Frankia alni ACN14a uid58695

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|111219530|ref|YP_710324.1| putative organic hydroperoxide resistance protein (partial) [Frankia alni ACN14a]
    MDLQLSIPKGVGGDDGPGTNPEQLFATGYAACFHSALKAVARGKKADVTDSAVSVTIDLIRDDDGAIGLGARIEAQIPGL
    ERATAQELLEAAHAM
    CPYSRATKGNIPAEVVLVDND

    >gi|111219652|ref|YP_710446.1| methylated-DNA--protein-cysteine methyltransferase (6-O-methylguanine-DNA methyltransferase) (O-6-methylguanine-DNA-alkyltransferase) [Frankia alni ACN14a]
    MTGQDSPEFDPLATVLGAEVDLSRLRLRLLAEAERDGLLDVVYRTVDAPVGRLLLVATRRGLVRVAYEVEGHDTVLATLA
    ERISPRLLKAGGRLDAVAGQLDDYFSRVRYRFDVDLDLRLASRFRLTVLEHLREIPYGGTASYAAVAALAGSPRAVRAVG
    TACATNPLPVVIP
    CHRVVRSDGGIGRYVGGDDAKRTLLRLEGAI

    >gi|111219797|ref|YP_710591.1| anti-oxidant AhpCTSA family protein [Frankia alni ACN14a]
    MSLTIGDTAPDFVAATTEGPIKFHEWIGDSWAVLFSHPKNFTPICTTELGYVASIKPEFDRRNVKIIGLSVDPIELHDAW
    AKDIEETQGTAPNYPLIGDADFAISKAYGMLGADVSGDPSDRTAADNQTVRNVFVIGPDKKIKLVLVYPMTTGRNFDEVL
    RVIDSLQLTAKHKVATPVNWKQGENVVIAGSVSNDQAKEIFGTWDEPKPYIRIVPQPTA

    >gi|111219896|ref|YP_710690.1| hypothetical protein FRAAL0403 [Frankia alni ACN14a]
    MRRATVARTVAELAALLGSEGGTLALSAVDESAGTVALSFSLNDADCGDNCALPPDQLRRVVETRLRRALPGLTAVRIDD
    SRQPVSAGAGGLAGAGGVAPAGPAPSSITVLDPTGGVVPGDADPGPDLGSLRGRRIGVRVDVLWQAWDQTVDEWIAELER
    AGAVVTTWRRAQGLKGAEGERRQAEYDAFVGGVDAVISGLAN
    CGSCTSWSVKDGLNALNRGLPTVVAVTEHFVGLARTLA
    ADNGRPGLRLVELPSSLNTLPEEQVRAHARSSFPALLDAIGAVVR

    >gi|111220328|ref|YP_711122.1| hypothetical protein FRAAL0856 [Frankia alni ACN14a]
    MTLAQPRRRIPDPRDRNARLAWLDGWWDRSTVHLARVAVVGVGALGNEILKNLALLDFRQVTIIDRDTVERSNLSRSVLF
    RPRHEGQPKVTAAADTLADLNPALRVDALHADVVHETGLGHLRGQDVILAGLDSRRVRWWLNRTARALGVPWVEGATQGP
    HGHAMAFLPGAGPCYECTFTDQDWRALDDVAS
    CRQLALDAAVRGRVATSPTAASIVAAAQVHLAMDLLHGRPVVGGRSLL
    VNLEAPDLMVSGRPENPACEAHTRFEPVLDTALSARTATVGDLLAAAAPTVGEPATVELRWDSVWEFDCAGCGRTSPVRR
    ARGLVPHSTATCPDCGAERRPVFRHRLGAEDAGLSLAAVGIPPLDVVEVRGPAGSAWLELAGDRAEAVPTGTDRDSHP

    >gi|111220340|ref|YP_711134.1| hypothetical protein FRAAL0869 [Frankia alni ACN14a]
    MRVALSAMTHILVDARNDRSYYRSIKTNVRSYTAEEGSPMASKAVISLTTGLEDLEKVTVAFLVAVGAAETGRETLMFLT
    QEAVRLALPGEAKGEGCAGCPPLESLVERYRIAGGRYFV
    CPICVDARNIDASLLIEGAELNGTVPMWNWIGDDGATTFSY


    >gi|111220409|ref|YP_711203.1| putative thioredoxin [Frankia alni ACN14a]
    MTGVWVLVGAVVVAVALGTAMRARDGRFRPSRGRRVAADGGPARAVVAEPSPADGTSPADGTSPVAAGPDGGLRAELAAL
    GEALGERATLLQFSTAF
    CAPCRSTRQVLAGVAALVPGVRHVEVDAEAHLDLVRRLAVRRTPTVLIVDASGREVRRASGAP
    PTRQAVFATLAQIVPADEIVPTGQTVPTDGTKRADSDSSEPPPAG

    >gi|111220411|ref|YP_711205.1| putative thiosulfate sulfurtransferase (rhodanese-like protein) [Frankia alni ACN14a]
    MVDAAWVEANRDDPKVVLVEVDEDVSAYDKGHIPGAVRLDWKSELQDPVIRDFVNKEQFEKLLSGKGIANDDTVVLYGGN
    NNWFAAYAYWYLSLYGHADVRLLDGGRKKWELDGRELTAEVTPRPATSYTAKEARTDIRAFREEVVAAIGEKALVDVRSP
    DEFSGRLLAPAHLPQEQSQRAGHIPTAKNIPWAKTANEDGTFRSNDELTTLYGEAGVDLSQDIIAY
    CRIGERSAHTWFAL
    HELLDLPNVKNYDGSWTEYGSLVGVPIEKGA

    >gi|111220414|ref|YP_711208.1| hypothetical protein FRAAL0946 [Frankia alni ACN14a]
    MTRPLVVKVTAGMDAPERCSQAFTVAAVAVAAGTDVSVWLTGESAWFALPGRAAEFDLPHAAPLPDLLAGILAGGRVTVC
    TQCAARRSFGPDDVIPGVRIAGAAAFVDEVLADGVQALVY

    >gi|111220448|ref|YP_711242.1| putative redoxin [Frankia alni ACN14a]
    MDDDGSGSAQPGGGSARITLLTRVGCHLCDTARDAVARVAEQERVGWREADVDADPRLADEYGDRVPVILVDGREHGYWR
    VEEERLRRALAGRRWSLRSGGGR

    >gi|111220456|ref|YP_711250.1| cation-transporting P-type ATPase A [Frankia alni ACN14a]
    MTNVGVEAGEPARVELAIGGMTCSSCAARVERKLNRIDGVSASVNYATEKATITLARPAPADTAGTGGPVTIDELIGAVQ
    AAGYTANLPAAAMRPPAGQGRATATATGAGGSTAVGSTAVGSDDATESTGDAAGAGGDAESAADDEAGRHGADLRAMRRR
    LTVSAVLALPVVVLAMVPAWQFDYWQWVSLALATPVVFWGGRPFHAAAARGARHGAATMDTLVSLGTLAAFGWSLYALVF
    GGAGDPGMRHSFSFTGGLSDVGTGTAGAGMSHGGGMSHGAGGHSGGATAIYLEVAAGVTVFLLAGRFLELRARRRSGAAL
    RALLHLGATDVTVRRPVSGPGGLMVETRIPVDELCPGDEFVVRPGEKIATDGVVLEGVSAVDASMVTGESVPVEVGPGDP
    VVGATVNAGGRLIVQATRVGADTQLARIARLVEQAQSGKARVQRLADRISAVFVPAVITAALITLGAWLAAGQPATASFT
    AAVAVLIVACPCALGLATPTALLVGTGRGAQLGILIRGPEVLESTRRVQTVLLDKTGTVTTGRMRTAAVHPAPGESAADV
    LRLAGAAEDASEHPIARAVADAARAAAGGSLPPVTDFASDAGLGVRGTVEGRAVVVGRARLFAELPAELADALARERDAG
    RTAVVVGWDGAARGLISVADTVRPTAAEAVAALRRLGLHPVLLTGDAHAVARAVAAEVGIAPEDVIAEVLPEEKVATVRR
    LQGEGRVVAMVGDGVNDAAALAQADLGLAMGGGTDAAIEASDLTLVNADPRLVADAIRLARATLRTIRGNLFWAFAYNLA
    ALPLAAAGLLNPMIAGAAMAFSSVFVVTNSLRLRRFAPLPPAGPAALPSARPAPTVAARS

    >gi|111220468|ref|YP_711262.1| Thiol:disulfide interchange protein helX precursor (cytochrome c biogenesis protein helX) [Frankia alni ACN14a]
    MAGFAAACSGGGGTVDATGGGGFNFVQQSAGKDFVPAGNRHEAPRLAGKNLDGADFDVASLRGKIVVVNFWASWCAPCRA
    ETPGLVRLSKANPTVAFLGVNEKDPSGAKAFVRDNGVPYPSVVDRLGTLAAGWPVAPGLPSTFVLDADGRIAARFTGPVV
    PDDDLKPVLTRLQAEA

    >gi|111220667|ref|YP_711461.1| flavoprotein disulfide reductase [Frankia alni ACN14a]
    MTRIVILGGGPGGYESALVAASLGATVTVIDSDGIGGACVLTDCVPSKTLIATSETMTNIALAPGLGIRPHGPGAGTEAV
    LPAVAWGMRSGLDGGVPPLTPPEVVSVDPEQVYERVRELAKAQSLDIERRLEREKVEVVHAAGRLVGPHAIETNTGETFV
    GDVILVATGASPRDLPTARPDGERILTWRHLYDLKEIPEHLVVVGSGVTGAEFASAYRAMGAEVTLVSSRERVLPGEDPD
    AARVIEDVFVRRGIEVLNRSRAASVRRIGDGVIVELTDGRTVTGSHALMAVGSVPRTKGLGLTEVGVRLGPGGHVNVDRM
    SRTSVPGVYAAGDCTGVLPLASVAAMQGRIAMWHALGEAVSPLRLGTVSSNIFTEPEIATVGVTQVMKDTGAVAAEVTTV
    PLSRNPRAKMMGIEDGFVKLFCRPGSGSVLGGVIVAPRASELILSVSLAVEHGLTVDQIAHTFSIYPSLSGSITEAARVL
    RPRDFFAGFDNAG

    >gi|111220976|ref|YP_711770.1| putative thiol peroxidase, thioredoxin-dependent (bacterioferritin comigratory protein) [Frankia alni ACN14a]
    MTETASAARLAPGDPAPDFTLPDADGNEVSLSSLRGRRVVVYFYPAASTPGCTKQACDFRDSLAQLNDAGIDVLGISPDK
    PAKLVKFRDNESLTFPLLSDPERSVLKSYGAFGEKTMYGKKTVGVIRSTFVIGADGRIEVAQYNVRATGHVAKLLRDLNL
    ATA

    >gi|111221019|ref|YP_711813.1| oxidoreductase [Frankia alni ACN14a]
    MILAATVGGTDMDPDTQAGGTQAGDTRARDAQALAVHALEARVDVIVIGAGPAGENVAGRCADAGLAVTIVERELVGGEC
    SYWGCIPSKTLIRPGEVLAAARRVPGAAAAVTGALDPAAVFARRDRLVGGFSDDSQVPWLTDKGVTLVRGTGRLTGRPRQ
    VEVTGADGDRRVLTASRAVVVATGSRATVPPIPGLADAEPWDNRSATAATAVPRRLVVLGGGAVGAELAQAFRRLGSAEV
    TVVEGSPRLLAREEEFAGEQVRAAFEADGITVRLGTRAVDVRRGRPDSATSRGPVTVTLAAGAGPHSADDHAGSDRSGRS
    HAEGDHAEGDDSVRDDSMGDDSVGDTVVADEILVAVGRTPATGDLGLAAVGLQPGTFIEVDDRLLAVGVDGGWLYAVGDV
    CGRALLTHMAKYQARIVADVITGRRDAAGEPARDVADGLAIPRVTFTDPQASAVGLTERAAREAGLTVRAVSVATGGVAG
    ASVRGEGIIGTSKIVVDESRRVLVGATFTGPDTQEMVHAATIAIVAAVPVERLWHAVPSFPTVCEVWLRLLEEYGL

    >gi|111221227|ref|YP_712021.1| glutathione peroxidase [Frankia alni ACN14a]
    MTVHDFTVDTPDGSSRSLGDYAGQTLLIVNVASKCGLTPQYEGLESIYQELHGRGLEILGFPCNQFGGQEPGTDEEIQNF
    CSTNYNVTFPVLSKVEVNGDGAAPLFKYLRAEAPGDFGPESGFLYEHVSKTRPEAIGTDEVKWNFTKFLVDGEGNVVRRY
    EPTVTPEEIRKDLDAVLA

    >gi|111221301|ref|YP_712095.1| putative signal peptide [Frankia alni ACN14a]
    MTTETLSTPAPAPGAAAAEDDPGTVVADLWFDPLCPWAWLTSRWLLEVEKVRPVRVRWHVMSLSVLNEGRDDLPEQYREL
    LAKGWGPVRICIAAAERHGEGVLAALYTALGRRRHVEKAEFDEATFVAALTEAGADPALAAAASSTEWDAKVRASHADGI
    GRVGMDVGTPVVAVGENAFFGPVITPAPKGADAGRLWDGVLLVAGTPGFFELKRSRDVAPIFT

    >gi|111221719|ref|YP_712513.1| hypothetical protein FRAAL2287 [Frankia alni ACN14a]
    MLAAARSRLRRLEPAEAAQALAEGSGSVLVDIRPAAQRAAEGEIPDAVVVERNVLEWRFDPTSDARLPIATGDDLQVIVI
    CSEGYTSSLAADALRQLGLRRATDVIGGYHAWAAAGLPIRGGG

    >gi|111221746|ref|YP_712540.1| hypothetical protein FRAAL2315 [Frankia alni ACN14a]
    MPGGASVASGMTSATFAITWDYRCPFARNAHEHVLTGLAAGADWNVSFIPFSLGQAHVEEGQPSVWEKPEQDSGILALQA
    GVVIRDEYPDLFPAAHRALFAARHDEGRHLEDRAVIRETLTAVGLPADEVLARVDEGGLARVQAEHERYVASHSVWGVPT
    FIADDQAVFVRLMNRAPLGAEAAPSVRAVERVVDQLTGWPELNEFKHTSIPR

    >gi|111223017|ref|YP_713811.1| dihydrolipoamide dehydrogenase [Frankia alni ACN14a]
    MAAIRAAQLGLTTAVVEERYWGGVCLNVGCIPSKALLRNAELVHTLTHEAKTFGISVDGSITVDYGAAFQRSRKVADGRV
    KGVHFLMKKNNITEYSGRGTFVDDHTLSVTGADGATSTVTFDHVIIAAGATPRLLPGTSLSERVVTYEQQILSSELPRSI
    VIAGAGAIGVEFGYVLRNYGVDVTIVEFLDRVVPLEDAEVSAELAKHYKKAGITILTSTRVDSIDDSGDTVKVTVTGSDG
    VSKVLETEKVLQAIGFGPNVTGYGLENTGVALTERGAIDVDGYCRTNVPHIFAIGDVTAKLMLAHAAEAMGIIAAETIGD
    AETYPLDYVMIPRATYCQPQVASFGYTEAQARDAGYDVKVAKFPFSANGKAHGLGETAGFVKILSDAKYGELLGAHLIGP
    DVTELLPELTLAQRWDLTVAELARNVHAHPTLGESVKEALHGLAGHMINF

    >gi|111223122|ref|YP_713916.1| hypothetical protein FRAAL3712 [Frankia alni ACN14a]
    MRVDIWSDVVCPWCYVGKARFDRALAAFAHRDEVQVRFHSYELNPTLPRGRSESLLVALARKFSDVPAAEIEGMEHRVAD
    AARQEGLAYRSDRRNGNTFDLHRVLHLAGEAGRQAEAVTALNQAHFGAGRDVFDHDIAVEVFTSAGLPAAEVRRVLTGDD
    YAERVFADERAAHDMRVTGVPFFVVDRTLAVSGARPTDLFARTLDQAWARRAQRVA

    >gi|111223183|ref|YP_713977.1| methionine sulfoxide reductase [Frankia alni ACN14a]
    MTTSDHATGTTPTGPNPADTVKTDEQWRAELSPQRYAILRQAATEPPFTGAYTYSKETGTYRCGGCGAALFTSDTKYDSG
    SGWPSFTEPAVADAVELVEDRSHGMVRTEVRCARCGGHLGHVFDDGPGPTGQRY
    CMNSLALDLDPH

    >gi|111223269|ref|YP_714063.1| thiosulfate sulfurtransferase (partial match) [Frankia alni ACN14a]
    MSRRYVVIGAGAVGATIAAELNLAGIDVVVVARGANLAALRAGGLRYIRPPATEGGPADERRVDLAVAGGPDEVELRSGD
    VLVLATKSQDSEALLAAWAWQPVDGGRSTAAESLPVVLLQNGIENARTALRRFAVVIDAMVLSPSSHLRPGEVISPAAPL
    VAGFLLGRAPGGGVGDPVVEAIAADLRRGASAVRIVDDIGRWKAGKLLGNLAYNLDALYPPSPRRDAASAELVAEARRAF
    DAAGIDIADLRQDGGFDHTQLAIHDIPGFPRQGSSTWQSLARGGSVESDFLNGEIVLLARLHGLTAPVNAGVQRRIAVAA
    RLGTPPGGLGDADLAELLASGRGTRGSAAARQPGGRQPGGEVLVDAKALHDELGSALAPLLLDVRWALGDPHGHDHYREG
    HLPGAVYVDLDTELAAAPGGTAGRHPLPALADLQRAARSWGLTAGRPVVVYDDNGGLSAARAWWLLRWAGVADVRILDGA
    LGAWRDAGLPIETGEIIPLPGDIVLEAGHLPVLDADTAAAVAREGILLDARAPERYRGEVEPVDPRAGHIPGAVSASTGD
    NLDAAGRFLPAAELRARFLALGASAGGGGDAQAPIGVY
    CGSGVTASHEIAALAVAGFDAALFPGSWSAWSSDPARPVATG
    PR

    >gi|111223433|ref|YP_714227.1| hypothetical protein FRAAL4029 [Frankia alni ACN14a]
    MDIWSDVVCPWCYIGKARFEQALAGFAHRDEVSVVFHSYELDPTLPRGESGPLREALAAKFGRPVEEVAAMENRVADAAR
    GEGLQYTADRLSGNTFDLHRLLHLATDAGRQAEAVSALNAAHFGAGRPVFDAETAVEVFTAAGLDAAEVRRVWKGDDYTD
    AVRADERAARDLGITGVPFFVLDDAFGVSGAQPVELFTQALDQAWAHHRAAV

    >gi|111223686|ref|YP_714480.1| methylated-DNA--protein-cysteine methyltransferase (6-O-methylguanine-DNA methyltransferase) (MGMT) (O-6-methylguanine-DNA-alkyltransferase) [Frankia alni ACN14a]
    MLYTTLASPVGELLLVGTATDQAPGGLTLASLSLPGQRGAAVPAPHWRRAAEPFVAVAGEIEEYFAGERRRFTLTLQTGG
    TGFQERVWRALEAIPYGTTISYGQLAARIGAGRGEVRAVGTAVGANPLLLVRP
    CHRVIGADGTLRGFAAGLDRKEFLLRH
    EGALAPTLDLAGGATAASVPAGSAGEFG

    >gi|111223829|ref|YP_714623.1| hypothetical protein FRAAL4433 [Frankia alni ACN14a]
    MPTTDTAARPGLREFLVHKREAVLAREDAIAAGTLSGPAVLRAQSVADGRSGVRRIRIRDHQILSDSPPDYAGDDLGPSS
    PELVLGVFAS
    CLTHVFEIVAARLDIPLDEIRVEVEGQMEPRAGRPGFEGVPREPHNITYQASVTSPATAEEIETLYQTVE
    AECPLLALFTNPQTIAGSLVHTPSGGPAPEPSAEARAGDRG

    >gi|111223837|ref|YP_714631.1| thioredoxin-dependent thiol peroxidase; bacterioferritin comigratory protein; AhpC/TSA family protein [Frankia alni ACN14a]
    MPVAQPEVRSAQMLRVGDTAPDFELPDEDNTPRRLSTLLTDGPVVLFFYPAALTRGCTAESCHFRDLAAEFAAVGAQRVG
    ISTDTVAKQKKFSDKHSFDYPLLSDADGSVSRAFGVKRPIDLLRVRRATFVIGTDQVIIEAISSELNMNTHADRALAALG
    G

    >gi|111223887|ref|YP_714681.1| Alkyl hydroperoxide reductase [Frankia alni ACN14a]
    MLTVGDTFPAYDLTGVVSNDPDTAFVRETATSRPGTWRVVFFWPKDFTFVCPTEIAAFGRLNDEFADRDAQVLGVSTDSE
    YVHLAWRQNHPDLTDLPFPMLADIRKDLTAAAGVLGDDGVAQRATFIVDPDNVIQFVMVTAGSVGRNPAEVLRVLDALQT
    DELCPCNWQKGQATLGAAAPTPVEVAA

    >gi|111224431|ref|YP_715225.1| peroxiredoxin [Frankia alni ACN14a]
    MTVEVGSVAPDFSLKDQNNEVITLSEFRGKRNVVLLFYPLTFTGVCQGELCSVRDDLGSFQNDNVQVLAVSVDSPFAHKV
    WAEQQGYEFPLLADFWPHGEVAKAYGIFNEERGISVRGTFVIDKEGVVRWKVVNNIPDARDQAEYLKALAAL

    >gi|111224511|ref|YP_715305.1| hypothetical protein FRAAL5127 [Frankia alni ACN14a]
    MTVQDTTETATQSSTVILTDTAAGKVKTLLEQEGRDDLKLRIAVQPGGCSGMRYQLFFDERSLDGDTVLDFSGVKVVLDR
    MSSPYLGGATIDFVDTIEKQGFTIDNPNAQGSCACGDSFH

    >gi|111224533|ref|YP_715327.1| dihydrolipoamide dehydrogenase [Frankia alni ACN14a]
    MADSAAGPVDLVILGGGSGGYAAALRAAELDLSVVLIEKDKLGGTCLHRGCIPTKALLHSAEIVDNINESESFGIRSTFD
    GIDMAKVNSYKDSVIAGLFKGLTGLIKSRGIEVVEGFGRLVSPTSVAVGDRVISGRHVLLATGSYSKSLPGLDIDHDRVI
    TSDDALTLDHVPASAVVLGAGAIGCEFASVWRSYGAEVTIVEALPHLVPLEDESSSKLLERAFRKRGIAQHLGARFAGVK
    TTDHGVTVSLESGTTIDAELLLVAVGRGPVSAGLGYEEVGIATDRGYVLVDRFLRTNVPTVSALGDLRPGLQLAHVGFAE
    GIFVAEQLAGLNPVPVDYDNVPRVTYSHPEVASVGLTAAAARERFGEISTVTYNLAGNGKSQILKTAGAVTLVAVPDGPV
    VGVHMVGDRVGELIAEAQLITNWEAFPAEVAQLIHPHPTLSEALGEAHLALAGKPLHVHG

    >gi|111224725|ref|YP_715519.1| 3-mercaptopyruvate sulfurtransferase [Frankia alni ACN14a]
    MSNVLISATDLVRLLDSARPPRVLDVRWQLGGPPGRDGYLAGHIPGAVFVDLETELAAPPVPAQGRHPLPDVAALQRAAR
    GWGLSTGDTVVVYDDSGAMSAARAWWLLRWASVEPVLILDGGLAAWTAAGGTLQTEPVQPPPGDITLVPGALPTLDADGV
    AALARDGIVLDARAGERYRGEVEPVDPVAGHIPGAHSAPTGDNLGADGTFRSPAELARRFAALGVTGEQPVGVY
    CGSGVT
    AAHEVAALAIAGHPAALYPGSWSQWSNLPDRPVATGPEAG

    >gi|111224857|ref|YP_715651.1| thiol:disulfide interchange protein [Frankia alni ACN14a]
    MDPAGFQAGTGWAIKPQGACKGDVCVPLPSSVRRPDGRLDVTGLAERLGMGLVADEAHGVWALGPESAVTGRALTTAQAP
    PLELPRLDGTPFRLDSLRGQKVVLVAWASW
    CGCREDLRLWSALREQLHPRGLEVVTVALDTGGPDAARPWIEKAGGSHPA
    LIDIRHELGAKFGVVNVPNGLWIDEDGIIVRPAEPAWIEDPHASSETAARSLDELPPDHRDVRAEIGKMTIDPAVYPAMI
    RDWVANGRASRYALEPHEVLDRARPRDAAVSRAAARFELGEYVHRAGDHTAAVAHWREAHRLQPDNWTYKRQAWNLADPE
    SVRTIDAYGTGWLDDVRALGAENYYPEIQP

    >gi|111224859|ref|YP_715653.1| hypothetical protein FRAAL5494 [Frankia alni ACN14a]
    MLVSTDTVDPAVFTAGTGWSIKPQGACKGEHCVPLPAEARDAAGDLVVEVVAGRLGMPLVVDAEHGLTAVGPEAAVTGRM
    LTTAEAPELTLPTFDGATFQLSRLRGTKVLLVAWASW
    CGCAHDLPLWAELRERLRGNNLEIVTVAMDVAGPDAGRQFVER
    ATPRHPAAIDAEHSLGRLFGVVNVPSGVWIDEAGMIVRPAEPAFPGRVVIFDELRKADLAREAAASAGTLDRMREVLRSD
    EGLSDSTVSLVEMTRVIADHAEPELYLRMLLDWADKGADSEYVLTPDEVVERSAPRPPDVATAAAHFELGQHFERHGDHL
    AAVAHWRRAHELQPLNWTYKRQAWRFEYGPDGQPDRYDSSMEHDLRAVGPENYYPRLLP

    >gi|111224978|ref|YP_715772.1| hypothetical protein FRAAL5614 [Frankia alni ACN14a]
    MKIEYCTRCRWLPRAAWLAQELLTTFEGDLAEVCLVPGTGGVFVVRLGDRVLWDRREQGFPEPSAVKRLVRDEVAPGRPL
    GHVEASALDPDA

    >gi|111225253|ref|YP_716047.1| putative thioredoxin [Frankia alni ACN14a]
    MNGAAPAAGDAPAGPVVIDVTEASFATDVVSRSMQVPVVLDFWASWCGPCKQLSPVLEKLALADGGRWILAKIDVDANPG
    LAQAAGVQGIPAVKAVVGGRIIGEFTGAVPEREVRNWLDQLLSLVDEAMGGMPGAAAGDAARDPHLAAAEDALARGDIDT
    AVESYRVRLAEAPADPEALTGLARAELLRRVRDHDPADIRRRLAADPDDVDAAIAAADLGIAQGDVAGALAGLVEVVRRT
    SGPQREQARAHLVDLFQALGDAEPAVAPARRSLAAALF

    >gi|111225383|ref|YP_716177.1| putative glutaredoxin-like protein [Frankia alni ACN14a]
    MLTIYTTSWCGYCVRLKSQLDRAGLEYKTVDIENDPTAEQLVRDANNGNATVPTVLFPDGTVMTNPSVRQVTEKVTSAA

    >gi|111225394|ref|YP_716188.1| molybdopterin biosynthesis-like protein MoeZ [Frankia alni ACN14a]
    MSLPPLVDPAEGLTVDEVRRYSRHLIIPDVAMDGQKRLKNARVLAVGAGGLGSPTLMYLAAAGVGTLGIVEFDTVDESNL
    QRQIIHGQSDVGRSKAESARDSVLNINPYVNVVLHETRLDTSNVMEIFSQYDLIVDGTDNFATRYLVNDAAVLLGKPYVW
    GSIYRFDGQASVFWADHGPCYRCLYPEPPPPGMVPS
    CAEGGVLGVLCASIASIQTTEAIKLLTGIGDPLVGRLMVYDALE
    MTYRAIKVRKDPECPLCGKNPTITELIDYEAFCGVVSEEAQLAAAGSTITASELKGWLDAGEPIELVDVREPAEWEIVRI
    PGARLIPKGDLPAHLAELPQDRRVVVY
    CKSGVRSAEALATLKGAGFSSAVHVQGGVTAWATQVDKSLPVY

    >gi|111225545|ref|YP_716339.1| peptide methionine sulfoxide reductase [Frankia alni ACN14a]
    MAQMFFGRHKTTLPTPEEALPGRDRPVFVGDSRHTVLGTSFTGPFPAGLDTAVFGLGCFWGAERAFWQVPGVYTTAVGYA
    GGSTPNPTYEEVCSGQTGHTEAVLVVFDPAKVSYAELLKVFWEGHDPTQGMRQGNDVGTQYRSAIYTTSDAQAAAADASR
    DGFEKVLQGAGYGPITTEIAPAGPFYLAEEYHQQYLSDAKNPYGYCGLGGTGLSCPVGVAGVGADREGSAGVA

    >gi|111225552|ref|YP_716346.1| hypothetical protein FRAAL6208 [Frankia alni ACN14a]
    MPNKLAEQTSPYLLQHADNPVDWWPWCPEAFAEAARRGVPVLLSVGYASCHWCHVMAHESFEDVVTAAYMNDHFVNIKVD
    REERPDVDSVYMDVTVALTGHGGWPMTVFLTPTAEPFFAGTYFPPRPRPGMGSFRQVLEAVVAAWQTRRAEIEESGADIA
    RRLAEAAARGPVAGLAASPTSGVADELSPPLLDTAVAGLSARFDARHGGFGGAPKFPPSMVAEMLLRHAARTGDGHSLEM
    VALTCERMARGGMYDQLAGGFARYSVDATWTVPHFEKMLYDNAQLLRVYLHLWRATGSPLAQRVVRETAAFLLADLRTPQ
    GGFASALDADAVPAGVPAAHAQPEEGASYSWTPAGLRAALGADDGAWAAEIFGVTAEGTFEHGTSVLQLPADPPDAARFA
    AVRAALAAARAGRPQPARDDKVVAAWNGLAIAALAEAGALLDEPAWIRAAEDAAVLLRDVHLVAGRLRRTSRDGRVGTNA
    GVLEDYGDVAEGLLTLHQVTGDPEWLTLAGELLEVVRARFAAPDGGFFDTADDAEALLRRPRDDSDSATPSGQAAVAGAL
    LTYAALTGSAEHRSTAEATVARFAPLLSRDARFAGWAGAVAEALLAGPAEVAVVDSPALERLARLGTAPGAVVVTSGPLV
    AGRGAPGVYVCRDFVCELPVHTAEEVRRQLGVKVAT

    >gi|111226070|ref|YP_716864.1| metallo-beta-lactamase [Frankia alni ACN14a]
    MSSDQIPAVSVADLPADLSADGAPLLVDVREPDEWSAGHIADALHIPMGELVTRLDEVPREQDVVVVCRSGGRSAAVTGY
    LVQGGWQVRNLTDGMLAWQAHGRPMVSESGAAPRVL

    >gi|111226134|ref|YP_716928.1| hypothetical protein FRAAL6802 [Frankia alni ACN14a]
    MAQVRHLLGSTPGTEGFALRIGVDPGGCSGYTYKLALVPGAEAGDVVLPQDGFDVVVHTTSVDLLRGMRVDYTETLTSSG
    FTFANPNAKSSCGCGSSFGSSDDPERTAADAKLREQVEEIMEEIRPMLRGDGGDAEVVAVLAGGGQPGSAEVHLRLTGAC
    GGCSSANATLTGVIEARLRQELPEIGRVALVA

    >gi|111226205|ref|YP_716999.1| thioredoxin reductase, FAD/NAD(P)-binding [Frankia alni ACN14a]
    MRDVIIVGSGPAGYTAAIYTARANLRPLVFEGAVAAGGALMNTTEVENFPGFPEGVQGPELMEKLRQQAERFGAELVADD
    VTELDLTANPKVVRVEDQTFLARTVIVATGSAYRKLGVEHEERLLGRGVSA
    CATCDGFFFRDHDIAVVGGGDSAMEEATF
    LTRFARSVTLIHRRDKLRASAIMQERAFSNDKIRFRWNADVAEILGEDKLTGVRLRDTVTGETDELEVTGLFVAIGHEPR
    TELLRGQLELDDAGYVKVAHPTTKTNLDGVFACGDVVDHTYRQAITAAGTGCAAALDAERFIAAGEGPGETTTEAPRVST
    PAPQPA

    >gi|111226206|ref|YP_717000.1| thioredoxin 1, redox factor [Frankia alni ACN14a]
    MAGTTPVTDSTFTAEVLQSDVPVLVDFWAEWCGPCKMVGPVLEEIAKEHGEKLRIVKLNIDENPETARNYQIMSIPTMAV
    FVKGEVDKSIVGAKPKAALLRDLSAYI