Francisella philomiragia ATCC 25017 uid59105

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|167626262|ref|YP_001676762.1| hypothetical protein Fphi_0041 [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MIDFQYGYTDLSDKFYSAQKVYRYPDAKLLIVNDCLAKDLGLDLEGKSEQELLKNLLGYTSKKPISQAYAGHQFGNFTML
    GDGRAILIGEYEKPNGELVDFHLKGAGLTKFSRGGDGKAALAPMLREYIVSEAMHNLGIPTSRILAVISTGENIQRNKLQ
    QGAIALRVASSHIRVGTFQYAAMLGESYNQELLDYTIVRHNIPYCNNKALSLLDYVIDKQTTLITQWERVGFIHGVMNTD
    NMTISGETIDYGPCAFMDIYDPDTVFSSIDRDGRYAFANQASIAGWNIARLAESLLKLISQDEDEAIKSAQDKLQSYSEI
    YKQKWRQMFLSKIGFGINSEYDDELISGLLIDMFKHKLDYTNTFYDLSYNNFDHLRNKGLKDWLDKYVNYDINFESMMKS
    NPVIIPRNHQVEKALEFAKNGNFSILQSLVTALETPYELNALTKKYMVEPLEQEKVRFTF
    CGT

    >gi|167626346|ref|YP_001676846.1| hypothetical protein Fphi_0124 [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MVEVFDPNNSILEVTVAAAKHFEKHLAKDSNNIGIYVGTKLMGCSGLAYDIDFVTQQPADTTVVDQQGLRFFVSNKSMNF
    LNGLRIDYVKHDFGLYKLEYTNPNESARCGCGESFTV

    >gi|167626448|ref|YP_001676948.1| iron-sulfur cluster insertion protein ErpA [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MSEVVQSVDPINFTESASLKVKELIEEEGDNSLSLRVYITGGGCSGFQYAFAFDNEIKEDDMVITKNGVRLLVDSMSFQY
    LVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV

    >gi|167626461|ref|YP_001676961.1| hypothetical protein Fphi_0244 [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MLSSCANQQVETKPATSVDDAISTKNEDTRSYAEVIAIPMVMSSLLDDESTPRVGPKNAKKAVVIFFDYACGKCAQISKE
    MNKLIKENPDTEFIFKAYPSLKRDAKVANYATLVANEAYLQGGSELFLAYNKAVFSQRESSGRLTNVDVENAAKRLGIKV
    DDNNLKQKAATEELETRKLGKLIGFHGPHAFIVLPTDLANMNAKQLESNTDKIYVISDKQTNSVTDDYQEAAKWSASKIQ
    TQLKNMK

    >gi|167626476|ref|YP_001676976.1| thioredoxin reductase [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MANHHKLIILGSGPAGYTAAIYAARANLNPVIITGMQPGGQLTTTTDVDNWPGEADGIMGPELMEKLQKQAERFDTQITY
    DTINSVDLQTRPFKLVGEIEEYTCDALIISTGATAKYLGLESEEKFMGKGVSA
    CATCDGFFYKNKDVAVVGGGNTAVEEA
    LFLSNIAKSVTLIHRRDSLRSEKILIDKLMEKAENGNVNIIWDTTLEEVLGDDMGVNALRLKNVKTNEESKIDVMGVFIA
    IGHTPNTGIFKDQLEMENGYIKVKSGLAGDATQTNIKGVFAAGDVADHVYKQAVTSAGTGCMAALDAEKYLDNLNQ

    >gi|167626505|ref|YP_001677005.1| stringent starvation protein A [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MKVTLYTTKYCPYSLRARIALLEKKMAMDVVEAGDLEPNVVKKISPNGIFPVLMEKDYSINNRKALLIYIDERFPAPSLL
    PSVVNDRIKIRLSLDKIDNEWYPVLDEIRKNRENKTKLKAIFKDLRESLLAMEKAFSDSDYFISSGFTLADCYIAALIIC
    LEAEGFVIDEEYGSIFNYKKRVFARDSVKKANLKGGAGESLLKTLRAHR

    >gi|167626652|ref|YP_001677152.1| methionine sulfoxide reductase B [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MNKILSIIFMIIPLISFADTPSWQNFDKQKALANLSKQQYYVTQQGGTERAFNNEYWNNHKQGIYVDVVSGEPLFSSTDK
    YDSGTGWPSFTKPIDNSFIKTRNDNSWFISRTEVLSKYANSHLGHVFDDGPQPTGKRY
    CMNSAALRFIPKEDMQKEGYGK
    YLYLFK

    >gi|167626663|ref|YP_001677163.1| heavy metal cation transport ATPase [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MSKQYQSFKVYGLDCIEEINIIKKTLSKKIAADSMQFDLLNGKLSIDNQNVSEKEIITLIKKVGLKAITWDEHITESQNI
    SFLTKYSRLITTLLSGVFIIFANLYHSINHGFVHAFIGDESISQTVPLISQASYLIAILFGSWFVLPKAISAIKRLDADM
    NLLMLIAITGAIIIGQLFEAAVVSFLFAFSLLLESWSVANARSAITKLMKLTPDTALVYCCHDKQFEEKPLAEINTGKTL
    LIKPGQRIALDGIILKGNSYINQAPITGESIPVEKTIGDQVFAGSINGNSAIEIKTTSTAENSSIAKIIQAIEHAQSKRS
    KAEKWVDKFAKIYTPTMIFLAIIIATIPPLLLNESWLKWGYEALVILVIACPCALVISTPISIVSSLAKAARNGILIKGG
    EFIEIPAKLKAIAFDKTGTLTQGNPSITEIIITQNYSQQQLITIAASLESSVDHPIAKAILDYAKNNNITFTQATNTEVL
    GGKGVIGKVNESSFWLGNHAFAHEKRLCNNEDLHAQAIKLANNGQTLIFIGSDENIIGIIAIQDMIKNNVNNALKQLKKL
    GINQTIMLTGDNTATSQSIATQAGIDKFYAELLPQDKVAKVEELANKYENIAMVGDGINDAPALARSNLGIAMGTIGNDI
    AIETADIALMSDDIAKLPWLIKHSKKTLKIIKQNITFAIAIKAIFISLAITDLATLWMAIAADMGATLIVIINSLRLLK

    >gi|167626703|ref|YP_001677203.1| arsenate reductase [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MIKVFGINNCTSVRSALKFFEEKGKKVEYINLRQNKPTLQEMKEIKQIGNFQVIDLFNSKGKLFTEMGLKEKIDALSEQE
    AFELLVSDALLFKRPLVVDGNYARTGWNKKEYEEKWG

    >gi|167627034|ref|YP_001677534.1| bacterioferritin comigratory protein [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MKTLEQGQLAPNFKLENQNNEEVSLSDFKGKKNVLVYFYPKAMTPGCTTQSIGLSSISDKLAKLDTVVLGISTDTPKRLK
    KFEERDSLTIQLLSDEDHKVAEQFGVWGEKKFMGKVYDGIHRISFFIDKDGKINHVFDKFKTKDHHEIVLEYIQNYMNS

    >gi|167627060|ref|YP_001677560.1| peptide methionine sulfoxide reductase [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MKKRKIIILSSLLFASSFVFANDDSESKYQKAVFAGGCFWCLESDFEYMQKHQDLSHDGIIKVISGYDGGLQKDPTYKTV
    SAGITNYKESVEVVYDPTKISYQDLVEYFYRRIDPTDSKGQFCDKGEQYQSAIYYSDDKQKQVAEDVTKKLKAEFKKHNQ
    PVYTQILPSTHFYKAESYHQDYHHKNPKRYCYYRTGCGRDVTVNKVWQNIDWKYSNITPFNIPSSYAECLTR

    >gi|167627189|ref|YP_001677689.1| glutaredoxin-related protein [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MYTQEEQKVVDRIEKQLKENDIILYMKGSPNLPQCGFSAHAASAIRACGKPFAFVNILENPDIRAILPKYADWPTFPQLW
    VKGELIGGCDIIMEMNESGELKELIDSVK

    >gi|167627234|ref|YP_001677734.1| disulfide bond formation protein [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MRFIFRHIFLFNIIVCFFALITVVFTIIGLGWKPCPMCLIQQLCVLCIMIFSILGLIKNSSKGFSTIVQTVIILIIAVGC
    YIAADQAYLQYFSSTISDDPTG
    CGAISNPFLIDATKSLTGTVSSCTSIAEEISGISLAVYSLIFFICLLVMNCVSLFVRI
    FKK

    >gi|167627336|ref|YP_001677836.1| methylated-DNA--(protein)-cysteine S-methyltransferase [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MLKETHQIYLATINKENYKTVFYLQEIKTPIGNLVAIADDNYLYACFFISDLNIYSIEKLLKIYNAKILFKTNDIINQTR
    NQLDKYFNKELKTFSIPLQLTGTDFQKQVWHELIKIPYGETISYRKEATNIGKPTAFRAVANANGKNLLPIIIP
    CHRVIN
    SNGKLGGYTGGLYKKEFLLNLEGN

    >gi|167627338|ref|YP_001677838.1| dihydrolipoamide dehydrogenase [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MIKTDICIIGGGSGGLSVAAGAVQMGASVVLCEGGKMGGDCLNYGCVPSKAIIEASRVIAKLNKAPDFGINVDSIDIDYA
    KVQAHIKATIAKIEPHDSVERFEKLGVKVIQEYAEIVDRYTVKAGDKIIKAKYIVIATGSRASIPNIKGLDTIDFLTNET
    IFELKEKPQHLMIIGGGPIGVELAQAYALLGSQVTIFEASDTILGMLDSECCKVVIKEFDRLGINIITNVNITEIEQQNQ
    QINVCCGDKYYEGSHLLVAVGRQPNLAKLNLDNVGVRYTSRGINVDKRLRTNYKNIYAIGDITGGYQFTHVAGYHAGIVI
    QNILFKLPAKVDYSSLPWSIYTSPEIAHVGQDISQAQDQGAKILKLSYQNNDRAVASLTTNGLVKVAVSRKGYILGVTIV
    GESASELIVQWTLAIKNRLKIKDIASHIVAYPTLSELNKRIAGSYFTPKLYSNKVRRLVRLLMKVFGKRL

    >gi|167627413|ref|YP_001677913.1| pyruvate dehydrogenase complex, E3 component, dihydrolipoamide dehydrogenase [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MSDIKTQVVVLGSGPGGYSAAFRAADLGLEVVLVERYAEIGGVCLNVGCIPSKAMLHIAKVINEARHLESLGIIEMGGLK
    INRENLLKYKDGVIGKLTGGLKGMAQMRKVKIVQGYGKFTSDKELAVEAADGKVTKIAFDNCIIAAGSSVINLPFVPKDD
    RIIDSTGALEMKEIPETMLVVGGGIIGLEMAQVYSELGTKITVVEFADQLMNGVDKDLVKAYQKVNSRYDVRLKTGVTAM
    EAKEDGIYVTMEGDHPAKNERFDRVLMAIGRKPNGKLIDAEKAGVKVDERGFIPVDKQLRTNVPHIFAIGDIVGQPMLAH
    KAVPEGRTAAEVISGLNHSFDPLVIPSVAYTDPEVAWVGETETSAKAKGIKYEKGVFPWAASGRSLSIDRSEGMTKVLFD
    ENHKIIGASIVGTNAGELISEAALAIEMGCDAEDIALTVHPHPTLSESLMMATEVFEGTATDLPPQKKKK

    >gi|167627466|ref|YP_001677966.1| arsenate reductase [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MKIYHNPKCSKSRQAKQVLDQYNINYDTHLYLDNPLSVKEIKELLTKLKLSIIDIIRTKEAIWKENFKGGEFTNDELIEI
    VASNPKLLERPIIEHNDFAVVARSDEKIQEILNTH

    >gi|167627498|ref|YP_001677998.1| thioredoxin [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MSKCIDILDSQFESEVLNSDTPVLLDFWAPWCGPCKMLSPILEQVAEHYGDKVKVCKINIDDNEETAMKFGVRGVPTLMV
    FKDGENKETKVGVVQKTQLISIVDKYL

    >gi|167627520|ref|YP_001678020.1| rhodanese-related sulfurtransferase [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MSKVKNISVKDFLELQKKEKVKLIDIRTTGEHNRECIDCAENISVDEIYDADIQPDEIVVLHCQSGNRTNQAATKVKDLN
    AKAVYLLEGGLNAWKQHKQPTKKNVKEPLPIMRQVQIIVGFMVLLGVVLSFTVSQYFAILSGFFGAGLLFAGLTGTCGLA
    IMLEFLPYNKRK

    >gi|167627521|ref|YP_001678021.1| uncharacterized NAD(FAD)-dependent dehydrogenase [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MAKKYLIVGGVAAGASAAARLRRLDDKAEIVMFEKGPHVSFSNCGLPYHLGGYIEPAEKLILMTPEKFDTRYNIEARTNS
    EVVSVDKSNKTVTVINHITGEEYTESYDKLVLAVGAKPIVPPFKGLETINHFILRNVVDVKKIHKAVFDSEKPVKEVTVI
    GAGFIGIEVAENLKERGFNVTIVEMANQIMRPFDYEMVKYLEKELLDHDINLMLSEKVVGFESDKVLLESGKEVKSDLVV
    LAIGVAPDTAFLKNVGIDLAKSGHILVNENYQTSDKDIYAAGDAILVKNALTGQDFNLPLAGPANKQGRLIADHINGRKI
    VNKGYIASSIIQIFNYTGAATGLNEAWIKFHNLDIDYQVAYTAPFDRVSIMPNAQNVFTKILFESNTGKLLGAQTIGKGI
    VDKRADVFATAIKAGMTVEDLQDLELCYAPPYSTGKDVVNHTGYVANNLLNGDFKQVLFTDVEKLLAENAQIIDVREFGE
    TSKGMLAGAKNIPMSEIRNRLSELDKTKPVYVH
    CQSGQRSYNVTLMLQHHGYDVYNIAGGYAMISNYYGTIERITGECRI
    SIT

    >gi|167627723|ref|YP_001678223.1| rhodanese-like family protein [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MQHTSGFLDLVNDAKSRIQECTVDDINKMNETETLDGLLIDTREESEFANGYIPNAIHISKGIIESAIESAVPNKNQKMY
    FY
    CGGGFRSAIVADKLREMGYKNVISVDGGWRAWNAKGYPTKSPNQARPHEFLKLVNNAKSDIKECSVTDLYDKINSNEL
    DGVIFDVREDSEFNRFHIQGATHLSKGQIEVKIESLIPNKNQKIYLY
    CGSGFRSALAAKSLKSMGYTGVISVEGGINAWL
    NNNFPVTQD

    >gi|167627785|ref|YP_001678285.1| glutaredoxin 2 [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MKIYLYHHCPYCIKVRLLADLSKLDYEMIILANDDEKSHIDRIGSKQVPFLEKDDGTFIKESDEICKFIAKTQNFEIAES
    TIDNYAKESVAKLAEHYRRIVYPRIPHHPRNECDFPTQSAKDYFINKKSQYIGDFDALLRNPPYDSIIAINKILREIAPF
    VKTPFINGDNFSWDDINIFPVFFILTMARDLLEIPNNISNYIKNIETKTNIELY

    >gi|167627811|ref|YP_001678311.1| hypothetical protein Fphi_1586 [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MQKKSFAILSVFVLFLLVIIYFFSTANLSKSSFNNQQGLYLVKQAFPQYKVIKTFDTGIHLQAYILEDKKDPTKRTVTFT
    SEDGDVIVNGELLAWDRNQNKLTSLNQIYANYFTSSPQASDLYLDIKKYATYIQQGSDDAPHKFYAIIDPN
    CRYCASLFD
    ASQPAIKSGDLAVRWIPIGSLQNSPDVVRSIFNSKDPLQALIEYHNTKKYNESLTKPNEKAENNMRLSTDISGFPTIIYK
    TPEGALKISGGNKLPLTEAKIAEKDNIKKVNEFLLLTSNSF

    >gi|167627813|ref|YP_001678313.1| soluble pyridine nucleotide transhydrogenase [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MEYNYDIIIIGSGPGGEGAAMKATRNGQKVAIIEDDAIGGGCNNWGTIPSKTLRQLSREVWYNKKNFDFPDMLDNAFEVV
    LKQREIKKNRFANNEIDVFYGFASFLDKNKIKISRKNGSTEIITAKKFILATGSRPYQPDDIDFTHPRILDSDKLLELKD
    KNIKSITIYGAGVIGCEYASILGTLDIQVNLINTRDKLMSFLDDEIIETLTNHFTVNQKINLMHNETYKSIKAKGDKVIT
    TLNSGRIIESDYVLFALGRAGNTNGLNLDKIGVEYSPQRGLVNVNDNYQTTQPNIYAVGDVIGFPSLASSAFNQGRFAAT
    HIIDGSCNDKLVEDIPTGIYTRPEISCIGKTEEQLTAENIPYESGRAYFKDLARAQISGSETGMLKILFHKETFEILGIH
    CFGHRVSEIIHIGQAIKSMPGKHNTIRYFLNTTFNYPTMAEAYRIAAIDGVNKLKPKNKQCVPEHK

    >gi|167627842|ref|YP_001678342.1| bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MVEVKIYTKTNCPFCDLAKSWFGTNDIPFTQITLDDDQERLNFYAEVNKNILLVEEHIKSVPQIFIGDVPIGGYDNLMAR
    AGEVIARVKGSSLTTFSKTYKPFSYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVA
    VGQNYYDQFIPLFKNNEVRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDANPNTRRGLGLC
    LAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNQFKKEIYLMASKAV
    ELEDKFIDLAYEIGTIEGLKADEVKEYIRHITDRRLNQLGLNEIYNIDKNPLTWLEWILNGADHTNFFENRVTEYEVAGL
    TGNWDEAYQH

    >gi|167627843|ref|YP_001678343.1| glutaredoxin 1 [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MKVKIYTRNGCPFCVWAKQWFDENEIVFEETIIDDHSQRLRFYEEMNQSGKVAFPISTVPQIFIDDEHIGGFTDLKANAT
    EILAKK

    >gi|167627852|ref|YP_001678352.1| AhpC/TSA family peroxiredoxin [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MVLVGKKAPLFNAPAVLGTGEIVDSYDFAKAMQGKYAVVVFYPLDFTFVCPSELIALDKRTAKLKELGVEVVSVSIDSHF
    THNAWRNTPINEGGIGPVKYTMVADINQEIVKAYDVQSEGGMAFRGTFLIDKSGVVRHQVVNDLPLGRNMDEVIRMVEAL
    QFHEQHGEVCPAGWNKGDEGMKASPEGVAEYLSGHVVDL

    >gi|167627864|ref|YP_001678364.1| hypothetical protein Fphi_1639 [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MSKSQATIYRMVTNKHICPFGIKAKDLLRRKDYSIKDIHLKNRQEIDDFKAKYNVKTTPQIFIDENKIGGYDDLLKFFNL
    AKDKKEKSYNPILAVFAMTFLLALAYSYSISGNIFDLLVIKLFMGLSISFLATLKLQNLDSFSNQFITYDLLAMKYVRYS
    YIYPFAEAFVGICIVASIFSYLAAIIAIIIGLIGAISVFYAVYIQKRDLKCACVGGDSNVPLGFLSLTENIMMIAMGIWM
    LFL

    >gi|167627867|ref|YP_001678367.1| peroxiredoxin, AhpC-TSA family protein [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MTKRVPNVTFKTRVRDESIGGSNPFRWQDVTSADIFDNKRVIVFSLPGAFTPTCSTYQLPGFENNAARFKELGIDEIYVL
    SVNDSFVMNKWIQALDVKNIKPIPDGNGEFTQALDMLVDKSNLGFGKRSWRYAMIVNNHEIEKMFVEPGKRDNAEDDPYG
    ESSPENLLKYLEAK

    >gi|167627871|ref|YP_001678371.1| glutathione peroxidase [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MSIYDFKLTKNDGSEYSLPNNKVLLIVNVASKCGFTKQYKGLQHLHKLYPDLEIVAFPCNSFGGQEPGSDEEIKSFCETN
    YDVTFPIMKKTKVNGKDAEPLFEYLKERAKGVLGTEAIKWNFTKFLVSKDGETVIRYAPKTIPEDLISDIENFLKD

    >gi|167627886|ref|YP_001678386.1| glutaredoxin like protein [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MTQQFNKIVLYRMVTPEKTCPYGLKAKALFEEKGWCFEDHILKTRAETDAFKHKYNLETTPLIFIDGKQIGGYSDLLEFL
    GQK

    >gi|167627892|ref|YP_001678392.1| bifunctional methionine sulfoxide reductase B/A protein [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MLKTKSLTPHQYEIIINKDTEHPFTGRYNDLDQKGTYICRNCGTPLFKADSKFISTCGWPSYDIHIDNNVKQLPDADGRR
    TEILCNNCDGHLGHIFHGEGYTNLNTRY
    CVNSASVDFVPVESLGETEEIIVAAGCFWGVEYYMKKLNGVVFAESGYCGGD
    QPNPDYRKVCAGNTGYLEVVRIIFEKKKISLEEVLKYFFEIHDFEQVDGQGPDIGEQYKSAIFYYDDKQKQIAEDIKSEL
    SDKGYKVATDIREAKPYYVAEDYHLDYYMKKGTLPYCHTRKKIF

    >gi|167627894|ref|YP_001678394.1| protein-disulfide isomerase [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MTKKKLLKALAVAAIATSLVACSDSSNKDKSAKDAATNSESSVATTAPVVQGTDTVTKNASYTIGYGMGATIEADKNVKS
    YNLNNDKIIEGFSDALNAKKPAISPEEIAKNMDNLRNKVQQKMSEERVSSFLKVKDSIYGSDLTPKSDVKDPEVVVYEFF
    DYQ
    CMYCSKLAPQIEKVMQDNSNVQVVFAEFPIFGERAPASEYAAEVGTAIYKLYGADAYVKYHNGIFATGEDEGKLKDS
    TIDKVAVQCGADLTKVKKAIKDDKIADHLRDTLKLGFENLGIQGTPFLVIAPAVNANADNTTVIGGYTDADNIQSAIDKA
    KTAPKTVTATNNTTVVTTPTATAAVNDTQAQSNVTEAPVTDSGSSVTADQSNNQDDIEA

    >gi|167627909|ref|YP_001678409.1| peroxiredoxin, putative [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MNNDSPILPLLGDIFPNLGSVQTTHGIMNIPEDLKGQWFILFSHPADFTPVCTTEFVAFQKRFSNFEQLNCKLVGMSIDQ
    VFSHIKWTQWIHENLDIKIQFPIIAANDSLAMKLGMLHPGKGTNTVRAVFIVDPQSKVRLIMYYPQEVGRNMDEIVRSVK
    ALQLADKQGAVPAGWPNNELIGDRVIIPPANNEKTAQERLESSDCYDWWFCHKPLEK

    >gi|167627972|ref|YP_001678472.1| arsenate reductase [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MIVIYHNQECGTSRNVLEIIRAAGYDPIVIEYLKEGWTKSQLLGLFAAADLTPKEALRKTKSPAKELGLLDDNISDDVII
    NAMINNPILVNRPIVCSPKGVKLCRPSEEVLSILDKWPSGPFYKEDGQLLIDIKGQRYL

    >gi|167627986|ref|YP_001678486.1| thioredoxin [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MALSKVIKTDEANFDKLINSSTKPILVDFYADWCGPCKTLSPILDQLSKDYAGAVIVKVNVDDNQSLAAKFGIRSIPTMI
    IFKAGQPVETLTGVHTGSQLEQKLKAYE

    >gi|167628008|ref|YP_001678508.1| glutathione reductase [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MSNNHFDVISLGGGSGGIASAVQAAKFGKKVAIIEKHELGGTCVNRGCVPKKAMWYGANLAEALKHDVAGYGFDVEVKGF
    NWAKLKEKRATYIGNIHGFYDRLLDKWNITHFNNWGKFKNNKTIILDDGTELTADHIFISPGAYPIVPKNIEGAELGITS
    DEFFELEETPKKAVIVGGGYIGVEIAGVLNAHGTDTTVMVRRDKPLMEFDNCISDALVECMQMTNLNIMNHTNIIKVEKA
    GSTLKITTDTGKVLENVDTLIWATGRAPNTHNLGIENTDIEITDKGIIPANEWSETNVKGVYSLGDASGVPQLTPVAIKT
    GRYLARRLFNGETNLKANLEYIPTVIFSHPAIGTVGLTEKEARDKYGDDNVKIYKSRFTALYCAISGHRMPTVMKLVVTG
    DNERVVGCHMIGINVDEMLQGFAVAINMGATKRDFDDTIAIHPTSSEELVTM

    >gi|167628070|ref|YP_001678570.1| rhodanese sulfurtransferase [Francisella philomiragia subsp. philomiragia ATCC 25017]
    MSQIVVCAMYKFVTLEDYEAMRQPLLDTMIKNNVKGTLLLANEGINGTVAGSREGVNALLAYLKSDSRLADIDYKESYHQ
    EMPFYRSKVKLKKEIVTLGIEEIDPNKVCGKYVEPKDWNALISDPETILVDTRNDYEIEIGTFKNAINPSTETFREFPEY
    VDKNLDPKKHKKVAMF
    CTGGIRCEKSTALMKAKGFDEVYHLKGGILKYLEEVPKEESMWEGECFVFDSRVAVNHDLEKGS
    YDQCFACRMPITEEDKKRPEYVKGISCHHCYDKVTEEQKARFAEREKQSQLAAERGFSHVGDDAKKLAKLNKQQKQQAKE
    IARKKAKSEI