Alkaliphilus oremlandii OhILAs uid58495

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|158319089|ref|YP_001511596.1| D-proline reductase (dithiol) [Alkaliphilus oremlandii OhILAs]
    MSLSIVKGLQSEIFVPITPPPVWTPVKKELKDMTIALATAAGVHLKSDKRFNLAGDFSFREVPVESLSTDLMVSHGGYDN
    GDVNKDINCMFPIDRLKELAEEGFIKAAAPVHFGFMGGGGDQQKFQEETGPEIARRLKSEGVDAVLLTAG
    CGTCHRSAVI
    VQRAIEESGIPTIIIAALPPVVRQNGTPRAVAPLVPMGANAGAPNDKAMQTAIVRDSLIQLVEITSAGKIVQLPYEYTAK
    V

    >gi|158319113|ref|YP_001511620.1| copper-translocating P-type ATPase [Alkaliphilus oremlandii OhILAs]
    MKAIRTVSVKGMTCAACSAAVERNLSKAEGISKATVNLATEKLTVEYDTEKISMEDMVTRIDKLGYKLIDEEDFREIVIP
    IKGMT
    CASCSAAVERALKKQEGVVATSVNLATEKATVKYNNDVIKISQIKNAIEKAGYEPLDIEVEASNDKDKEAKENEI
    KGLWKRFVVALIFTAPLFYISMGHMLGAPLPEVINPHHNPLNFAIVQLFLTIPVMLAGHKFYTVGFKTLFKGSPNMDSLI
    AIGTSAAFLYGIYAIKEIAGGNQDMAMELYFETAGVIITLIMLGKYFEAVSKGKTSEAIKQLMGLQPKAATVIVDGKEVK
    IPIQEVEVGHKIVVKPGEKIPVDGIVIEGYTSVDESMLTGESIPVEKNKGDRVTGGSINKNGSIAFEATKVGKDTALAQI
    IKLVEDAQGSKAPIAKMADIISGYFVPIVIAIAVIAGVIWYFTGSSINFSLTIFISVLVIACPCALGLATPTAIMVGTGK
    GAEYGVLIKGGEALETAHQIKTVVFDKTGTITEGKPKVTDIITNEQITEEELLTLAASAEKGSEHPLGEAIVKAGEERNL
    ILKKVDRFTAIPGHGIEVTIEGKNMLLGNKKLMADRKISITLQNESDQLATEGKTPMYITIDGDLAGIIAVADVVKGSSK
    AAIDALHRMGIEVAMITGDNRRTAEAIAKQVGIDIVLAEVLPEDKSNEVKKLQASGKKVAMVGDGVNDAPALAQADIGMA
    IGSGTDVAMESADIVLMRSDLMDVVTAIQLSKKTIKNIKENLFWAFAYNTAGIPIAAGVLYALGGPLLNPMIGAGAMALS
    SVSVVSNALRLRGFKPSHR

    >gi|158319114|ref|YP_001511621.1| copper ion binding protein [Alkaliphilus oremlandii OhILAs]
    MKKKIMIEGMSCGHCSGRVEKALKEQSAVKAVTVDLASKNAVVELSEDLSDDVIKEIIDDAGYDVVGIENL

    >gi|158319201|ref|YP_001511708.1| methylated-DNA--protein-cysteine methyltransferase [Alkaliphilus oremlandii OhILAs]
    MYYKTTYPSPVGILTLACGGDHLVGVWNEGQKYHGDTILKDMIENNNLPIFDSTKKWLDRYFAGQRPDISELPLAPLGSA
    FRQQVWRILCDIPYGKVITYGDIAKQMAVKMNKKSMSSQAIGGAVGHNPISIIIP
    CHRVVGSKGSLTGYAAGVHIKVKLL
    ELEGADMLPLFVPKV

    >gi|158319328|ref|YP_001511835.1| NADH dehydrogenase (quinone) [Alkaliphilus oremlandii OhILAs]
    MKIIVGQGSCGIAAGANKVYSVLKEQIEHRNLDIELKSTGCIGMCYLEPIVDLIDENGHKETFVKVDGDMANAIVAAIAE
    RQGNSSTIEEVDREILSKQKRVALKNCGIIDPENIDEYIATGGYEAMKKCLETMTPEDVIEEIKISGLKGRGGAGFPTWF
    KWNAAKQSPGSVKYVVCNADEGDPGAFMDRSVLEGDPHNLIEGMIINGYAIGANEGIIYVRAEYPLAINRLNHAIEEARS
    RGYLGKNILGLDKFDFDLRIKAGAGAFVCGEETALIESLQGERGMPRLKPPFPAQRGYWDKPTNINNVETFANVAWIINN
    GGAAFGHMGTENSKGTKVFALTGKIKKGGLVEVPMGITLRDIVYDIGGGIKGDKEFKAVQMGGPSGGCIPAELLDTSVDY
    ESIAKIGAIMGSGGMVVMDETTCMVDMARFFLDFTRKESCGKCIHCRIGTKRMLEILTRICEGEGKEGDIELLEDLGEKI
    KEGSL
    CGLGQTAPNPVLSTIRYFREEYESHIHRKKCPAKQCRNLLEYNILDEKCIGCGLCRRNCPVEAISGETKKVHSIN
    QELCIQCGKCYEVCKFGAVIVD

    >gi|158319348|ref|YP_001511855.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Alkaliphilus oremlandii OhILAs]
    MAERMVGLKAPYFEMNTANGDGKDFGKISLEDYKGKWLVMFFYPLDFTFVCPTEITAISKRVAEFNKLNAEILGVSTDSE
    HSHKAWINAAQDKGGLGQITFPLASDRTQSVARDYGILIEEEGIALRGLFIIDPEGVLRYSVVHDLNVGRSVDETLRVLQ
    GLQSGGLCPIDWHPGDNTL

    >gi|158319449|ref|YP_001511956.1| rhodanese domain-containing protein [Alkaliphilus oremlandii OhILAs]
    MKNIVSQQWLKNNLSLDHLVLLEARETFDATDSSANQHIPKAQYVLLEEHMSGELQPHGGRHPLPDMEKFVRDMEAFGIN
    DESIVVIYDSGSMAPAGRLWWLFKYIGKDQVFVLEGGLTKWMENGFTVTTEQFVPKPSGHLSLNINDAMLVDMQYVKDTI
    GSKNIALVDARASERYAGEVEPIDRVAGHIPGAINYPWMNLTVNQEIMEREALEKYFEPLKEFEEIIVY
    CGSGVTAVVDI
    LFMEEVGLNPKLYAGSYSDWISYEDNEIITK

    >gi|158319502|ref|YP_001512009.1| hypothetical protein Clos_0451 [Alkaliphilus oremlandii OhILAs]
    MIVQQLFESGMSFEVFAPNDHDVNMEKLLKIYEQIQLDEEFINKIKFIHKNIYILVFAELWCPDCIINLPAIKKISEVNP
    NITFRILPRDGYEQYMEPYKIGGKPKIPTCVIFNDKFEEIGAFIEYPKILRDIVNKGNQVEVIVAKRKYHKGEYVVDTIK
    EIFDLIMKAI

    >gi|158319681|ref|YP_001512188.1| arsenate reductase and related [Alkaliphilus oremlandii OhILAs]
    MKYLFIHYPKCSTCRNAKKWLDGNHIEYEERLIKENNPTEVEITEWFHKSSYPIKRFFNTSGNLYKELQLKDKLPTMSEE
    EQIKLLATDGMLVKRPILVGEGTVLLGFKEEEWNQLK

    >gi|158319683|ref|YP_001512190.1| OsmC family protein [Alkaliphilus oremlandii OhILAs]
    MNSTKITASLKGNMAFEMDLNGHTLITDAAPEIGGENLGPRPKALLLSGLIGCTGIDVMMILNKMRVKPDDVIISAEADQ
    TDTEPKVYKTIHLIYTFKGKDLPVEKLQRAVRLSQEKYCGVSAMLEKAAPITYEIRVEE

    >gi|158319702|ref|YP_001512209.1| thioredoxin [Alkaliphilus oremlandii OhILAs]
    MVMEVNQGNFNEVIKDTVPVLVDFWAPWCGPCKMLGPVLEEVAVELEGKMKVTKLNVDENQEISMEYGVSSIPTVLVFKE
    GALVDRFVGFMPKAAIIQKLEKHI

    >gi|158319703|ref|YP_001512210.1| thioredoxin-disulfide reductase [Alkaliphilus oremlandii OhILAs]
    MSERYDIAIVGSGPAGITAAINAKIRNKKIILFGYENLSNKLYLAPRIDNYVGFHGIRGKELAEKFKAHLDEMDIEITYE
    RPDNIYAMGDYYAIMINGKLYEATALILATGIQFGKPFRGEAEFLGRGVGY
    CATCDAPLYKGKTVTIIGYNKESIEEANY
    VSELAEKVYFVPMMKEEYSLNHNIEVIQDKPVEIVGSTKVEKLVLKNSEIQSDGIFILRDSVPPDQLVPGLLVEDAHIKV
    NRDMETNLEGCYAAGDVTGKPYQYLKAMGEGQVAALNAVAYLERRKLNSDGVSNPTEGK

    >gi|158319724|ref|YP_001512231.1| redoxin domain-containing protein [Alkaliphilus oremlandii OhILAs]
    MADIRKNLVTMGGNPVTLVGKEIKVGDPAPDFTVLKNDLSPFTLKDAGNTVKIISVVPSLDTGVCELQTIHFNQEAAELG
    DVKILTISVDLPFAQKRFCGAQGIDKVITLSDHRDLSFGENYGFVIEELRLLSRGIVVLDKENTVRYVEYVKEVTEHPNY
    DRAIEEAKKLI

    >gi|158319829|ref|YP_001512336.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Alkaliphilus oremlandii OhILAs]
    MKVENLFYKEENRVKKQIIKLGTVLLLIASTMIFILNGCSQKINGTNVNKKYAEKGMVNLIGEPYNYEKGTVDKGIGLGF
    VLTDKENELMEKEQLGIERNPRLGYTFSYITENGVKMLKEPSILDGKTDMPNITAAFFNYAAIYKIPNDSKDEIGEITMK
    YLTDTYSNKKAVATLKEHTYYFAWNEDYSSIDDLSEQDKKNIEALISNFDSFVNNFCIFPSSNVEKNMKNFNAKMLNGGN
    FTQEDFAKYDITMVNIWATW
    CRGCVEEMPELQAVYEKLPENMNMISICSNAGTEAELAKEILDKKGCKFPTLIPDEKLEE
    SLLDYLDAYPTTVFVDSKGNIIGEEQIGAPSQNKEDVTDAYLNLMNEILERFSK

    >gi|158319931|ref|YP_001512438.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Alkaliphilus oremlandii OhILAs]
    MSKKIVIVGGVAGGASAAARLRRMDENAEIVLFEKGEYISFANCGLPYYIGNIIEERDALLVQTVEGMSQKFHMDIRVFS
    EVIKIDPSKKKVTVKNLKTDESYDESYDILLLSPGAHPVKPPIPGISEAENLFTLRNIPDTDAIKSFVDHSAPKSAVVIG
    GGFIGIEMAENLHHRGLKVTIVEASDQILGPIDYEMAAILHNHIQSKGVDLILGDGVKSFENRGNRIVLQSGKEIETDLI
    VFAIGVRPETQIAKDAGLKLNERGAIQVNEYLQTSNESIYAIGDAIEVTDFISGKPAMIPLAGPANKQGRIVANNICGKF
    EKYVGTMGTSVVKVFDMTVASTGNNEKLLKSNEVSYEAIHIHPGSHAGYYPGALPISMKMLFDPSTGKIFGAQAVGYDGT
    EKRIDVIATAIAAKMSAVDLKELELAYAPPFSSAKDPVNMLGFVAANMMDGLIDTVQWHEIDDIVKNGGILLDVRETIEY
    HLGAIQGSIHIPLGELRSRFNELPKDKVIHIY
    CQVGIRGYNAARILVQNGFKVKNLDGGFKTYGSVFLNNNFNDCIVKID
    DSGVAKIDCSTGEIK

    >gi|158319972|ref|YP_001512479.1| methylated-DNA--protein-cysteine methyltransferase [Alkaliphilus oremlandii OhILAs]
    MKNIFFYHTPIGKIGIAESNNAITHVYFDEEIHEKDMEIKETPVLKEAGRQLMEYFEGIRKDFDLPLAPQGTAFQQKAWK
    ALQEIPYGETRSYGDIAKRIGNPKACRAVGMANNRNPIGIIIP
    CHRVIGANGKLVGYGGGLHIKAYLLKLEKEKVNA

    >gi|158319990|ref|YP_001512497.1| thioredoxin reductase [Alkaliphilus oremlandii OhILAs]
    MENILDVIIIGGGPAGLSAGLYAARAKMTTLILEKEKAGGQIVSTAEVANYPGSMENATGPILIDRMLEQCKEFGATFEK
    DTITEIDVNGPIKVLKGEKATYQAKSIIIASGANPRPIGAPGERELIGKGVSY
    CATCDGDFFTDLEVFVIGGGDSAVEEA
    IFLTKFARKVTIVHRRDELRAAKSIQEKAFKNPKINFIWDSTVEEIKGDGIVESVVFRNLKTNEITEYMADEEDGTFGIF
    VFVGYIPATNIFKGIINMDETGYIITDDNMKTNVPGVFAAGDCRVKSLRQVITAAADGAIAAIQAEKYIENELA

    >gi|158319991|ref|YP_001512498.1| thioredoxin domain-containing protein [Alkaliphilus oremlandii OhILAs]
    MLELDKDTFEGEVLQADGYVLVDYWSDGCEPCKALMPDVEELQKQYGDQVKFTKLNTTGARRLAIKEKVLGLPTIALYHN
    GAKVDEVTKDDATKANIEAMIQKYL

    >gi|158319993|ref|YP_001512500.1| glycine/sarcosine/betaine reductase complex protein A [Alkaliphilus oremlandii OhILAs]
    MARFDGKKIIIIGDRDGIPGPAIEECLKGTGAEVVFSATECFVCTAAGAMDLENQQRVKDLTEKYGADNVVVVLGAAEAE
    ASGLAAETVTAGDPTFAGPLAGVQLGLRVYHAVEPQFKDEVDAGVYDDQVGMMEMVLDVDSIVEEMNNIRSEFSKYND

    >gi|158319994|ref|YP_001512501.1| selenoprotein B [Alkaliphilus oremlandii OhILAs]
    MSKKRVVHYINQFFAGIGGEEKADIRPELREGVVGPGMALNTAMNEEAEIVATIICGDSYFNENLEEAKNEIIEMVKKYN
    PDLFIAGPAFNAGRYGVACGTIAKAVNDELEIPVLTGMYIENPGADMFKKNIYIVETGNSAAAMRKAVPAMASLAAKLLK
    GEAIGTPKEDQYIPRGIRKNYFSEEKGATRAVNMLMKKLKGEEFTTEYPMPDFDRVDPNPAVQDLSKIKIAIVTSGGIVP
    KGNPERIESSSASKYGKYDISSFDDLTEADHETAHGGYDPVYANIDPDRVIPVDVLRDMEKEGVIGELHKYFYTTVGNGT
    SVGNSKKFAEEFAKELIADGVQAVILTST
    CGTCTRCGATMVKEIERAGIPVVHMCTVVPISLTVGANRIVPTVAIPHPLG
    NPNLEPKEEKALRRKLVEKALEALTTEVAGQTVFE

    >gi|158320063|ref|YP_001512570.1| protein of unknown function DUF395 YeeE/YedE [Alkaliphilus oremlandii OhILAs]
    MTSNKIEELKNKRKREIPNKKSQLPYFFMVAFIAFIICAYLYNRNIRHSIVWTIGLLIGITMQRSRFCFAASFRDPIMVG
    TTSLFRAVIIGLIICTIGFSIFQQITIGNEINYVVDDVPGQIYPVGFHTIFGALLFGIGMVIAGG
    CASGTLIRIGEGYLM
    QGMVLIGFVIGATLGSSHFEFWDQLFISTSKTVYIPKYIGFIPALILQLLILCALYIFAHWYDKKNNMMADL

    >gi|158320065|ref|YP_001512572.1| protein of unknown function DUF395 YeeE/YedE [Alkaliphilus oremlandii OhILAs]
    MTLKDKILKKPWPYWVGGIILALLNVLLLFTTGSAWRISTSFLYMGASILEKIGIQASDWYYFNVYGNELNVGENYLSNS
    TMILAGAMVIGALMAVLLVSEFKFKKIKNRKQWIVALIGGILMGYGTRLSFG
    CNIGAYFSAIPSFSLHGWVFGAFMFVGA
    WLGSKILFKYIL

    >gi|158320072|ref|YP_001512579.1| alkylhydroperoxidase [Alkaliphilus oremlandii OhILAs]
    MAKDVRQMLQDFTGGLEALSSSNGAQVEAFMNLLGAAYEPDALDLKMKELISIGVAIYNRCEYCIVFHTYNALQAGATRK
    EIIEAAMVAVAFGGGPSMAYSVTLLKDSLDEFEKDFK

    >gi|158320073|ref|YP_001512580.1| dihydrolipoamide dehydrogenase [Alkaliphilus oremlandii OhILAs]
    MIVEVKLEKLSGHNKSGVIGSIHKKSGDIVKVGEEIFDIEAKKGNITITSDVEGEIVEIKVKEGDPVSIGDVLLMVEGEK
    ADSKGEANKKQGFNYMANFLKPQKESMDSDIVIIGGGPGGYVAAIEGAKQGAKVILIEKEELGGT
    CLNRGCIPTKALVRS
    SEVYELVKNSAEYGVFNSSSSYDFSKIIARKNDIVNELVGGIDYLLSKNNVTVLKGSGEILDKNTVFVKEKNKEITINTN
    NIIIATGSKAFVPPIKGAASKNIVTSKEMLNLSELPQKIIIVGGGVIGMEFAFICNALDTDVSVVEFAEDILVALDEDVR
    TEIREIAIEKGIKIYTSSKVEEIIDTEEGQSIVVFDKNGTKGYITGDKVLMSVGRVPFYGDIDLEKLGIDLNEKGRGIKV
    NSKMQTTVDNIYAIGDVTNIIQLAHVASHQGIIAIENILGKDVEANYEVVPSAIFTSPEIASVGIHEKAAMEQGISVKTG
    KFPFGANGKALTQGERRGFVKIITEEATGVILGGSIIGPHATDLIHEVAVAIQNKLTAEQLINTIHAHPTTAEAVHEALL
    ATTPKGAIHFAE

    >gi|158320102|ref|YP_001512609.1| heavy metal translocating P-type ATPase [Alkaliphilus oremlandii OhILAs]
    METKSLKIQGMTCASCAASVEKATKKLQGVKESNVNFATEKLNITFDETKVSVGDIQAAVEKAGYKAISDSANRTLKIEG
    MT
    CASCAQSVEKAVKKLDGVNEASVNFATEKLNISYDSSKVKTIDIKKAVEKAGYKAIEEETTVDADKERKEREMKVLWR
    KFIVSAIFTIPMLYITMGHMLGIHLPEIIDPMMNPTNFGLAQLILVIPSVIAGYKFYTVGFTALIRRSPNMDSLIAIGTA
    AAFVYGIFAIVQISEGNIEYANDLYFEAASVIITLILLGKYLESVTKGKTSEAIKKLMGLAPKTAIIIRDGKEVEISIEE
    VEVGDVIVVKPGEKMPVDGVVVEGNTSVDESMLTGESIPVEKNAGDNIIGASINKNGTIKYKATRVGKDTALAQIIKLVE
    DAQGSKAPIAKLADIISGYFVPVVIVLAIASGLAWYFIGGESLLFALTIFISTLVIACPCALGLATPTAIMVGTGKGAEN
    GVLIKSGVALETAHKIKTIVFDKTGTITEGKPKVTDVVVANGITEDELLQLTASAEKGSEHPLGEAIVKGAEEKGLEFKK
    LDKFAAIPGHGIEVTIDGKVILAGNRKLMVDRKIAIDKLEDASNKLAEEGKTPMYVAIDNKIAGIIAVADTVKENSKRAI
    EKLHKMGIEVAMITGDNKRTAAAIAKQVGIDRILAEVLPEDKANEVKKLQAEGRKVAMVGDGINDAPALAQADIGIAIGS
    GTDVAMESADIVLMRSDLMDVPTAIQLSKSTIRNIKENLFWAFAYNTLGIPVAMGVLHIFGGPLLSPVLAALAMTFSSVS
    VLLNALRLKGFKPVR

    >gi|158320103|ref|YP_001512610.1| heavy metal transport/detoxification protein [Alkaliphilus oremlandii OhILAs]
    MKKKILIEGMSCGNCVKHTEEALKEICGVKSVKVDLEGKNAVVDLAHPVDDAKFKAAIDEAGYEVVGIEEL

    >gi|158320122|ref|YP_001512629.1| heavy metal translocating P-type ATPase [Alkaliphilus oremlandii OhILAs]
    MSQKIRKELILEGLDCANCSAKIEYEANQIAGVSVSMNFMTKTLTIETENGQELERILVQINTIVNKHEPDVIVREKTIN
    KGEKKALILVGLG
    CANCAAKMETQIKNLTGVKNATVDFVSKKLTIEANSKQDLKRIIEEATAIVKRIEPDVKVVDEEQKR
    KSDNKRIFILDGLG
    CANCASKIESEVKKIEGVKVASVDFVSKKLTMETDANINFEKLNEGIVSIVKRIEPDVKVISAEEI
    IKEKANDDEEDSNKKEIIRLGISGALFAIGLAFNLPSWLELTVFLISYIISGGKIVLKALKNITRGQVFDENFLMSIATI
    GAFFIGEYPEGVAVMLFFQVGEFFQELAVNRSRKSISALMDIRPDFANIKIGDDIKRVSPEEVSIGDIIVVKPGEKVPLD
    GKVVEGSSMVDTSALTGESVPREVEVGNDVLSGFINKNGLLTIEVTKEFGESTVSKILDLVQNASSKKAPTENFITKFAR
    YYTPVVVVIAVLLAIVPPLVVPGATFSDWIYRALVFLVISCPCALVVSIPLGFFGGIGGASRSGVLVKGSNYLEALNNVE
    IVIFDKTGTLTKGVFNVTEINPQNNYTEEELIEYAAYAESYSNHPIAVSILKAYEKEVDKSKIESYDEISGHGIKVKVEG
    KEILAGNIKLMNKENIQVSKVESVGTVVHVALNNVYAGYIVISDEVKDDSASAIKALKALGVKKTVMLTGDVRSVGEKVG
    KQLGLDEVYAELLPTEKVEKLELIDKQKSPKGKLVFVGDGINDAPVLARADIGMAMGGLGSDAAIEAADVVIMTDEPSKI
    ATGIKIAKRTRKIVWQNIILAMGVKLIFLILGATGVASLWEAVFADVGVTVIAVINAMRVMRVKDI

    >gi|158320124|ref|YP_001512631.1| hypothetical protein Clos_1089 [Alkaliphilus oremlandii OhILAs]
    MAKRLIEVFTAGCYVCDNTVKQIKELACPNCEVIVYDLNKKCETNECEDKAKKYGIQSVPAVAINGKLVDCCKNKGIDIE
    ALKAAGLGQ

    >gi|158320129|ref|YP_001512636.1| arsenite S-adenosylmethyltransferase [Alkaliphilus oremlandii OhILAs]
    MAKSREDIRGFIRKNYAQVAKKGNVGGCCSGGCSCSDAPIDINETSMKLGYTENDLSNVPTEANMGLGCGNPIAIANLKE
    GEVVLDLGSGGGFDCFLARRQVGESGYVIGVDMTPDMISLARKNAEKSGYTNVEFRLGEIEHLPVPDSSVDVIISNCVIN
    LSPDKKQVFKEAFRVLKAGGRLSTSDVVATAELPQNIKDDLSLIAS
    CIGGAEYVEDIKEMIKQAGFKNIKLTSKDNSRDI
    VKEWAPNKNIEDFISSYIIEAVK

    >gi|158320159|ref|YP_001512666.1| redox-active disulfide protein 2 [Alkaliphilus oremlandii OhILAs]
    MLIKILGSGCRSCTILKENTEEALKEVGMEAEIIKVEDFVDIMEYGVMSTPALVIDEKVVSYGKVLKPKEIVKILNK

    >gi|158320173|ref|YP_001512680.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Alkaliphilus oremlandii OhILAs]
    MLHYDIVVIGGGPAGLAAAIEARKNGVKKILIIERDTELGGILQQCIHNGFGLQVFKEELTGPEYAERFIKELITMGIEY
    KLDTMALEVSENKVITAVNPVDGMLHIKAGAIILAMGCRERTRGAIRIPGTRPAGVMTAGTAQRFVNMEGYMIGKKVVIL
    GSGDIGLIMARRLTLEGAEVLAVAELMPYSGGLTRNIVQCLEDFNIPLYLSHTVTNVEGRHRVESVTIAQVDERFKPIEG
    TEKKFQCDTLLLSVGLIPENELSKSAGIALDSITGGPIVNESMETSVEGIFACGNVVHVHDLVDWVTAESKRAGISAAKY
    IKGQIENNCKTIHLKGINGVRYIVPHQIRLENVEEKVELMMRVDNIYKDVKLVVRNNTDVIKEIKRNHVAPGEMETIQLD
    LSQCNLNDCDEICVEIVKKEA

    >gi|158320767|ref|YP_001513274.1| selenide, water dikinase [Alkaliphilus oremlandii OhILAs]
    MNQNRRLTQMTKSAGCAAKLGPDVLAQVLCDLPKIEDPNLIVGLETSDDAAVYKINDDMALIQTLDFFTPVVDDPYTYGQ
    IAAANSLSDVYAMGGRPLTAMNIVCFPNCLDPKILNQILKGGADKVLESGALLVGGHTVEDDEPKYGLSITGIVHPKKVW
    ANSTAREGDYLILTKPVGLGVLNTAIKADIATKEQYDGAVKVMSMLNKYAFEALENLDVSACTDITGFGFLGHVYEMAKG
    SGVSIEIFADKVPLIDGAKELATMGIIPAGMYSNKKHIENEVLKEQDIEDAIEDLLYDPQTSGGLLVSISEKDLPDALEN
    LSLIESNGFSVVGRVLPRSDYAVYVK

    >gi|158320800|ref|YP_001513307.1| electron transport complex, RnfABCDGE type, A subunit [Alkaliphilus oremlandii OhILAs]
    MTLESIFVILVGGILVNNYVLSRNLGICPFLGVSKQVETAFGMGMAVTFVMTLAGLITYLVQTFILNPLGLGYMQTVTFI
    LVIAALVQFVEMVIQKSSPTLYQSLGVYLPLITTN
    CAVLGVAILNIKENYNLIETIVNSAASAIGFSLAIVLFAGIRERL
    ELSNIPEAFKGFPIALFTASLMSMAFLGFSGLV

    >gi|158320801|ref|YP_001513308.1| electron transport complex, RnfABCDGE type, E subunit [Alkaliphilus oremlandii OhILAs]
    MSIKKVFNDGLIFNNPTFVQVLGMCPTLAVTTSATNGLGMGLATTAVLIGSNMVISMLRKVIPDQIRIPAFVVVIATFVT
    IIEMLMQAYVTPLYEALGIFLPLIVVN
    CIILARAEAFAFKNSIFVSAVDGIGNGLGFALALTILGSIRELIGAGSIFGKQ
    IMWSSYEPFAIMTQAPGAFLVLGLLLALFGSLAAKQKNA

    >gi|158320974|ref|YP_001513481.1| peptide methionine sulfoxide reductase [Alkaliphilus oremlandii OhILAs]
    MDTNQKLSIAVFALGCFWGPDAQFGSIKGVVSTRVGYAGGTTNNPSYYNLGDHSESIEIQYDANVITYGELLNIFWNLHN
    PVYETTNRQYMSRIFYLDDGQKSEALEMKRQIEAANGEKIYTEIVPLENFYLAEGYHQKYYLQNTTKLYQTLKAIYGGFG
    NLVRSTLAARMNGYIAGNLSIASLKEEMDLVELPEDQYEKVLSIVEEIK

    >gi|158320990|ref|YP_001513497.1| hypothetical protein Clos_1963 [Alkaliphilus oremlandii OhILAs]
    MKQGKGKIIVAGGIIGFISALLVKLGNPVNMGICVACFLRDIAGGLGLHGAGNVQYIRPEISGFILGSFIIAKMKGEFKA
    RGGSSPLLRFVLGFFLMIGALVFLGCPLRMILRLANGDLNAVVGLIGYVFGIFIGIQFIKRGFSLGRSVSQPESNGYIMP
    VFAVGLLVLLFLKPAFLLFSENGPGALKAPALVSLTAGLIIGIILQRTRLCTAGGFRDAILIKDFYFLWGLIGIFVFALI
    GNLALNPESFKIGFTGQPIAHTDFLWNFLGMVLAGITSALLGG
    CPLRQTILAGEGDADAVITVLGLMAGAAFAHNFGLAA
    SPSGVGINGKIAVIIGFVVVLGIGYNVIQYNKRIRSRKEDLNTKGGEIHA

    >gi|158321074|ref|YP_001513581.1| heavy metal transport/detoxification protein [Alkaliphilus oremlandii OhILAs]
    MTNKTYQMETISCPSCITKIEGALKKVAGITQYEVLFNTSRVKVSFDESIVSSEEIKGRIENLGYDILSEK

    >gi|158321081|ref|YP_001513588.1| methionine-R-sulfoxide reductase [Alkaliphilus oremlandii OhILAs]
    MSEKYLKPEDKVLREKLTPVQYEVTQNNATERPFTSEYNAHDEEGLYVDIVSGEPLFSSKHKFDAGCGWPSFTEPIEHEN
    VLEKKDRSHGMIRTEVRSKHGDSHLGHVFNDGPKEAGGLRY
    CINGASLKFIKKEDLEKEGYGEYLKIFE

    >gi|158321154|ref|YP_001513661.1| glutaredoxin [Alkaliphilus oremlandii OhILAs]
    MAKEVIVYTSNTCPHCFTVKEFLSENNVEFTEKNIQTDAAARKELMKKGIMAVPVIQIDEEVVVGFDRDKIEELLG

    >gi|158321169|ref|YP_001513676.1| hypothetical protein Clos_2144 [Alkaliphilus oremlandii OhILAs]
    MFEREVADFLETLRTRREFLKISGKGIAGITVTASMMNMLGYTNVDVASAETYVTAKGILISERNKCVGCQRCEMVCTVT
    NDRKVHPFISRVKISRNFNYGNEIKDNYRYEDGYYGNFLMTPETCKQCENPKCASACPVDAISLNERWGAWMVDESKCIG
    CGVCKRACPWGMPTVDPEDKKSTKCILCGACVANCITGSLQMIPWEKISEMALRKGYQFA

    >gi|158321172|ref|YP_001513679.1| dihydrolipoamide dehydrogenase [Alkaliphilus oremlandii OhILAs]
    MEKDIVIIGGGPGGYVAAIRGAQLGGKVTLIEENALGGTCLNVGCIPTKALCKNAEVISTLKNIEEFGIKGIENYSIDVE
    KIQERKQNVIDQLVGGIHTVLSAYGVEILRGRGTILNKNLVKATLVTGEEREIPAKNIIIATGAKPTLPPIPGIHLNGVM
    TSNELLSFKEIPKRLAIIGGGVIGIEFAGIFNALGSEVTVFEFAPSILIKLDKDISKRLTTSLKKDGIKINTSTGVEEIK
    ESNGSLVIVAKDKKGSIEVEVDQVLVSVGRTPVIEGLNLEGIGIELDRKRIQVNDRFETNVKGVYAIGDVNGGMMLAHEA
    SHEGKSVAEIIMDAPVSEDRGVVPSCIFISPEISTVGITEEEAKEQGIDYKTSKFMFGANGKALSMGEPQGFVKVISTGE
    NNRIIGVHIMGPHAADLIHEGALAIRNQLTADDIASTIHAHPTLGEAFVEAVMGLTNEAIHMVPSKR

    >gi|158321187|ref|YP_001513694.1| heavy metal translocating P-type ATPase [Alkaliphilus oremlandii OhILAs]
    MSSEIKDGLRREFILEGLHCANCASKIETRVNELEEVQFAHVNFVTKTLVIEANSLEKIEDIIHKMKDIVKKLEPDVLVK
    EKSKARKNIHRNHSSHGQCCDHDHDHSEGHSHSHKEEPGHRVDNHSHGHDHDHGHSHGNGNHKTQYLRLGIGALLFAMAA
    IFKVSNTMEFILFFASYILIGGEVVLRAAKNILRGQVFDENFLMAIATIGAFAIGEFSEGVAVMLFYQIGELFQDIAVNR
    SRKSIAELMDIRPDYANLKIGNGEKKVSPEEVQVGDYIIVKPGEKIPLDGVVIEGVTMMDTSALTGESVPREIQKGSNVL
    SGFINKNGVVVIEVTKSFEDSTVAKILDLVENASGKKAPTENFITKFARYYTPIVVYAALGLALIPPLFVEGATFSEWIY
    RALIFLVVSCPCALVISIPLGFFGGIGGASKNGILIKGGNYLEALNNVETVIFDKTGTLTKGVFKVTEIQPNNISKEELL
    EFAAFAESYSNHPIAVSILNEYGKTINKEEIESYEEISGHGIRVKVKGKVILAGNARLMESFNIPYHPAEAIGTIVYMAV
    DGSFAGHIIISDEIKKDAKEAIKVLKNIGVKKTVMLTGDNKLVGTRVGSELGLDEVYAELLPDQKVEKLEMLDRQKSEKG
    KLVFVGDGINDAPVLARADIGVAMGGLGSDAAIEAADVVLMTDEPMKLVSAIKIAKRTRRIVWQNIAFAFIVKAIVLVLG
    AGGLATMWEAVFADVGVALIAILNSMRVLNVKDL

    >gi|158321404|ref|YP_001513911.1| hypothetical protein Clos_2383 [Alkaliphilus oremlandii OhILAs]
    MEKKENIEMGWNLEHSYATLPKIFFANAKPASAPLPKLVVFNHKLAEALGFNVREIENESLAHLFAGNRLPEGAAPIAQA
    YAGHQFGHFTMLGDGRAVLLGEQMTPLGERLDIQLKGAGRTKYSRGGDGRAVLGPMLREYIISEAMHGLGIPTTRSLAVV
    TTGESVVRERFLQGAVLARVASSHIRVGTFQYAATWGKEQDLKALADYTIKRHFSNENIHGNPYAHLLDEVIKRQAMLIA
    QWQLVGFIHGVMNTDNMAISGETIDYGPCAFMDVYHPSTVFSSIDVHGRYAYGNQPKIALWNLIKFAETLLPLLHENQEQ
    AVEVAQNSISRFNALYEKNWADGMRRKLGLFSKEENDEHLIHELLRIMEKYSADYTNTFIALTFDNMKDTAMFESEEFAQ
    WHTLWKARLEGQKESKEDAHGLMRNNNPTVIPRNHRVEEALDAAENNRDYSKMENLLKVLSSPYEYSKEHEAYAVLPPPS
    AQPYRTF
    CGT

    >gi|158321443|ref|YP_001513950.1| glutaredoxin 3 [Alkaliphilus oremlandii OhILAs]
    MKNITIYTKNYCPYCKKAVSLLSSKGVDFKEVDVTHDSKAFEDVMAKTGWDTVPQVFVDEEFLGGCDDIHALDRQGILDK
    KLGLK

    >gi|158321736|ref|YP_001514243.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Alkaliphilus oremlandii OhILAs]
    MRKKNITLIVLILIFITATYYMFFVKDSKEGGQKNDVVMENNFEEEKSKEKKETDSKVKAPIAIGNEVPNFTLKNLDGKE
    ISLEDYRGKKVLINFWGTW
    CVFCDIEMPDIQKLDKENEDIVVLAVNVMEGKETVKKYITDGGYEFEVALDEKGIVARTYL
    VSGYPTSYFVDEEGILVQMVPGMMTYDQMNKVVEHMGNK

    >gi|158321837|ref|YP_001514344.1| hypothetical protein Clos_2817 [Alkaliphilus oremlandii OhILAs]
    MVIKILGSGCKNCTVLKENTEMALKEAGIEAEVLKVEDFKEIMTYGVLSTPALVIDEKVVSYGKVLKPKDILKFLNK