREGSGTLTTPSGVLNAQPYSFKLRFEDESGRSGTNPEELIAAAHAGCFTMALSGQLTKAGHTAKELR
    TNAVLTLEQQATGFTITKIQLQLTASVPGIAEEEFQALAKTAKEN
    CPVSKVLNAEISLDATLL

    >gi|226228123|ref|YP_002762229.1| hypothetical protein GAU_2717 [Gemmatimonas aurantiaca T-27]
    MKTAQQLIAEAKAQITEVTAREVQDALARGEAVELIDIREQNEWSLGHAKPAQYIGRGVLENQIEAKVPRDARVVLMCAS
    GNRSALAAVTLREMGYANVASLAGGFRDWVASGGEVAG

    >gi|226228219|ref|YP_002762325.1| thiosulfate sulfurtransferase [Gemmatimonas aurantiaca T-27]
    MSPVASLPGHPDPAIVAKGYAHPERLVSTEWLAAHLDHPSLRLLECNEDVLLYSVEHIPGAQKLDWHIDLNDQVERDYIA
    RAAFEQLLRSKGIDDTTTVVFYGDKNNWWATYAFWVFQLFGFDNAVVLDGGRAKWIAENRPTTTDVPIFAPTAYVAGERN
    DTRIRAYFGETKAHMEAGGPMVDVRSPQEYTGEKLHMPDYPQEGTLRGGHIPGARSMPWAKAADADGSFKSADALRALYE
    GELGLSPKAAVVTY
    CRIGERSSHTWFVLTYLLGFDNVRNYDGSWTEWGNAVRAPIRKGETP

    >gi|226228250|ref|YP_002762356.1| putative oxidoreductase [Gemmatimonas aurantiaca T-27]
    MAFTKLVSVELYADLVCPWCWIGDRRLWRALTVVQEAHPHVGFDVVWRPFQLDPSLPPEGRDWEEVIENKFGGRARAEPM
    FARVAEAGAPDGCVFHFDRITRMANTARAHGLVVHAQQTEGDTWALVESIYARHFTEGADLGDADTLRQLGRAAGFSEAD
    LTQIVDEGRYDLDVQQSQREAARLGIQGVPFAVLDGRYGISGAQPEEVFVQALTQVVNE

    >gi|226228309|ref|YP_002762415.1| cation-transporting P-type ATPase [Gemmatimonas aurantiaca T-27]
    METVRIPVSGMTCAACSSRVQRALQKQPGVADANVNLMMKSATVTFDPAAVSPESLIATIEDTGYGASLANPDQTAFEEQ
    EARDRAQNDEYHELRRKAVVSGVIGVIAMIVSMPLMSMLAGEDHAHGAQSSGAVVVDPFMRWSMDTLDPVLRSVMPWLYT
    VPASVLTGGLLVATLVVMVWAGRHFYTRAWAAARHGAADMNTLVSVGTLAAFGYSLVATFSPAFFTTRGVAPDVYYEAVI
    IIIALILTGNMFEARAKQRTSAALRALVDLQPQTARVLRFDAEVDAPVDTIEAGEVIIVRPGERIPVDGQITQGESAVDE
    SMLTGESLPVAKQVGDRVIGGTINRTGAFRYSATTLGANSVLAQIVKLMRDAQGSRAPIQRLADQISAVFVPVVIGLAAL
    TFGIWYFAADQAPLVRAFASAVAVLIIACPCAMGLAVPTAVMVASGKGAQLGVLIKGGEALQRAGDITTVVLDKTGTITQ
    GAPTVTDFLVAPALAIDADVLLQRVASVEHASEHPLAESIVQHAQAKGLTLGTPESFASVTGRGVQGVVDDAAMAVGNAA
    FMHDWGISVDALEADAVRLAGEGRTPMYIAMDGALAGLVAVADPIRDSSPRAIADLHALGLTVVMLTGDNERTAQAIARA
    AGVDRVVAGVMPDGKVREVQRLQDEGAVVAMVGDGINDAPALAQADVGMAIGSGTDIAVEAGDVVLMRGDLQGVVRAIAL
    SRRTMRTMKQNLFWAFIYNVIGIPIAAGVLYPAFGLQLSPILASAAMAFSSVSVVANSLRLRRVTFA

    >gi|226228310|ref|YP_002762416.1| heavy metal-binding protein [Gemmatimonas aurantiaca T-27]
    MQSLKLEISGMSCGHCVKAVDKALSKVDGVTVQSVGVGEATVSFDPSRATSQQLAEAVADAGFQLTGSH

    >gi|226228380|ref|YP_002762486.1| hypothetical protein GAU_2974 [Gemmatimonas aurantiaca T-27]
    MTARIANPAALVPDLLKAMLGLESAIRTSGLDHGLLELVKMRVSQINRCAFCLHLHATELQKAGENAMRIHLLPAWRESA
    AFTPREKAALGWAEALTLLADTQAPDADYDALREQFTDTEQVQLTMAIGAINVWNRLQVGFRAGHPPVSLPHAA

    >gi|226228571|ref|YP_002762677.1| thiol-disulfide oxidoreductase [Gemmatimonas aurantiaca T-27]
    MQRSPRGAARRYVAWRDADARARGLAEPADVATHTSVRDARETFAFDFKDVSGARVTNRDARYAGKVVVVNVTGTWCPNC
    HDEAPFLSSLYRKYREQGLEVVALDFEETEELQDLSRLKAFVKRYDVDYAYLVAGEPKEVTAKLPQAVNLNTWPATFFLG
    RDGTVRAVRTGFAAKASGVHHETLVAEYEAIVEGLLKEPVSGASGR

    >gi|226228636|ref|YP_002762742.1| putative thiol-specific antioxidant protein [Gemmatimonas aurantiaca T-27]
    MRIGQTAPDFQADTTHGSIRFHEWLGDSWGIIFSHPKDFTPVCTTELGYVARLAPEFAKRNVKVIGLSVDPTDRHSEWAK
    DIQETQGYMPEFPMIGDTELAVSKLYDMLPEEAGESCEGRTAADNQTVRTVYVIGPDKKIKLILAYPMTTGRNFDEILRV
    VDSMQLTAKHRVATPANWQHGEEVIIAGSVSNDEARTIYPDGWKEPKPYLRIVPQPGA

    >gi|226228639|ref|YP_002762745.1| putative thiosulfate sulfurtransferase [Gemmatimonas aurantiaca T-27]
    MTMPVRAPLAGLCSLTAPAFRVALTAVALTLTSGFMPHAAQAQSPAPSPLKIVSTEWLAERLSDPRLVIIQVEGKNSPDV
    VRIPGARVIPYSALTTRRGPLTTELPDVDSLASLFRNLGVSDASTVVITTSQESPMAARALMSLDYLGHGSMAFLDGGVA
    RWTAQNRRTTTEAPVVTRGTFTPRVRQDLVATADWISGAQQQGRIALIDTRTDGEYAGGGNRSGMPSAGHLQGARQLEWE
    QLFTDEKHFQLRDSTQLRQLYTERMRGGDTVVTY
    CWVGYRASMTYVAARALGLPARFYDGSYQDWQQRQLPVVAGTSPRE


    >gi|226228986|ref|YP_002763092.1| thioredoxin [Gemmatimonas aurantiaca T-27]
    MRQPRLRAFPTCGSPTSPDMPAFFAAARRAAVATTLASAAALAALAISPVLPIAAPLAAQDLGIAVGEKAPGGPLETMAG
    QTVDLSSYMGKQPVVIEFWATW
    CGNCKQLEPAMRAAMTKHGAKVKFVTVAVSVNQSYDRVKAWQAANKLPGDLLYDRKGT
    VSGEYDVPATSYVVVVDRAGKIVYTGVGGTQDLEAAIKKAL

    >gi|226229053|ref|YP_002763159.1| putative molybdopterin biosynthesis protein MoeB [Gemmatimonas aurantiaca T-27]
    MDANLTQHAPPVASPDSAAGLTSDERDRYRRQLTLPSFGLEGQERLKTSRVLIVGAGGLGSPAALYLAAAGVGTIGLVDH
    DVVDITNLHRQLLHGTSDVGRDKLASARDRLRDINPLVQVVAHDSWLTSANAMDIIANYDLVIDGADNFATRYLVNDACV
    LLGRPNVHGSVFRFDGQASVFGMPDGPCYRCLYPEPPPPEMVPN
    CAEGGVLGVLPGLVGTIQATEAIKVLLGIGTSLAGR
    LLMIDAMRMQFRTVMLSRDPECPACGTRTITALIDYDQFCGTPGLHALADARAEEISVATLRGWIDRNERITVIDVREPT
    ETAAGVIGGARLVPMAELQAAMDTLPRDHTLVMV
    CKSGVRSARATRQLKAAGFTKVCSLAGGMVRWEEHHTAG

    >gi|226229078|ref|YP_002763184.1| hypothetical protein GAU_3672 [Gemmatimonas aurantiaca T-27]
    MAATLYGFRSCDMVRNAIKWLDANGVAYTFFDYRKDALDPAVVDDWFARADWELVFNRNSTTFKELPEQQKVGIDAQRAK
    QMMLAETNLIKRPVLDTGDQLLLGFKAANWATALGK

    >gi|226229080|ref|YP_002763186.1| organic hydroperoxide resistance protein [Gemmatimonas aurantiaca T-27]
    MNVLYRTAATATGGRTGQAATHDGALSVALVTPRELGGPGGEGNNPEQLFAAGYSACFLGALKFVASQRKVTVSPESTVT
    AAVGIGKRDDGQGFGLDVELTISLPGVDAATATELMQAAHVV
    CPYSHATRNGLDVRLSLAPSDAA

    >gi|226229187|ref|YP_002763293.1| cation-transporting P-type ATPase [Gemmatimonas aurantiaca T-27]
    MSTDTLRLAGTIRTAHPAVGEATLCAHCSLPVPSGLIQESAEHQFCCTGCHTAFAILHEHGLDSYYGFSQRREAPVQASG
    RSYEEFDHPTFAALYVQSLPGGLSRTELYLEGVH
    CASCVWLVERVPLLQTGVLRAELDVRRSLAVVEWDPNTITLSAIAR
    SLDVLGYPPHPFRGVARADMRRREDRAMLVRIGISGAIAINMMLAALALYAGELNGMDAGFTHFFRWVSFALMVPAFVWP
    GRVFFTGAWASVRTKSLHMDLPIAIALAAGLVRGAINTITGTGPIYFDGLALLIFALLVGRFLQQRGQRLAADSAELLHA
    IAPSTARIVEQGTVREIPAEALLPGMTLDVRAGETFAADGVVVLGQSTVNAALLTGESRPASVQTGELVYAGTLNVEAPL
    QVRVEQAGETSRIAKLLYQVEESARRRAPIVQTANRLAGIFTAVVLVLAAATFGIKASFNAPHALDDAIALLIVTCPCAL
    ALATPLAITVAVSRAAGNGMLIKGGDALELLASPGTMVFDKTGTITEGRTALVRWVGPAWVQPMVLALEAGSSHPLAEGF
    RQAWPTLGTPDVIDAQHVVGGGLEGTINGHRVRVGSPRFVAASLTATSDVMTAALRAEDDIGRTLTPVHVSVDGELVAMA
    GMGDRVRDDARTALDTLRANGWRTVLLSGDAVDVVRTVGVSLGFADGQAIGGASPEQKLAFIEDAKRRGRVVMVGDGVND
    AAAIAAANVGIGVQGGAEACLATADVYLTRSDLSALVELTDGSRRTLRVIRRNIALSIAYNVVGASMAMFGLLTPLAAAI
    LMPASSITVVLGSWYGFSFPRKDRTPPRGSRTELAAPHVLEVAA

    >gi|226229225|ref|YP_002763331.1| peptide methionine sulfoxide reductase MsrA [Gemmatimonas aurantiaca T-27]
    MADANGAQPQEVAIIAGGCFWGMEALLRDIPGVLDTDVGYTGGWLENPTYHDTHDSKSGHAESIRVVFDPTVLSYESLLE
    NWFFRMHDPTTLNRQGGDIGTQYRSAIFYTSDAQRETAERVKAQVQQSGLWSKPIVTEIVPEAKWWSAEGYHQDYLVKNP
    GGYSCHFMR

    >gi|226229226|ref|YP_002763332.1| peptide methionine sulfoxide reductase [Gemmatimonas aurantiaca T-27]
    MDTNGKTNSSTNSDTSGYTKPTAEELARTLTPEQFTVTQQCGTEPPFRNAYWDNHEDGLYVDVVSGEPLFASIHKFDSGT
    GWPSFTRPVAPNVTEHADNAYGMRRVEVRSKHGDSHLGHVFPDGPRTEGGMRY
    CINSASLRFIPVADLEGEGYGEYVSLF
    NDAASGGTHG

    >gi|226229228|ref|YP_002763334.1| hypothetical protein GAU_3822 [Gemmatimonas aurantiaca T-27]
    MQTLRFDNRFVDELPGDPDPRNQRRQVLGAAWSAVQPTPVTAPQLLAVAPDVAAMLGFSPEQTASPEFAAVFGGNALLEG
    MRPWAACYGGHQFGQWAGQLGDGRAISLGELVTTAGDRWELQLKGAGPTPYSRTADGRAVLRSSIREFLCSEAMHHLGVP
    TTRALSLVTTGDPVVRDVLYNGNPAPEPGAVVCRVAPSFVRFGNFEIFTARHDLTTLAQLVDFTIARDFPHIDGDVDARR
    AAWFREVCERTAHLMVHWMRVGFVHGVMNTDNMSILGLTIDYGPYGWLDNFDPQWTPNTTDAQGRRYRYAQQPAVAQWNL
    MRLADAIAPLFRDVTPLQAGLDHYGDVFLVAHEAMQAAKFGFVRQGPDEDALITEAFALMERVDIDFTRFFRALGDAPAA
    LGDASAVTVLGDVFYDATLRDTHADALTAWLRRWHVAVGRQRPDAATRRTAMHAVNPWFVLRNYVAQQAIDAATAGDPSQ
    VRLLLEVLRRPYDEQPEHAALVARRPEWARHKVG
    CSMLSCSS