Gallionella capsiferriformans ES 2 uid51505

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|302877333|ref|YP_003845897.1| Rhodanese domain-containing protein [Gallionella capsiferriformans ES-2]
    MDLNAGSFVRKTGITLTSAAVLLFSSAVFAADTPASLKGATVVDAVKAKSLVDSGVKIIDARVANEYAEAHIKGALSVPY
    KEKSAKSADFDVTQDSVDMSKLPVDKNAGIIFY
    CNGAECWKGYKEATVAVKAGYKAVYWLRLGIPDWKAKGYPIE

    >gi|302877350|ref|YP_003845914.1| glutaredoxin [Gallionella capsiferriformans ES-2]
    MIKLFFKALRLILMPFMLLWAKLAMPRGIVRPPRIQDKIDAECRQLALYHFKTCPFCIKVRHEMARLSLPITLLDAQHDP
    KHRADLLEGGGKIQTPCLQITDQAGGVQWLYESKVIISYLQALSSPPTPEINT

    >gi|302877375|ref|YP_003845939.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Gallionella capsiferriformans ES-2]
    MVSLQPPLCDFGWKARDFDLLGVDGVRYTLANARGPNGLLVMFICNHCPYVKSIRDRLVRDAGQLKRQGINTIAIMSNDP
    ADFEEDSFENMKRVATEFAYPFPYVWDETQQIAKDYGAVCTPDFFGFNADLELQYRGRLDASRKEAVENAPRDLYDAMVQ
    VAKTGRGPQEQIASMGCSIKWKTE

    >gi|302877427|ref|YP_003845991.1| DSBA oxidoreductase [Gallionella capsiferriformans ES-2]
    MKLSLKGLLVALALLMCGTSYAAVQGKEFTLLAAPQIANAKKIEVLEFFFYECSHCYHLHPELARWEKALPADVELTLVP
    TIFRDSTEPLARAYYALDSIGKIKQLDDAIYQAIHVKQANLYDMDTISAFVASNGVDKAKFAAAYNSFSVNSRIMRAKQM
    IREYHIEGTPTLVVDGRYAITGLQPADTIRVLNEVVAMVRKGRASGKVKAKP

    >gi|302877453|ref|YP_003846017.1| UBA/THIF-type NAD/FAD binding protein [Gallionella capsiferriformans ES-2]
    MDDFQLQRYGRHILLDEIGIEGQQRLIESRVLIVGLGGLGSPASLYLAASGVGQITLCDDDSVDLSNLQRQIAHRTSSIG
    QSKVGSAAAAILDINPETHCIQFESRVNQTDLNQLVALHDVVLDCSDNFSTRYAVNQACKTHHTPLISGAAILFSGQASV
    FDFRDPNAACYNCLFPEDSDAENLR
    CATTGIFSPLAGIIGTIQAAETLKLLIGIQPGLSGKLLTVNALDMSFRHSVITKD
    HHCSRCSSS

    >gi|302877465|ref|YP_003846029.1| Rhodanese domain-containing protein [Gallionella capsiferriformans ES-2]
    MQFITSNFFPISLALMSGVMIIWSMLGSRVRGIKDVDTNAALQLINHKNAFILDVREPAEFKAGHILNAQLIPLGKLKER
    MGELAKYKDKPVVVV
    CRSGNRSGNACVALGKNEFTQAYNLAGGMMAWQKANLPTQK

    >gi|302877466|ref|YP_003846030.1| glutaredoxin 3 [Gallionella capsiferriformans ES-2]
    MYTTEVCPYCIRAEQLLQRKGVTEIEKIRVDLQPELRLHMVEITGRRTVPQIFINEQHVGGFDDLAALEQAGSLTALLAN


    >gi|302877495|ref|YP_003846059.1| electron transport protein SCO1/SenC [Gallionella capsiferriformans ES-2]
    MLLRNGFVFLLMLFIAGCGEPKLPSPFHAAEVGAKYAGADFKLTDHTGKLRTLHDFRGKVVVLFFGYMHCPDVCPTTMAD
    LSQVMTRLGKDADRVQVLFVTVDPERDTQALLAQYVPAFHPSFLGLFGDAGSTAQVAKVFDVMYQKQATATGYNVDHSAG
    SFLIDTDGRVRLLSPFAQRTDWLEQDIRLLLALGKS

    >gi|302877512|ref|YP_003846076.1| copper-translocating P-type ATPase [Gallionella capsiferriformans ES-2]
    MSHTETAHLAHAGCFHCGLPIASDAHYQKLLDHGQREFCCFACQSVCEAIYEAGLQGYYQRTPQGTLLAPPPMPPRDIEM
    YDLDDVQQDFVNCQGELRDAHLLVEGIH
    CAACVWLIERGMMRTPGVLSAGVNLAGKRLHLRWNERQVKLSTLIHQLAKIG
    YSGVPYDPEVAEGSMKRINRALLFRLFFAAFAMMNLNLIAIALYSGADRGQFVNFFHWMAFALATPALLYSGYPFYKGAL
    SGLRNASLTMDLPIAIGLTVTYVFSLYVTITGGDRVYFDTVTNLTFVILIGRYLEGMFRHQAVSATNRLMDLQPRVATVL
    REGDEKIVSVRAVKVGETVLVKPGSHIPMDGIVLEGSSSVDESMLSGESAHVKKQPDDRVSAGTLNGSGALLVEVQAASQ
    DSTLSKIIRLVEEAQSSKAPIQRLSDSIVPWFVLATLILASVTFYIWSADFEFALMAATSVLIITCPCALGMATPMSIAV
    ASGLGARHGILVKNGVVLETLSRVTHFVFDKTGTLTEGKMRVEQVVVAQGQDEEALLALCASVERYSEHSVARAVVIAAE
    ARELPFRDQLVQGFLATAGAGVEAEVAGRQILLGTADWLLKQGVVQSEQLIKVQDTSEAQAKTCVHLAVGGEHVAVLVIA
    DTLRVDAKALIDTLREAGIGMTLLSGDRRAVAEEIARQLGGMEVIAEVLPQDKDRVIQALQERGECVAMVGDGVNDAPAL
    IRADVGIALGSGTDVSVESADIVLMHNELDKVRLATLLSRRTLRTIKQNIGLSFVYNSIMVPLAIMGHVTPLLAAITMPV
    SSLLVIGNAARIRSLFK

    >gi|302877561|ref|YP_003846125.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Gallionella capsiferriformans ES-2]
    MAVLVGKAAPDFTAAAVMGNNEINESFNLKSHIAGKAAVIFFYPLDFTFVCPSELIAFDHRLAEFKNRGVEVIGVSIDSQ
    FTHLAWKNTPVNKGGIGQVGYPLVADIKHEICQAYDVELAGAGVALRGSFLIDKTGVVMHQVVNMLPLGRDIDEMLRMVD
    ALQFFETHGEVCPAGWKKGKAGMNASTEGVAQYLADHAQSL

    >gi|302877562|ref|YP_003846126.1| Rhodanese domain-containing protein [Gallionella capsiferriformans ES-2]
    MKLTTKKISLTLATLLLVMLGAQRLQATTDVDIDVTQAHTMNRQGALLLDVREPSEYTEVHAPNATLIPLGQLGARLDEI
    ASYKDKPIIVM
    CRSGRRSAKAVHLLQEAGYSHVSNIAGGILAWEKSELKVVRPN

    >gi|302877563|ref|YP_003846127.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Gallionella capsiferriformans ES-2]
    MKVVIIGGVAGGATAAARIRRNDERAEIVMIERGPYISFANCGLPYHISGTIEQREQLLVTSEPAFEARYRVDVRSRTEA
    IAIDRQAKLVRLRDLNTGDEYDESYDKLLLSPGAEPVRPKLPGIDSPRVFGLRNIPDLDRIMGHLEQHSPRRAVVIGGGF
    IGIEVAENLHEKGIFTTLVEGADQILLPLDYEMAAIVHSHMKDKNVELYLSDKVERFEDKDDHTVVYLGSGRRLQADMVV
    LAIGVRPETTLARASGLELGSTGGIKVDSHLQTSDPDIYAVGDAIEVTQFISGRQALIPLAGPANRQGRMAADNIVFGNK
    QQYRGTQSTSILKAFDLAAATTGLNEKQLIAAEIPFLSCITHSGSHASYYPGAKQISLKLLFSPEGRILGAQAVGADGAD
    KRIDVISTAIHGNLNVEDLAELELAYAPPFSSAKDPVNIAGYVAINLLNKSHEMIAWRELHARLLAKSSELQLIDVRTAE
    EYEFGSIATARNFDVNQIREHLDELDRNAPVVVF
    CQIGLRGYLAYRILKQHGFTQVSNLSGGYKTYSWAVDKQSNPDIFD
    YEDIKRRAPEVIEAERSGSAVLVAPGGELHTLNAVGLQCPGPIMKTYKAMEALDAGELLEVTVSDPAFGRDIRAWAKKTG
    NDVLSLKSDKGLIVVLLRKNKAVPVVALPAATRDKLTLVVFSDDLDKVMASMIIANGALAMGKPVSLFFTFWGLDVLRRE
    NAPARDKPMMDRMFSSMLPSGVDHLNSISKMDMHGLGAKMIRKVMHDKGVETPGHLLQSLVDGGAQMIACQMSMDVMGIH
    QSELIDGVEIGGVAAFLGEASESGTTLFI

    >gi|302877594|ref|YP_003846158.1| OsmC family protein [Gallionella capsiferriformans ES-2]
    MKARVKWVENVAFLGETESNHAVLMDGAPAAGGRNLGPRPMEMLLLGAGGCTSFDVMSILKKSRQAVTDCYVELDAERAE
    TDPKVFTKIHMHFVVKGRNIKPEVVEKAIKLSAEKYCSASIMLGATALVTHDFEVIQEQD

    >gi|302877601|ref|YP_003846165.1| iron-sulfur cluster assembly accessory protein [Gallionella capsiferriformans ES-2]
    MDATTAVTESQDLLVFTDNAAAKVKQLIEEEGNSELKLRVFVSGGGCSGFQYGFTFDEITNEDDTVLDKNGVQLLIDPMS
    YQYLVGAEIDYTEGLEGSQFVIKNPNATTTCGCGSSFSV

    >gi|302877668|ref|YP_003846232.1| dihydrolipoamide dehydrogenase [Gallionella capsiferriformans ES-2]
    MSQTIEVKVPDIGDFKDIAIIEVSVKTGDTVTAEQSLITLETDKAAMEVPSPAAGVVKELKVKVGDKVSKGSMVLVLEVP
    DSGIKIQYDADPKPDAGARSQDAATSEPRIPNPQSSDIHAEVVVLGAGPGGYTAAFRAADLGKQVVMIEKHSSLGGV
    CLN
    VGCIPSKALLHVAKVISEAEEVSHHGVTFGKPAIDIDAIRSWKESVVNKLTGGLKQLAKQRKVQVVQGVAKFVSANSISV
    ATPEGEKLITFDHAIIAAGSSVARIPGFPYDDPRIIDSTGALALQDVPKRLLILGGGIIGLEMATVYDALGSKISVVELM
    DQLIPGADKDMVKPLHTRIAKRYEAIYLKTKVTKIESLPEGLRVTFEGEQAPEPQLYDRVLMAVGRRPNGREINAEAAGL
    TVNDRGFIPVDKQQRTNVPHIFAIGDIVGDPMLAHKAVHEGKVAAENIAGHKAYFEPLTIPSVAYTDPEIAWMGLTETQA
    KAQGIAYEKGAFPWAASGRALSVGREEGMTKVLLDPVSRRILGAGIVGVNAGELIAEAVLALEMGADMEDIGLTIHPHPT
    LSETLCFAAEMAEGTITDLLPPRKRG

    >gi|302877699|ref|YP_003846263.1| Glutathione S-transferase domain [Gallionella capsiferriformans ES-2]
    MRLYSGTVCPYSHRCRIVLFEKGMDFEVIDVDLMDKSEDLAAISPGGKVPVLVERDLVLTEANIINEYIDERFPHPQLMP
    ADPVMRGRARLFLFRFEQELYSNVNIIMQGGKTADKARASIRDNLTQLSQILTKQKYLLGNDFSMLDVSVAPLLWRLDHY
    GIVLGKDAAPMLKYAERLFSRQGFIDSLTPAERAMRK

    >gi|302877887|ref|YP_003846451.1| iron-sulfur cluster assembly protein IscA [Gallionella capsiferriformans ES-2]
    MGVTLTEAAAKHVKNFIAKRGRGIGLRIGVRTSGCSGMAYKLEFADVLEADDLPFDSFGVTVLVDPKSLPYIDGMELDYT
    REGLNEGFKFNNPNVKDACGCGESFQV

    >gi|302877892|ref|YP_003846456.1| Disulphide bond formation protein DsbB [Gallionella capsiferriformans ES-2]
    MVNLWRRISNSWLYLAGFLYASGLMGFGFYLQYVKHQDPCPLCMVQRVIFIGILALYLIAATHGPKRAGARIYAALITLF
    SASGIAVAARHIWIQHLPADQVPA
    CGPGLDYMLETMPMANVLKELMHGSGECAARGWTFLTLGIPEWSLLCYFALGTWAV
    LIALKSK

    >gi|302878099|ref|YP_003846663.1| cadmium-translocating P-type ATPase [Gallionella capsiferriformans ES-2]
    MKHSMFNIRNMDCPTEEALIRKRLGAVTGISELTFNLMDRRLGVEHTLADEQPILDALREIGMNAVPVTEADTVSKSEAV
    THVVSRRTWIFMTVSGITAITSEIIVWSGADEQSLAVIALALLSIVTGGLGTLKKGWIALKNFTLNMNFLMSIATIGAIS
    IGQWPEAAVVIFLFALSELIETFSLERAKHAIRGLMAMTPETATVRIDGGEWVEKGAADVQVEQIVRVRPGERIPLDGVV
    TAGGSSVNQAPITGESIPVAKTAGDPVFAGTLNERGVLEFRVTATKGHTTLDRIIRSVQEAQGQRAPTQRFVDQFARYYT
    PAVVAFAVLVAVVPPLLFGAAFELWFYKALVMLVIACPCALVISTPVTVVSGLASAARQGILVKGGLHLENGRLIKIVAL
    DKTGTLTHGRPVVTDVIPLVDQAVDVLLQLAASVDAHSGHPVAAAIVSAWQTSADGSARLLLPVASFESLTGRGAKAVIE
    DQLYYVGNHRQVEELGICGPHVEEVLRRLEEEGKTAVVLTTENAPLCIIGVADTLRGHSVEAIKQLHALGVASVMLTGDN
    QTTANVIAAEVGIDDARGNLLPEDKLAVIDDLIARYGKVGMVGDGINDAPALARASIGFAMGSAGTDTAIETADVALMDD
    DLRKLARFIALSRYTSRVLRQNITLAIGIKVVFFALALAGKATLWMAVFADMGASLIVIFNGMRLLRIKGGIERDHIKSG
    HTR

    >gi|302878165|ref|YP_003846729.1| cadmium-translocating P-type ATPase [Gallionella capsiferriformans ES-2]
    MPEKLTLDLSLILPDVPDERDACAGRLTRLLQAEGLEKVHLVREDGGARLCLHYDPQLFSVSRVRELAQAAGAKLGNHYR
    HESLRIDGMD
    CPTCATVIEHALQRTDGVLEASVSYAAERLRLEYDSEKIGRPAILRRIQALGYAVLEEGREAGWFAEHRE
    LIFSGVAGLLLLAGWLAGLAGAPRNLSLGLLLGAYAAGGFYTLRDAWQSVKSRRFDIDTLMIVAAAGAAALGAWEEGALL
    LFLFSLGHALEHMAMDRARKAIEALAELAPKTAVVQRDGVEIEVRVEDLQRGDRVIVKPGQRIPADGQVASGNSAVGQSP
    VTGESMPVDKQPGDKVFAATVNGEGALVIEVTKLARESTMARMVEMVAEAQTQKSPTQRFTDRFECIFVPIVLAGAALLI
    ALPPLFGFPFAESFYRALAVLVAASPCALAIATPSAVLSGIARAARGGVLIKGGAHLENLGVLTAIAFDKTGTLTIGKPR
    VTDVVAISGNEESLLTIAAAVESRSAHPLAQAVVAEAKGRGLIWSEAGEVEAVTGKGLRAEFDGQKVAIGNAKLFDGKPI
    PDGIQQQAMRLEAEGKTTMLIQADGQFLGILALADTPREGVRQVLERLHQLGITKTIMLTGDNERVGRAIADAVGLNEVK
    AGLLPEDKVKAMGALAQRYGLVAMVGDGVNDAPAMAHATVGIAMGGAGTDVALETADVALMADDLSKLPFAVALSRASRR
    VIRQNLWISLGVVVLLIPATLFGWAGIGLAVLLHEGSTFVVVINALRLLNFRSPIVENDRPVPV

    >gi|302878587|ref|YP_003847151.1| hypothetical protein Galf_1361 [Gallionella capsiferriformans ES-2]
    MKWLDFKRDYLVQFWSPIPSVIAAGVLAAYYFGITGTFWAVTGEFTRWGGHLLQWFGFHPETWGYFKVIHLEGSPLSRVD
    GVMIIGMFAGCLSAALWSNNVRLRQPQHRIRIFQALAGGIIAGFGARLAMG
    CNLAAFFTGIPQFSLHAWFFALSTVAGTW
    FGARFVMLPMFRVAVKMQKVSAAQSLVQTPERAARRFRLGMLIFAGCVLWAIAKTFDAPKLGLAALFGLAFGILIERGQV
    CFTSAFRDLWLTGRTQMAKAIILGMAVSTIGVYSYIQLGVPAKIMWAGPNAVIGGLLFGFGIVLAGSCETGWMYRAVEGQ
    VHYWWVGLGNIIGATLLALCWDDIAPVLATRYDKVDLLVVFGKTGGLMVTYAMLALALLAVLWWEKRFFAAKTVAQEVV

    >gi|302878819|ref|YP_003847383.1| peptide methionine sulfoxide reductase [Gallionella capsiferriformans ES-2]
    MKRFIFMLATLLPLTGVAMTNNTQTAYLAGGCFWGLADLVRQMPGVIATEVGYTGGTTPNAVYEQVKTGRTGHAESLKIV
    FNPEKLSYRHLLFEFFRMHNPTTRNQQGNDIGSQYRSAIFYLDEAQQHTAMEVIKTAEASGELKSKIVTEVVPFREFYRA
    EEYHQQYLIKHPGGYTCHYIRRLNLGE

    >gi|302878900|ref|YP_003847464.1| thioredoxin reductase [Gallionella capsiferriformans ES-2]
    MTTQHHRLIILGSGPAGYTAAVYAARANLGPVLITGMAQGGQLMTTTEVDNWPGDVSGVQGPELMARLQQHAERFNTLMI
    SDHIHTARLQQKPFLLEGDAGSYTCDALIICTGASAQYLGLPSEEAFMGRGVSG
    CATCDGFFYRGQNVAVIGGGNTAVEE
    ALYLANIAKHVTLVHRRDTFRAERIMIDHLMEKVAEGKITLQLNSTLDEVLGDASGVTGMRVKDVQSGDKQDIELTGVFI
    AIGHKPNTEIFAGQLEMNNGYISTRGGSTGNATAASISGVFAAGDVQDQIYRQAVTSAATGCMAALDADKYLASIGKL

    >gi|302878916|ref|YP_003847480.1| selenide, water dikinase [Gallionella capsiferriformans ES-2]
    MSEVKLTQLSHGGGCGCKIAPALLQKILGDIKDKLPYPDLLVGTETCDDAAVYRLNDSQAIIATTDFFMPIVDDPYDFGR
    IAATNALSDVYAMGGTPIMALAIVGMPINKLPVEAIRAILQGGESVCRAAGIPLAGGHSIDSPEPIYGLVAIGVVHPDRL
    KKNSAARAGDVLILGKGLGVGIMAAALKKGALSAEGYQQLISNTTKLNTVGPALSAIDSVHALTDVTGFGLLGHLLEMCR
    GAGLTGEVSFNQVPILPAALELAQAGYGPGAIERNMESYGCDVQFAEGISSWQQRVLADAQTSGGLLVSVAPDAVQEVLA
    CFHQAGFEQAAVIGVMKAGSAKVVVS

    >gi|302878939|ref|YP_003847503.1| arsenate reductase and related [Gallionella capsiferriformans ES-2]
    MIKLYGNANCSTVKKARDWLTAHHIAVEFHDFKKSGLDASIVENWLSQRDQSELINRKGLTWRALTDEQKQSIKDDTSAL
    ALMIDKTSVVKRPVLEQAGRVLHIGFDPLAYAHLFNKEVKS

    >gi|302878953|ref|YP_003847517.1| copper-translocating P-type ATPase [Gallionella capsiferriformans ES-2]
    MKTHIDLQVTGMHCANCSSRLEKALNLLPGVNAAVSIATEKAHISYDPKTLTPEGLIKAIQETGFDAHPMRDFAAEKLAR
    LAALQSQQRQFILAALLTAPMLLQMLLMFAGIHLMLPDWLSFLLATPVQFWIGGRFYSGAWRSLRGGAANMDVLVVLGTS
    AAYFFSCAVWLLNLDQPVYFEAGATLITLVLLGKLLEAHAKGKTSSALEALISLQPKIAHVERDGVMLEMAIDQMRIEDV
    FLVRPGESVPVDGIVLSGSSAIDEAMLTGESLPQSKSKGDTVYAATLNGLGVLKCRAQAIGSHTRLAAIIRLVEQAQGSK
    AAIQQLADKLSAVFVPTVVCIALLTFVAWWVAGSTLGTALINAVAVLVISCPCALGLATPTALVVATGRAAQTGILVKDA
    EALERTHKLSVLLVDKTGTLTEGHPAVTDLLPHGDLTGDELLKISAALAQGSTHPLSRALTAHASTLRIDTEQAGNIREF
    PGQGLCAEINGMSYLLGSPAFAAGRAVALDDQRITALQQQGKTVLVIAQDSALLGYIAVADPLRPTSRSAVSKLIKLGIR
    VIMISGDNPVTSQRIADQAGISEFRANVRPEEKAALVESFKQGGNTVGMVGDGINDAPALAAAHVSFAMRGGSDIAIEAA
    DITLMKSDLMSVVDAISLSRAALAKIRQNLFFAFGYNVLGIPLAAAGMLNPVIAGAMMALSSLSVVSNALLLKRWMPAVE
    D

    >gi|302878978|ref|YP_003847542.1| periplasmic protein thiol/disulphide oxidoreductase DsbE [Gallionella capsiferriformans ES-2]
    MMRFILPFVIFLVLSVFLYKGLGRDTREVPSPLVGKAAPAFVLPLLHEPEKKFSPEEMKGKVWLLNVWASWCGACKDEHP
    ILMELSRQNIVPIVGLDYKDKAVDGEMTLKRAGDPYSLVIADLDGKVGFDYGVYGVPETYVIDKQGMIAYKLIGALTAQN
    LRDTILPKVAELQAK

    >gi|302879021|ref|YP_003847585.1| thioredoxin [Gallionella capsiferriformans ES-2]
    MTESLHIVCPHCDGINRVPGDKLTENPVCGKCKASLFNAHPVELNAGNFNRHIGRSDIPVLIDFWAPWCGPCKMMAPAFV
    KAAALLEPRMRLAKLDTEQAQELAAQYNIRSIPTLALFKNGREIARQAGAMDVNGIVQWARAKL

    >gi|302879100|ref|YP_003847664.1| Thioredoxin domain-containing protein [Gallionella capsiferriformans ES-2]
    MKQIARSLMLLLALIFPLLAHALGEPYTQEKMDALNKAEKPVLVTIHANWCGTCRAQERVLEKLLSKAEFREITILRVDF
    DQQKPVVHKLGAKYQSTLIVFKGGEMAGRMTGETDSDRIARLLYSAL

    >gi|302879103|ref|YP_003847667.1| hypothetical protein Galf_1895 [Gallionella capsiferriformans ES-2]
    MKMQRLYLGASVLLMLLLTWQTVLHESALLLIPLGALLGVAFHHAGFGFTGTYRMLLEAGSVRLVQAQLLLLALTTLLFA
    PFLAAASFNGHSIVGAVAPLGFGVTTGAFMFGIGMQLAGGCGSGTLCGFGSGNTRLFFTIITFCFGGWLATLHADWWENL
    PAWDAPALGDMLGWPLAVGLQLAVFALLWRATLLWGKRDEVNTVQVYTWWRGPWPLYLSMLLVALLNLAVLLQTGHPWVV
    TWAFTLWGAKMAAALGWDAEGSTFWNNDYRLDQLQGSVFTDETSVMDMAIILGSLIAAALAGVLKPNLRLTLLPLLAALL
    GGLLMGYGSRIAYG
    CNIGAFLSGISSTSLHGWLWILAALPGNWVGIKLRGVFRVE

    >gi|302879105|ref|YP_003847669.1| Mercuric transport protein MerT [Gallionella capsiferriformans ES-2]
    MSETKTGRGALFIGGLAAILASTCCLGPLVLITLGFSGAWISNLTVMEPYRPIFIGAALVALFFAWRRIYRPEGACKPSE
    VCALPQARRAYKSIFWIVVMLVLVVLSFPYIAPLFY

    >gi|302879108|ref|YP_003847672.1| mercuric reductase [Gallionella capsiferriformans ES-2]
    MINESPHIAIIGSGGAAMACALKAVERGARVTLIERGTIGGTCVNIGCVPSKIMIRAAHIAHLRRESPFDGGISAIAPTI
    QRDNLLAQQQGRVDELRHAKYEKILESTLDINLMHGEARFKDGHTLIVQKLDGSEREVPFDRCLVATGASAAIPPTPGLK
    GTPYWTSTEALVSPAIPPRLAVIGSSVVALELAQAYARLGSKVTILARHTLFFREDPAIGVAVAEAFRTEGIDVRTQTQA
    SSVSFVDGEFMLVTNQGEFRADKLLVATGRSPNTRSLGLDNAGVALSPQGNIVIDDQMRSSAPDIYAAGDCTDQPQFVYV
    AAAAGTRAAINMTGGEATLDLTAMPAVVFTDPQVATVSLSEAEAHDKGIETVSRTLTLDNVPRALANFDTRGFIKIVAEA
    GSLRLVGVQVVAPEAGELIQTAAIAIRARMTVQDITDQLFPYLTMVEGLKLCAQTFTKDVKQLSCCAG

    >gi|302879112|ref|YP_003847676.1| Methyltransferase type 11 [Gallionella capsiferriformans ES-2]
    MHEAVQDYYGKQLQTSDDLKTSACCDASALPAWLKPLLAKVHPEVLSRYYGCGLVCPPRLEGCRVLDLGSGSGRDVYALA
    QLVGKTGEVVGVDMTPEQLAVAEKYRAHHAEQFGYANVRFLEGYIEKLDELGLEPGSFDVIVSNCVVNLSPDKDAVLRGV
    HRLLKKGGEFYFSDVYADRRVPDAVRNDPVLYGE
    CLGGALYWNDFIRLAQRHGFADPRLVEDRPLDITDPKLAPRVGNLK
    FFSATYRLFKLDNLETACEDYGQAVIYRGSIPDHPDAFTLDKHHRIETGRVFPV
    CGNTWRMLQDTRFAAHFEFIGDFGRH
    YGLFEGCGAAIPFDAKTGTEASCACC

    >gi|302879123|ref|YP_003847687.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Gallionella capsiferriformans ES-2]
    MKRGLLILLIFGLIVGFFVLDLGHYLTLESLKHWQQDFITLKAQSPWLVTGGFFIAYVVSTALSLPGAVILTLAAGALFG
    LGVGVLLASFASSFGATLAFLASRFVLRDAVQQRFGDKLKAINEGFARDGALYLFTLRLVPVFPFFLINLLLGLTPMKTR
    TFYWVSQVGMLAGTLVFVNAGTQLAALQSLSGILSPPLLLSFVLLGVFPMIAKKFTAWLQRRVYAKWQRPARFDRNLIVI
    GGGAAGLVSAYIAAAVKAKVTLIETHKMGGD
    CLNYGCVPSKALIKSAKLASQIRHGEHYGLNAGAPEFSFRKVMARVHKV
    ISEVAPHDSAERYTSLGVEVLQGYARITDPWTVEIKLNDGTTQTLTTRSIVIATGARPFVPPLPGLEEVGYVTSDTLWST
    FAELDAAPKRLVVLGGGPIGCELAQSFARLGSNVTQVEMAPRIMIREDLEVSELARASLSADGVEVLTDHKAVRCEKEGE
    RKYIVVEHEGQSRRIEFDVLICAVGRSARLKGFGLEELGIPVQRTVTTNDYLETLYPNIYAAGDVAGPYQFTHTAAHQAW
    YAAVNALFGDFKRFKVDYSVIPWATFIEPEVARVGLNEQEAREQGVAYEVTKYGIDDLDRAIADGTANGFVKVLTVSGKD
    KILGVTIVGEHAGDLLAEFVLAMKHGLGLNKILGTIHTYPTMAEANKYAAGEWKRNHAPQRILAWLERYHAWKRG

    >gi|302879124|ref|YP_003847688.1| radical SAM domain-containing protein [Gallionella capsiferriformans ES-2]
    MHATLPLLQATEFPALRRRELEILQVNLGYKCNMSCMHCHVNAGPNRTEMMDCSLIELIPRVLAARNLHTLDLTGGAPEL
    HEDFRDLVRAARKQGCKVIDRCNLTILFEPGQEDLAEFLAEQQVEIVASLPCYSLENVDKQRGKGAFDKSILGLQKLNAL
    GYGQPGSGLALNLVFNPQGASLPPDQSALQIDYQRELFTHFGIVFDQLLAIVNMPIQRFGSMLISKGKFNDYMRLLHDNF
    ASANLETVMCRNLISVDWKGFLYDCDFNQQLGLTIAGQGRPHLKDLLQQDMKGKSIRVADHCYGCTAGQGSS
    CGGALKDE
    SVQRCAA

    >gi|302879138|ref|YP_003847702.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Gallionella capsiferriformans ES-2]
    MNLLKSIFISSYMMAIMGIAGYAGWMLYQGESLMAWGGVLLTVAPILTVIMRAMMLKDMARTSAHFPLINLLGLAGTALA
    GFGGPSTGAATLLAVVGWVAFLLYSYWFSTYGDRQPSMKLVVGSKLPHFTVRDVNDNIVSSAQLTNKPAILIFYRGNW
    CP
    F
    CTAQIKELMARYKQLDALGVRVALIAPQPHENTVGVSKTYDAKFDFLTDEENAAARALGIEHKNGLPMGMQALGYDSDT
    VMPTVIITGKDGKIVWTHETDNYRVRPEPDTFLEVLRLHGVVTA

    >gi|302879208|ref|YP_003847772.1| OsmC family protein [Gallionella capsiferriformans ES-2]
    MYQLSMTDASQLHVHYKNHVISYGVDGSLPNPLEATYAALAGCAGVYTRKACKALGISAEGIEISCKPVVRQGNMLIPAR
    FVTEITFPERITAEQREQILAEISHCAVKELIHDGAQIEFVTVEAA

    >gi|302879248|ref|YP_003847812.1| Peroxiredoxin [Gallionella capsiferriformans ES-2]
    MKWFAVFAALIIFASLFVARAARAGNLPEIGKPAPDFKLNDQHEKLHSLQSYRGKWVVLYFYPKDDTPGCTQEACAFRDD
    LAQLTELGAKVIGVSVDDSASHAGFAKKYHLPFPLLADKQGEVAASYGALLNLGVMKVARRFTFLIDPQGNLKQDYLNVE
    TSRHSKEIIEDLKKLTAGEPK

    >gi|302879378|ref|YP_003847942.1| DsrE family protein [Gallionella capsiferriformans ES-2]
    MKLGIVIYSNDPETVWNAFRLGFFSRKQGDAVSVFLLGKGVEAESLVSEKFDVTGQMRSFSALGGSILACGTCLKLRQSE
    GSDICPVSTMQDLYALIRDSDKVLSF

    >gi|302879381|ref|YP_003847945.1| cadmium-translocating P-type ATPase [Gallionella capsiferriformans ES-2]
    MKHSMFNIRNMDCPTEEALIRKRLGSMPGIGELSFNLITRRLAVTHTLDDEQPILDALREIGMKTDPEPQCQSGSCSSCE
    AESPVVSRRTWALMAVSGTAAMVAEIVAWNGASEQSVAVIALALLSIVTGGLSTLKKGWIALKNFALNMNFLMSIAVIGA
    LAIGEWPEAAVVIFLFALAELIETLSLERAKNAIKGLMAMTPEVATVQLDNGEWRETAVTDVQVGQVVRVKPGERIPLDG
    VVTAGGSSVNQAPITGESMPVVKAAGDPVFAGTLNERGMLEFRVTANKGNTTLDRIIHTVQEAQGQRAPTQRFVDQFARY
    YTPAVVVFAVLVAVVPPLLFGAAFEPWFYKALVMLVIACPCALVISTPITVVSGLAAAARQGILIKGGVHLENGRLIKAV
    ALDKTGTLTHGKPVVTDVVPLVELPADSLLQLAASVDVHSEHPIASAIVSAWQTPADGNGTPRSLLPAISFESLTGRGAK
    AVVEGQLYYVCNHRQIEELGICGVHVEEALHRLEQEGKTAVVLATATESLCVIGVADTVRGHSAEAIRQLHALGVASVML
    TGDNQTTASAIAAQVGIDDARGNLLPEEKLAVIDELMNRYDHVGMVGDGINDAPALAKASIGFAMGSAGTDTAIETADVA
    LMDDDLRKVPHFIQLSRNTSRVLKQNITLAIGIKAIFFALALAGKATLWMAVFADMGASLIVVFNGMRLLRIKGGIERDH
    IKSGHTR

    >gi|302879431|ref|YP_003847995.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Gallionella capsiferriformans ES-2]
    MTHDFTLPATSGTTFTPAAALGKNLVLFFYPKDNTPGCTTEAQQFRDLHEQFKQTNCIVAGISRDSLKSHENFKAKFSLP
    FELLSDADETVCNLFGVIKLKNMYGKQVRGIERSTFVFDSQGMLRHEWRGLKADGHAQEVLDFVATLN

    >gi|302879433|ref|YP_003847997.1| methionine-R-sulfoxide reductase [Gallionella capsiferriformans ES-2]
    MSGTVQKSDDEWRATLTPEQYQVCRQCGTEPPFTGAYWDCHDAGVYRCACCAYPLFDSSTKFDSGSGWPSFWQPLATGNV
    AVAPDTSHGMRRDEVKCAHCGAHLGHVFPDGPEPTGLRY
    CINSASLTLDRP

    >gi|302879512|ref|YP_003848076.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Gallionella capsiferriformans ES-2]
    MLRAAFALLAVLLAWSAHAADFTLTDQQGKIHHLSDYRGKWVLVNYWATWCPPCLAEIPELNALHAAHKNTDLVVIGIAM
    DYSSGKVVAEFVRKHSISYPVVLGNSKIVAQIGELDVLPTSYLYNPSGEQVSMQAGEITRKSVEHYIKSKKFN

    >gi|302879565|ref|YP_003848129.1| electron transport complex, RnfABCDGE type, A subunit [Gallionella capsiferriformans ES-2]
    MTEYLLILLGAVFVNNIVMVKILGLCPFMGVSKKLEAAVGMGAATTFVLTLGSGASYLISHYLLGPDLAYLTTLSFIVVI
    AGIVQFTEMAVEKTSPSLYQTLGIYLPLITTN
    CAVLGIPLLNVQAKHNFMESLLFGFGGSVGFTLVMVLFAGLRERMEGA
    DVPGIFKGSAIAMVTAGLMSLSFMGFSGLIK

    >gi|302879566|ref|YP_003848130.1| electron transport complex, RnfABCDGE type, B subunit [Gallionella capsiferriformans ES-2]
    MLGALLVMASIAIVLGAVLGFAAIKFRVEGNPLVDKIDAVLPQTQCGQCGYPGCKPYATAIAEGAADINKCPPGGEEGIH
    KLADLLGMEFKPFGGETLPKPKAVAIIDESTCIGCTLCIQACPVDAIVGAAKQMHTIIAAECTGCELCLAPCPVDCISME
    PIPDSVSNWKWKYPVYALTVSK

    >gi|302879570|ref|YP_003848134.1| electron transport complex, RnfABCDGE type, E subunit [Gallionella capsiferriformans ES-2]
    MNYQEFKDIVYNGVWKQNTGVVQLLGLCPILAVSSSVVNGVSLGLATSLVMALSGAAIAPIRTIVPNEARIPVFILIIAV
    LVTVIQYLMNAYMYSLYVVLGIFIPLIVTN
    CIVLARIEAFAAKNPPLQSAIDGLAMGLGLTAVLAVLGGVREIFGHGTLL
    SGIDMALGESAKSLVITVVPDYHGFLLAILPPGAFITLGLLIATKNWLNLRAEARARTEASIVKTQAA

    >gi|302879573|ref|YP_003848137.1| Rhodanese domain-containing protein [Gallionella capsiferriformans ES-2]
    MNFSGFLEQYWPFLALGLWFAYKSWNSKRVIAMLPELKKNGAIFVDVRSAGEFAHGNAPGTINIPLQELGNRLHEIPKFS
    PVVLC
    CASGTRSGMAKMLLKKNGYRNVHNIGTWSKFLG

    >gi|302879624|ref|YP_003848188.1| hypothetical protein Galf_2424 [Gallionella capsiferriformans ES-2]
    MIKFTFDNRFVSELPGDQSGSPHSRQTPDVCWAAVNPTPTAQPVLLAYSNAAACLLNLSHEDVHSAEFLQAFSGNQLLPG
    MRPFAACYGGHQFGHWAGQLGDGRAISLGEVINLQGERWELQLKGAGMTPYSRRADGRAVLRSSLREFLCSEAMHHLGIP
    TTRALSLIGTGDDVMRDMFYDGHPNDEPGAIVCRIAPSFIRFGNFELLAARGEHELLRRLVDFTIDRDFQEISKEPDDYL
    SDWFSLVCERTAKLVVEWLRVGFVHGVMNTDNMSILGLTLDYGPYGWIDNFDPGWTPNTTDSEWRRYCLSQQPPVARWNL
    ERLADALSTIKGARSLRERGLKHFDATLQTSMTSMLAGKFGWLVWCDTDAELVETIFDLMQTAQVDMTQFFRALANIEQE
    APDLAVLRSAFYQEALYHNHSTLFNDWLQRYAARLCLQQESDDTRRKRMNLVNPRFILRNYLAQQAIEAAMQNDMSFLER
    LMQAGQRPYDEEIDADLVALRPDWALNKPG
    CSMLSCSS

    >gi|302879645|ref|YP_003848209.1| thioredoxin [Gallionella capsiferriformans ES-2]
    MSEHIHYVTDATFDAEVIQAALPVLVDYWAEWCGPCRMIAPILDEIAKEYAGRLTIAKLNVDENQQTPQKFGVRGIPTLM
    LFKNGNIEATKVGALSKSQLTAFIDSHI

    >gi|302879729|ref|YP_003848293.1| Rhodanese domain-containing protein [Gallionella capsiferriformans ES-2]
    MYLRMIDVADFKNITVAELVSMLQQGGVKLIDVRTDAEVARGKIPQGDVLPLHLLPLRMSELDKSATTVFYCQMGGRSAQ
    AAAFAVGNGFADVYNLQGGITAWAHAGQPLA

    >gi|302879736|ref|YP_003848300.1| glutaredoxin-like protein [Gallionella capsiferriformans ES-2]
    MTQDIQQRIHQLVTEHAVVLFIKGSAKFPQCGFSANVVRILNLLGVKEFLAVNVFEDPEMVPGLVEYASWPTLPQCYIRG
    EFVGGSDIMTEMYQSGELKQLLGELATAA

    >gi|302879860|ref|YP_003848424.1| Disulphide bond isomerase, DsbC/G-like [Gallionella capsiferriformans ES-2]
    MNKILSLLLLLACSAANAGEAEIRQSLQGKVGKLEHIAKTPYAGLYEIMIGDKVLYTDELGLYLIDGSVIDVKNRTDLTE
    QRRRQLFNFDKLPLELAVKRVKGNGKRKLAYFTDPQ
    CGYCKKLEKELSKVSDVTLYMFLYPIFPGSEEIVRNVRCAKDPA
    KTWDDLMLKGIAAASIACKTPTDKVMAFGREKQVNGTPNLIFADGTQVPGYLPAEELEKHLNEAAKK

    >gi|302879890|ref|YP_003848454.1| Glutathione S-transferase domain [Gallionella capsiferriformans ES-2]
    MPHPILYSFRRCPYAIRARMALHASGVAFELREIELRSKPACMLIASPKGSVPVLVLPDEGVIDESREIMQWALHQHDPE
    GWLGVSDAYLLAAAPLIDINDNNFKTALDGYKYADSEASRAVCRAQGEDFLQSLEARLQMTRYLLADEQSIADAAIFPFI
    RQFAGVDKDWFEQSPYPALRIWLTGMINSRHFSAVMQKQAIWQANPES

    >gi|302879927|ref|YP_003848491.1| methylated-DNA/protein-cysteine methyltransferase [Gallionella capsiferriformans ES-2]
    MDYQAKLSAPFGILGIRCEDDALTGIDFLPLTHSAERASGPFAQTVCEQLARYFDKPDAQFSLALKYPATAYRQRVWQAI
    SAIPCGQTRSYGELARQLNSGAQAVGQACGANPIPIIIP
    CHRVVGRAGLGGFMNSTGATTLDIKRWLLAHEGITG

    >gi|302879985|ref|YP_003848549.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Gallionella capsiferriformans ES-2]
    MVNKRALNLLLFVVLIAGIRLWQQRDMVSGAAPGLQGVTVAGQPYHLPAHPEHPVLVHFWASWCSVCRAEQSSIAALAHE
    DPNVITVAMQSGSPAQVAAHMREQGIDFPVVNDPDGSISRAWGVHAVPASFIIAPDGTISFVEVGYTTQAGLIIRRWLAG
    L

    >gi|302880000|ref|YP_003848564.1| Redoxin domain-containing protein [Gallionella capsiferriformans ES-2]
    MTRKKEASNKVAVTLDGNPVTLYGTFPAVNQTAPAFTLVDKDLQDVTLQSFAGKRKVLNIVPSLDTAVCATSTRRFNEAA
    SGLENTVVLVISADLPFAMSRFCVAEGLDNVITLSLMRGRDFMRNYGVKIADTALAGLTARAVLVLDEKDRVLHAELVSD
    ITHEPDYDAALRQLSIDN

    >gi|302880070|ref|YP_003848634.1| Protein-disulfide reductase [Gallionella capsiferriformans ES-2]
    MRYVLMLLFCLITPVTLADNLLDKLPAFGSKPSFLPPDQAFGLELVALDKHRLQANFKITPGYYLYRDKVSFTVAGESPK
    ITALTLPEGELKHDPNFGETRVFHRPFQAEIELDNPSATHLTLNASYQGCSEQGLCYPSQDKVLEIDLTDAGAFGINTAD
    ANKPTDNENVTPQNENAKIAGLFKQGSFWLIVSFFFGAGLLLALTPCVFPMIPILSGIIVGRGHKITKTHAFILSLAYVL
    GMALTYAAAGIAAGLSGDLISNALQTPWVLGSFAAIFVLLSLSMFGFYELQLPSAWQSKLSDTSNRLHGGHLSGVFVMGA
    LSAVIMGPCVAAPLAGALLYIGQTHDAVLGGVALFALAMGMGAPLLAIGTSAGALLPKAGAWMDSVKRIFGVLLLALAIW
    IIQPLLPVPVQMLLWGVLLVLSASYLRVLERLPTNAHGGQKLIKGLGLLSLLLGAAYLIGALSGARDVLRPLDAVCAVCK
    ADTQTTLTFSRIKSLSELDARLKQADGKIVMLDFYADW
    CVSCKEMERFTFSDPKIQAKLKSAIVLQADVTENNQAHKDLL
    KKFGLYGPPGILFFDKNRQEMTDFRLVGYQDAAQFISTLQSVGL

    >gi|302879592|ref|YP_003848156.1| cytochrome c biogenesis protein transmembrane region [Gallionella capsiferriformans ES-2]
    MKKLLIHIDSKVALYWRNLLVMLALLWAMPVMAQADEVWIKEKTGNQPQVQLYFFWSLTCPHCLEARPFVEAIPAGRPWI
    SLHTLEVTRHPEHARQYETMAAQMGQQAVSVPALLFCGEMHVGWDDAQTTGGDILRRLDACHDGVPAGNVAPATGVSLPV
    LGEIDQRHFSLPLLTIAIAGLDAFNPCAFFVLLFLLSLLVHQKSRKRMLAIGGIFVLCSGLMYFAFMAAWLNLFQLLGNL
    VWVTLAAGVLAVFVGIVNIKDFFVFEKGITLSIPESRKPDIYRRARAIIGAGNFPAMLAATVFLAIAANFYELLCTAGFP
    MVYTRLLTLNELSPAGRYLYLALYNFIYVIPLALIVLVFTYGMGARKLTEREGRLLKLLSGTMMLELGALLLLAPERLNN
    MAMTLSLLGVAVLITLIVARLSGKKI