Francisella novicida U112 uid58499

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|118496949|ref|YP_897999.1| arsenate reductase [Francisella tularensis subsp. novicida U112]
    MIKVFGINNCTSVRNTLKFFEEKGKKVEYVNLRQEKPTWQEMQKIKQIGNFETIDLFNSNGKLFAEMSLKDRFDSLSEEE
    AFKLLVTDALLFKRPLVVDGNYARTGWNKKEYEEKWG

    >gi|118497001|ref|YP_898051.1| heavy metal cation transport ATPase [Francisella tularensis subsp. novicida U112]
    MSNKQQYLNFKVYGLDCIEEVNIIKKALSKKVAEEYMQFDLLNGKLSINASGISTKEIIALINKSGLKASTWDQYISKNH
    DTNFYSKYSRLITTITSGMFIVFGYVYHGLTAGFIDAFVANDSSTQLTPLISQISYLLAILFGSWFVIPKALASLKRFSA
    DMNLLMLIAIVGAIIIGQHFEAAIVSFLFAFSLLLESWSVSNARKAITKLMQLTPDKALVYCCHDKQFEEKPIAEINIGK
    RVLIKPGQRIPLDGIIIKGSGYINQAPITGESIPVEKTINDEVFAGSINGSSSIEIKTTKTADNSSVAKIIQAIEHAQTK
    RSKAEKWVDKFARIYTPTMIALALLIAILPPLLLGQDWLKWIYQALVILVIACPCALVISTPISIVSSLAKAARNGILIK
    GGEFIEIPATLKAIAFDKTGTLTLGQPTITEIFVAENFSEQYLITIAASLESSVDHPIAKAVLDYATNDNIVFTAASNTQ
    VIIGKGVTGEIDNNSFWLGNHAFAHEKQLCNNSLLHKKATQLADSGLTLIFVGNSKDIIGIIAIQDKIKANINICLKQLK
    NLGIMQTIMLTGDNTATAKAIATQAEIDEFYAELLPQDKVTKVEELVNNYASVAMVGDGINDAPALATANLGIAMAAIGN
    DIAIETADIALMSDDIAKLPWLIKHSKRTLSIIKQNISFAIAIKVIFISLAVFDLATLWMAIAADMGATLIVIINSLRLL
    K

    >gi|118497011|ref|YP_898061.1| methionine sulfoxide reductase B [Francisella tularensis subsp. novicida U112]
    MKKIILILAFIPIITLADTQNWQSFDKTQALAKLTRLQYYVTQKGGTERAFNNKYWNNHRQGIYVDVVSGEPLFSSTDKY
    DSGTGWPSFTKPIDNSFIKTKTDNSWFMTRTEVLSRYANSHLGHVFDDGPQPTGKRY
    CMNSAALKFIPKEDMQKDGYGKY
    LYLFTNKNLQ

    >gi|118497148|ref|YP_898198.1| stringent starvation protein A [Francisella tularensis subsp. novicida U112]
    MMKVTLYTTKYCPYSLRARIALAEKKMSTDIVEAGDLEPAMIKKIAPNGVFPVLMEKDYSINNRKALLIYIDERFPAPSL
    LPNVVNERIKIRLSLDKIDNEWYPVLDQIRKHRSDQKMLESMFKDLKESLLAMEKAFTGSEFFISSGFTLADCYIAALII
    CLEAEGFIIDDEYGAIYEYKKRLFARDSVKKANIKGGAGESLLKTLRAHR

    >gi|118497179|ref|YP_898229.1| thioredoxin reductase [Francisella tularensis subsp. novicida U112]
    MANHHKLIILGSGPAGYTAAIYAARANLKPVIITGMQPGGQLTTTTDVDNWPGEPDGIMGPELMEKLQKQAERFDTQIVY
    DTINAVDLQNKPFKLVGEVEQYTCDALIIATGATAKYLGLESEEKFMGKGVSA
    CATCDGFFYKNKDVAVVGGGNTAVEEA
    LFLSNIAKSVTLIHRRDTLRSEKILIDKLMEKAQHGNINIIWNTTLEEVLGDDMGVNALRIKNIKTNEESQIDVAGVFIA
    IGHTPNTSIFAGQLEMENGYIKVKSGLAGDATQTNIKGVFAAGDVADHVYKQAVTSAGTGCMAALDAEKYLDNLDQ

    >gi|118497196|ref|YP_898246.1| protein-disulfide isomerase [Francisella tularensis subsp. novicida U112]
    MKKLLVTLGISSVLILSSCANHQNIQAQEASVNHKTSNDYAKIIAIPDIVKDLLSDPATPTVGPQDANKAVVVFFDYGCG
    KCAEISKEINKLMKENPNVKFIFKAYPSLKRDAKVANYASLVANEAYLQGGSELFLAYNKAIFAQRETNGELTVQDVDNV
    VKRLGIKVNDTKLKQKAAAEELDTRKLGKLIGFQGPHSFVILPTNLASMNANDLGNNVDKVYVISDKQTNVITDNYQQAA
    KWVATNIQAQLNNIK

    >gi|118497209|ref|YP_898259.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis subsp. novicida U112]
    MSEVVQSVDPINFTEAASLKVKELIEEEGDNSLSLRVYITGGGCSGFQYAFAFDNEVKEDDMVITKNGVRLLVDSMSFQY
    LVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV

    >gi|118497294|ref|YP_898344.1| glutathione peroxidase [Francisella tularensis subsp. novicida U112]
    MSIYDFKLTANDGSEYHLPKNKVLLIVNVASKCGFTKQYRGLQHLHKIYPDLEIVAFPCNSFGGQEPGSDEEIKNFCETN
    YNVTFPIMKKTKVNGKDAEPLFEYLKERAKGVLGTEAIKWNFTKFLVSKDGETVVRYAPKTIPEDLIPDIDNFLKD

    >gi|118497347|ref|YP_898397.1| hypothetical protein FTN_0752 [Francisella tularensis subsp. novicida U112]
    MVEVFDPNASSILEVTDAAAKHFKKHLDKHDGCIGIYVGTKVMGCSGLAYDVDFVKQQPQDTQKVQQHGINFFVSNKSMD
    FLNGLKIDYVKHDFGLYKLEYTNPNESARCGCGESFTV

    >gi|118497357|ref|YP_898407.1| glutaredoxin like protein [Francisella tularensis subsp. novicida U112]
    MNNFKSIVLYRMVTPEKICPYGLKAKALFEQKGWSFEDNHLKTRAETDAFKAKYNLQTTPLIFIDGQQIGGYSDLLEFLG
    EK

    >gi|118497364|ref|YP_898414.1| bifunctional methionine sulfoxide reductase B/A protein [Francisella tularensis subsp. novicida U112]
    MLKTKSLTPHEYDIIINKATEKPFTGRYNDLDQKGVYICRNCGTPLFRADSKFISACGWPSYDIHIDNNVKQLPDADGRR
    TEILCNNCDGHLGHIFHGEGYTKLNTRY
    CVNSACVDFIPIEDFGTTEEIIVAAGCFWGVEYYMKKLPGVLFAESGYCGGD
    QPYPDYKKVCQGDTGYLEVVRVIFDTSKVSLQQVLKYFFEIHDFEQVDGQGPDIGEQYKSAIFYYDDKQKQIAEDLKQIL
    AQKGYKVATEIRAMKPYYVAEDYHLDYYMKKGTLPYCHSHKKIF

    >gi|118497366|ref|YP_898416.1| protein-disulfide isomerase [Francisella tularensis subsp. novicida U112]
    MTKKKLLKALAVAAIATSLVACSDSSSNDKTSTTAASSGSSVATTTVAAPADNTNVTANASYTIGYGMGSSIATDKNIKT
    FNLNNDKVMAGFEDAINAKKPAIPLEDIANNMNTLRDKMQQQMNQKAVTSFLSVQDGIYNSDLTPKSDIKNPDVVVYEFF
    DYQ
    CMYCSKLAPEIEKIMKDNSDVQVVFAEFPIFGQKLPASEYAAEVGTAIYKLYGADAYVKYHNGIFATGEDEGSLKNA
    TVDNVAKQAGADMTKVNKAIQDDKIADHLKDMLKMGFGQLGIQGTPFLVIAPAKNATVANTTIIGGYTTADGIQAAINKA
    KSTATTTSTSNNGQTDTKQAQNDIATVTAEAQATSGSTEQLAQQSQDDDSVEA

    >gi|118497383|ref|YP_898433.1| putative rhodanese, sulfurtransferase [Francisella tularensis subsp. novicida U112]
    MSQIVVCAMYKFVTLEDFEAMRQPLLDTMIKNNVKGTLLLANEGINGTVAGTRESIDNLLAYLKSDPRLVDIDYKESYHQ
    EMPFYRSKVKLKKEIVTLGVDEIDPNKICGKYVEPKDWNDLISDPETVLIDTRNEYEIEIGTFKNAINPHTENFREFPQY
    VDENLDPKKHKKVAMF
    CTGGIRCEKSTALLKAKGFDEVYHLKGGILKYLEEVPKEKSMWQGECFVFDSRVAVNHDLEKGN
    YDQCFACRMPITEDDKKRPEYVKGISCHHCYDKVTEKQKARFAEREKQSQLAAEKGFSHIGDEAKKLAQLNKQKKQQAKE
    AARKKTEKN

    >gi|118497426|ref|YP_898476.1| glutathione reductase [Francisella tularensis subsp. novicida U112]
    MSKNHFDVISLGGGSGGIASAVQAAKFGKKVAIIEKRELGGTCVNRGCVPKKAMWYGANLAEALKHDVAGYGFDVEVKGF
    NWSKLKEKRATYIGNIHGFYDRLLDKWNITHFNNWGKFKDNKTIVLNDGTELTADHIFISPGAYPIVPKNIEGAELGITS
    DEFFELEETPKKAVIVGGGYIGVEIAGVLNAHGTDTTIMVRRDKPLMEFDNCISDALVECMQMTDLNIMNHTNITKVEKT
    GSTLKITTDTGKILEDVDTLIWATGRAPNTHNLGIENTDIKITDKGVIPANEWSETNVKGVYSLGDASGVPQLTPVAIKT
    GRYLARRLFNGETNLKANLEYIPTVIFSHPAIGTVGLTEKEARDKYGDENVKVYKSRFTALYCAISGHRMPTVMKLVVTG
    NNEKIVGCHMIGLNVDEMLQGFAVAINMGATKRDFDDTIAIHPTSSEELVTLV

    >gi|118497448|ref|YP_898498.1| thioredoxin [Francisella tularensis subsp. novicida U112]
    MALSNVIKTDEANFDKLIDNTNKAVLVDFYADWCGPCKTLAPILDQLSKDYTKAVIVKVNVDENQNLAARFAIRSIPTLI
    VFKNGKQVETLMGVHTASQLEQKLKAYE

    >gi|118497550|ref|YP_898600.1| AhpC/TSA family protein [Francisella tularensis subsp. novicida U112]
    MTKKVPNVTFKTRVRDESIGGSNPFRWQDVTSADIFDNKRVIVFSLPGAFTPTCSTYQLPGFENNAARFKELGIDEIYVL
    SVNDSFVMNKWIQVQGIQNIKPIPDGNGEFTEALDMLVDKSNIGFGKRSWRYAMIVNNGEIEKMFVEPGKRDNADNDPYG
    ESSPENLLKYLESK

    >gi|118497552|ref|YP_898602.1| hypothetical protein FTN_0960 [Francisella tularensis subsp. novicida U112]
    MNKQQAIIYRMVTDKHICPFGIKAKDLLKRKGYFVEDIHLKDRQQVDEFKNKYDVKTTPQIFIDGNRIGGYDDLVKFFGL
    VKDKQAKSYKPVIAVFAMTFLLALAFGYFIAGNIFALLTIKVFMGLSIAFLAMLKLQNLDSFVNQFITYDLLAMRYLRYA
    YIYPFAEAFVGISIIAAIFSYLAALIAIIIGLIGAISVFYAVYIQKRELKCACVGGNSNVPLGFLSLTENIMMIAMGIWM
    IFM

    >gi|118497565|ref|YP_898615.1| AhpC/TSA family peroxiredoxin [Francisella tularensis subsp. novicida U112]
    MVLVGKKAPLFNAPAVLGNGEIVDSYDFAKAIQGKYAVVVFYPLDFTFVCPSELIALDKRTAKLKELGVEVVSVSIDSHF
    THNAWRNTPINDGGIGPVKYTMVADINQEIVKAYDVQAAGGMAFRGTFLIDKSGVVRHQVVNDLPLGRNMDEVIRMVEAL
    QFHEEHGEVCPAGWKKGDQGMKASPQGVAEYLSDHVIDL

    >gi|118497574|ref|YP_898624.1| glutaredoxin 1 [Francisella tularensis subsp. novicida U112]
    MKVKIYTRNGCPYCVWAKQWFEENNIAFDETIIDDYAQRSKFYDEMNQSGKVIFPISTVPQIFIDDEHIGGFTELKANAD
    KILNKK

    >gi|118497575|ref|YP_898625.1| bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta [Francisella tularensis subsp. novicida U112]
    MVEVRIYTKTNCPFCDLAKSWFGANDIPFTQISLDDDVKRAEFYAEVNKNILLVEEHIRTVPQIFVGDVHIGGYDNLMAR
    AGEVIARVKGSSLTTFSKTYKPFNYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVA
    VGQNYYDQFIPLFKNNEIRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDADPTTRRGLGLC
    LAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAV
    ELEDKFIELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNFFENRVTEYEVAGL
    TGSWDEAYSA

    >gi|118497591|ref|YP_898641.1| soluble pyridine nucleotide transhydrogenase [Francisella tularensis subsp. novicida U112]
    MEYNYDIIIIGSGPGGEGAAMKATRNGQKVAIIEDDAIGGGCNNWGTIPSKALRQLSREVWYNKKNFDFPEMLDTAYEIV
    IKQREIKRNRFANNEIDVFYGFASFIDKHKIKISRKNGSTEIITAKKFILSTGSRPYHPDDIDFTHPRILDSDKLLELKD
    KNIKSITIYGAGVIGCEYASILGTLDIQVNLINTRNKLMSFLDDEIIETLTNHFTVNQRINLIHNETYKSIKARGDKVVT
    TLNSGRIIESDYVLFALGRSGNTNGLNLDKIGVEYDPQRGLVKVNDNYQTTQENIYAVGDVIGFPSLASSAFNQGRFAAT
    HIIDGSCNDKLVEDIPTGIYTRPEISCIGKTEEQLTAENIPYEVGRAYFKDLARAQISGSETGMLKILFHKETLEILGIH
    CFGHRVSEIIHIGQAIKSMPGKHNTIRYFLNTTFNYPTMAEAYRIAGIDGLNKLKPKNKQFVPEHQ

    >gi|118497593|ref|YP_898643.1| hypothetical protein FTN_1001 [Francisella tularensis subsp. novicida U112]
    MQKKSFSILVLFVVILLVVLYIFSTTNLNKISPDNKQGLYLVEHAFPQYKVIKTFDTGIHLQAYILEDKKDPTKHSVTFT
    SEDGAVIVNGELLAWDSNQNKLTSLNNIYANYFTSSPQANNLYLNIKKYATYIQQGSDDAPHKFYAIIDPS
    CSYCNRLFD
    ATQPAINSGELAVRWIPLGALRNSPEIVRSIFNSKDPLEALIKYHKTKTYDQKLTQQNEKAENNLRLSSDIEGFPTIVYK
    TPQGALKISGGNKLPLTDATIAAKDNINKINEFLLLTSNSF

    >gi|118497624|ref|YP_898674.1| glutaredoxin 2 [Francisella tularensis subsp. novicida U112]
    MKIYLYHHCPYCIKVRLVADLSNFDYQMIILANDDEKAHIDRIGSKQVPFLEKDDGTFIKESDEICKFIAKVQNFEIAES
    TIDDFVKGCIADLEPHYRRIIYPRIPHHPRNECDFPTQSAKEYFINKKSQYIGDFDALLRNPPYDSIRAINQILAKIDPF
    IKTLFINGEKFSWDDINIFPIFFILTMSKDLLEIPTNITNYIKNIEAKTNIELY

    >gi|118497672|ref|YP_898722.1| hypothetical protein FTN_1082 [Francisella tularensis subsp. novicida U112]
    MIDFQYTYSQLSEQFYSRQAVYKYPNAKLLILNDSLVTELGLDLANKSQQQLLEFLLGYSSKKPISQAYAGHQFGNFTML
    GDGRAILIGEYKKPNGELVDFHLKGAGLTKFSRGGDGKAALAPMLREYIVSEAMYNLGIPTSRILAVITTGENIQRNQLQ
    QGAIAVRVASSHIRVGTFQYAAMLGESYSQELLDYTTTRHNIPHNDNKALSLLDYVIAKQTSLITEWERVGFIHGVMNTD
    NMTISGETIDYGPCAFMDSYDPDTVFSSIDRDGRYAFANQASIAGWNIARLAESLLKLISADEEEAIKLAQDKLQSYSEI
    YKNKWQKMFLAKLGLSINKAQNDEMISDLLIEMFKSKLDYTNTFYNLTYKNFGALKDCGLGEWLEKYITKNEINFANMKK
    INPVIIPRNHQVEKALKSAEDAKFGNLYNLVAALKTPYEFNILTENYITEPVEEEKVRFTF
    CGT

    >gi|118497699|ref|YP_898749.1| rhodanese-like family protein [Francisella tularensis subsp. novicida U112]
    MQHSAGFLKLVNDAKSRIQECTVDDIQKMNETQTLDGLLIDTREESEVANGYIPNAIHLSKGIIESAIESAVPNKNQKMY
    FY
    CGGGFRSALVADKLREMGYKNVISVDGGWRAWNAKDYPTVSPNQFRPNEFLKLVNNAKTQIKECSTTELYNKINSQEL
    DGIVFDVREDSEFNRFHIQGATHLSKGQIEVKIENLVPNKQQKIYLY
    CGSGFRSALAAESLQHMGYTNVVSIAGGIKDWL
    ANNYPVSQD

    >gi|118497965|ref|YP_899015.1| uncharacterized NAD(FAD)-dependent dehydrogenase [Francisella tularensis subsp. novicida U112]
    MTKKYLIVGGVAAGASAAARLRRLDESAEIIMFEKGPHVSFSNCGLPYHLGGYIEPAEKLILMTPEKFDKQYNIDARTNS
    EVIAIDRINKLVTVINHHSGDKYSESYDKLILAVGAKPIVPPFKGLETIEHFILRNVVDVKKIHQAVFDKQKPVKDITVI
    GAGFIGVEVAENLKERGFNVTIIEMANQIMRPFDYEMAKFLEKELLDNGVNLLLGEKVVGFESDKVLLESGKEIKTDLAI
    LAIGVAPDTNFLKEVGIDLAKTGHILVNDNYQTSDENIYAAGDAILVKNALTAQDFNLPLAGPANKQGRLIADHINGHKV
    VNKGYIGSSIIQIFNYTGAATGLNEAWIKFHNLDIDYEVAYTAPFDRVSIMPNAVNVFTKILFEKNTGKLLGAQVIGRGI
    VDKRADVFATAIKAGMTVEDLQDLELCYAPPYSTGKDIVNHTGYVANNLLKGDFKQVAFTKVEELLAQNAQIIDVREIGE
    TRRGMLTNAKNIPLSEIRTRLAEIDKNQPVYVH
    CQTGQRSYNVVLMLQQHGYDAYNIAGGYIMISHYYDTIAHMTGKKIS
    FTR

    >gi|118497966|ref|YP_899016.1| rhodanese-related sulfurtransferase [Francisella tularensis subsp. novicida U112]
    MNKVEKISVKQFLDLQKKEKVKLIDIRTPAEHSRECIDCAENILVDDIYDADIKPDEVVVLHCQSGNRTNQAASKVSGLN
    AKKVYLLDGGINAWKQHKQPTQKNVKEPLPIMRQVQIIVGFLVLLGVVLSFTVSQYFAILSGFFGAGLLFAGLTGTCGLA
    VMLEFLPYNRKK

    >gi|118497988|ref|YP_899038.1| thioredoxin [Francisella tularensis subsp. novicida U112]
    MSKCIDISDSQFESEVVNSDIPVLLDFWAPWCGPCKMLAPILDQVAEHYGDKIKVCKINIDDNEETAMKFGVRGVPTLMV
    FKDGENKETKVGVVQKTQLISIVDKYL

    >gi|118498007|ref|YP_899057.1| arsenate reductase [Francisella tularensis subsp. novicida U112]
    MDYFYDFYTNVIYNCSYSKNIINVMKIYHNPKCSKSRQAKQILDQNNIDYEIHLYLDKPLSKDQVIVLLQKLKLSIKDII
    RTKENIWKENFSDKEFTEAELIEIVVANPGLLERPIIENGDFAVVARSDEKIQQILNTY

    >gi|118498063|ref|YP_899113.1| dihydrolipoamide dehydrogenase [Francisella tularensis subsp. novicida U112]
    MSDIKTQVVVLGSGPGGYSAAFRAADLGLEVVLVERYAEIGGVCLNVGCIPSKAMLHIAKVINEARHLESLGIIEMGGLK
    INRENLLKYKDGVIGKLTGGLKGMAQMRKVKIVQGYGKFTSDKELAVEAADGKVTKIAFDNCVIAAGSSVIKLPFVPEDD
    RIIDSTGALEMKEIPETMLVVGGGIIGLEMAQVYSELGTKITVVEFADQLMNGVDKDLVKAYQKVNSRYDVRLKTAVTAM
    EAKEDGIYVTMEGDHPAKNERFDRVLMAIGRKPNGKLIDAEKAGVKVDERGFIPVDKQLRTNVPHIFAIGDIVGQPMLAH
    KAVPEGRTAAEVISGLNHSFDPLVIPSVAYTDPEVAWVGETETSAKAKGIKYEKGVFPWAASGRSLSIDRSEGMTKILFD
    ENHKIIGASIVGTNAGELISEAALAIEMGCDAEDIALTVHPHPTLSESLMMATEVYEGTATDLPPQKKKK

    >gi|118498095|ref|YP_899145.1| dihydrolipoamide dehydrogenase [Francisella tularensis subsp. novicida U112]
    MIKADICIIGGGSGGLSVAAGAVQMGAKVVLCEGNKMGGDCLNYGCVPSKAIIEASRVIAKVNKAQAFGINIDNNNIEID
    YKKVQEHIKTTIAKIEPHDSVERFETLGVNVIQEYAQIIDQYTVKAGDNFIKARYIVIATGSRAAIPKIKGLAEVNYLTN
    ETIFDLKEKPEHLMIVGGGPIGVELAQAYALLGSKVTIFEASDTILGVLDNDCRKIILKEFDRLGISIITNVNISEIAQD
    DQEINLYCGSKLYQGSHLLIAAGRVPNLDKLDLDNVGIKYTSRGIKVDSCLRTNHKNIYAIGDVVGGYQFTHVAGYHAGV
    VIQNILFKLPIKVDYNSLPWSLYTSPEVAYVGQNIAQAQTHGAKILKLSYQNNDRAVASLVTNGLIKVAINKKGYILGAT
    IVGENASELIVQWTIAIKNKLKIKNMASHIVAYPTLSELNKRLAGNYFTPVLYSNKVRSLVRFLMKIFGKKL

    >gi|118498097|ref|YP_899147.1| methylated DNA-protein cysteine methyltransferase [Francisella tularensis subsp. novicida U112]
    MLKETHQIYLAAINKKSYKTVFYAQEIQTPIGNFIAVADDDYLYACFFINHSNINSIEKLLKVYNAKISFKTNDITNQTK
    NQLDKYFNKELKAFSIPLRLTGTDFQKQVWGELIKIPYGETISYLEEAKNIGNPTAFRAVANANGKNLFPIIIP
    CHRVIN
    TNGKPGGYTCGLDKKEFLLNLESNKES

    >gi|118498205|ref|YP_899255.1| glutaredoxin-related protein [Francisella tularensis subsp. novicida U112]
    MYTPEEQKVVERIEKQLKENDIILYMKGSPNLPQCGFSAHAATAIRSCGKPFAFVNILENPDIRAILPKYADWPTFPQLW
    VKGELIGGCDIIMEMNESGELKKLIDSVK

    >gi|118498311|ref|YP_899361.1| bacterioferritin comigratory protein [Francisella tularensis subsp. novicida U112]
    MKTLEQGQIAPNFKLENQNNEEVLLSDFKGKKNVLIYFYPKAMTPGCTTQSIGLSSINEKLTELDTVVLGISPDAPKRLK
    KFEERDNLTVQLLSDEDHKVAELFGVWGEKKFMGKVYDGIHRISFFIDKNGKIQHVFKDFKTKDHHEIVLEYIQNHKNS

    >gi|118498326|ref|YP_899376.1| peptide methionine sulfoxide reductase [Francisella tularensis subsp. novicida U112]
    MIKKIIYSLSILSCSLGFSADSDTKYEKAIFAGGCFWCLESDFEYMQKHQDLSHNGIIKVISGYDGGLQKDPTYKTVSAG
    ITNYKESVEVIYDPTKISYQELVEYFYRRIDPTDSKGQFCDKGKQYQSAIYYNNDKQKQVAEEVTKKLKEEFKKHNQSVY
    TQILPSTHFYKAESYHQDYHHKNPKRYCYYRTGCGRDLTINKVWQNIDWKYSNVVPFDIPSSYAECLTR