Acholeplasma laidlawii PG 8A uid58901

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|162446926|ref|YP_001620058.1| OsmC-like protein [Acholeplasma laidlawii PG-8A]
    MKGCVFMDDLKQIYETVITNMEGTKGFATADNGHAFGLASVLKADTEHTNPEQLIGAAWATCLNAAIISVIRSKKLTNRS
    RVDVKVKLWLHPIERYSFTLDATAAIEDLDPVTTKEIIDYAHRL
    CPVSKLIGDKPGVTLTIVPYQA

    >gi|162446991|ref|YP_001620123.1| thioredoxin reductase [Acholeplasma laidlawii PG-8A]
    MIDAIVIGVGPAGISTAINLRKLNHSVLVLGKDKGQLSNLDVIDNLYGHGPIAGEQLITKGIMQSRQLGIEVKNESVLNI
    EDFTDHFVVTTTHQTYEAKTVVLSTGKPRVQIKLEGYQAFKSKGIHL
    CTTCDGLFYKNKKVALIGNGAYLEHELETLENY
    TKDIMIFTNGSPYTHKKYPVIQDKLVAFLGEKRLTHIKTIKDTYQVNGVFLAIGHPMATELSLKLGVLMKDDNIVVDNFM
    QTNIKGLFAAGDCVGGMLQIPKAIHDGFMAAHGINQYLRGNNHGNNQYTY

    >gi|162446992|ref|YP_001620124.1| thioredoxin [Acholeplasma laidlawii PG-8A]
    MLFDLTKENFMKHVHETSGYVLIEFYGPTCKSCQSLLNILEDISDDYYGKIKVFKINCETESELADAYDIFSLPTMILFE
    HGNPIKELAGLHSYQDIESWLSI

    >gi|162447212|ref|YP_001620344.1| peroxiredoxin family protein [Acholeplasma laidlawii PG-8A]
    MKTMKNKPITVLGEPLQIGDKALDFIAVDNNLNEVSFFANFKKDYTLISAVPSLDTSVCDIQTRTINERLSSYKNLDFIT
    ISNDLPFAQKRWCGSNGLEITTLSDHKLLDFGMKYGALIKELRLLARSIFVLDHQRKVVYVEYLDEMSNHPNYDKLFKFL
    DTVL

    >gi|162447294|ref|YP_001620426.1| hypothetical protein ACL_0429 [Acholeplasma laidlawii PG-8A]
    MKKTTIQLETLTCPSCLQKINNAVKGLDGVNKDSVNVMLIQVKLN

    >gi|162447514|ref|YP_001620646.1| methionine-R-sulfoxide reductase B [Acholeplasma laidlawii PG-8A]
    MKKLTPIQKKVALENGTEPPFDNAYWNNFDEGIYVDVMDGTPLFTSLDKFDAMCGWPSFTKPIDNKIVIEKIDMSYGMFR
    TEVRTKNSNIHLGHVFDDGPEDEGGLRY
    CMNSASMRFIPLEDLEKEGYGQYKSLFDK

    >gi|162447530|ref|YP_001620662.1| glutathione peroxidase [Acholeplasma laidlawii PG-8A]
    MSLYDIEVTRADGSKEMMSKYQGKVLLIVNTATKCGYTKQYEGLQEIYDNYKDKGFEILDFPCNQFLAQAPGSIKKINEF
    CQINFGTTFTLFDKVKVNSKNAHPLYKYLKDNGPEEVVVSHDALVPSGKPKDKISWNFTKFLISKEGEILYRFSPKVTPE
    ELLPYLQKTL

    >gi|162447591|ref|YP_001620723.1| DsbA family oxidoreductase [Acholeplasma laidlawii PG-8A]
    MKIEVWSDFSCPFCYIGKTIFEQALNNFKDKDKIEVIYKAYQLSPDAPFETTEDSYTIFSRMKGVSLNQTKQMFMQTVER
    AKQVGLVYDYDNMKMTNTFKAHRLAKWARTFGKESVLSTKLFDAYFTKGLNIHDDKVLLDIVNTLGLDVHEAKVVLESNQ
    FHDEVAKEIEEAQSIGVRGVPFFVLDRKYAVSGAQPIEMFNQAIEQAYKEANPFQTIGSDDDICGPDGCAI

    >gi|162447613|ref|YP_001620745.1| rhodanese-like domain-containing protein [Acholeplasma laidlawii PG-8A]
    MYQTIMAQELEMLVRKGQVKVIDVREKSEMSMGYIKDMIHMPLSEFGNHLQKINKKDHYYVVCWSGSRSQVASNFLAQQG
    FKITNVLGGMSAYNGDVEYEM

    >gi|162447614|ref|YP_001620746.1| NAD(FAD)-dependent dehydrogenase [Acholeplasma laidlawii PG-8A]
    MKKIVVIGGVAGGMSFATRYRRLNQADEITIFEKGPFVSFANCGLPYYISGEIDSRDKLLVAKDTMLIDRFNLIIKQNHE
    VVKIEPKKKQVIVKNNGVESAYPYDKLVISTGAKPIIPQVKGMDTIPYFTLRNIPDLDYIMDFIHTNNPKKVAIIGAGFI
    GLEVAENLKKLGLHVSIIERANQVLTPLDYEMSQFARLELEKQGIDVYTSKDLLEIEDNKLIFDDLKLDADFIISSIGVV
    PESNLAVEAGIKVGMRNGIKVDEYFETSIKDIYAVGDAIIVKNFITNEDTLIPLASPANRQGRQLADILNGLDVKYQGTL
    GTSIVRLFDQTFASTGLNEKQLGNRAYEVIHLLANDHAGYYPGATSINLKVIFDPKTQKILGAQAVGKKGVDKRIDIIAT
    AIKSGLKVTELQELEFTYAPPFGSAKDIVNLAGYVSQNVILGLSKTVQWHQVDALIEEGAFFVDVRNTSEVRSLGKIKGA
    LNIPIDDLRSRLDEIPKDKKIVLY
    CQSGTRSYNAEQILRPLGYDCYNLDGSYSIYSKTQKEVK

    >gi|162447615|ref|YP_001620747.1| rhodanese-like domain-containing protein [Acholeplasma laidlawii PG-8A]
    MFFFKSNSVSWRDIKDADIVIDVREPYEFQPFHHKGAKNIPIGQISKYKTDKKVFVTCQSGMRSRMAVRILKKNGVDAVN
    IKGGMLKYYTRG

    >gi|162447616|ref|YP_001620748.1| hypothetical protein ACL_0756 [Acholeplasma laidlawii PG-8A]
    MEEIKMKIQALGGCCKKSMQNYQNTMDAAKECGIEESVEQISDTNEILKLGVMATPGLVIDGKVVSSGKLLSVGQIVELI
    NKHKA

    >gi|162447639|ref|YP_001620771.1| mercuric reductase [Acholeplasma laidlawii PG-8A]
    MKKLKMKIQGMTCKGCEGHIVEALEKIGAINVKASFHNGEAIFELPKDTDVELSKIAINNIKYQAGMIEEVSFNKNDSED
    KIYDLIIIGSGAAAFSAAIKAIEYGATVAIVERGEVGGT
    CVNVGCIPSKTLLRAGEINQAAKSNPFIGLKTNAQKVDLAT
    LVKQKDELVNELRSQKYINLIDEYGIDLVKGEARFINKTTIEVNDNRYIAKNYLIATGASSYIPKIHGLEFVDYLTSTTL
    LDLKETPRRLTVIGSGYIGLELGQLFHNLGSKVTIIQRGKQLLKDYDPEISDTVEKSLIEQGIELIKGVAYERIEQIGDI
    KKVYITVDGKNEIIESEQLLIATGRKPNTDTLNLSAADVNVGESNEIIIDDYGRTSNNKIYAAGDVTLGPQFVYVAAYEG
    GIVADNAIGGLNKKIDLSTVPAVTFTNPAIATVGLTEKEAKNIGYEVKTSVINLNLVPRAIVNRETTGIFKLVADTRTHR
    ILGAHIVSENAGDVIYAALLAVKHGLTIENLIDSLAPYLTMAEGLKLAALAFDKDVSKLSCCAG

    >gi|162447640|ref|YP_001620772.1| P-type ATPase, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter [Acholeplasma laidlawii PG-8A]
    MKHENLSVKGMTCASCVASVEKATAKLDGITNVNVNLTTEKLTFDYDMDKVSIEDVKKAVKAVGYEVLTETETADEHQLR
    KEQENITYF

    >gi|162447671|ref|YP_001620803.1| thioredoxin [Acholeplasma laidlawii PG-8A]
    MQQYKGEDFKGLVSKDGLVLVDFFATWCGPCKMLMPVLEQISTENVGAQLIKLDIDEYRKEAIDNGIRAVPTLVLFKDGK
    EVSRASGYQPREKILSWIEEHK

    >gi|162447680|ref|YP_001620812.1| methionine sulfoxide reductase A [Acholeplasma laidlawii PG-8A]
    MKTLILAGGCFWGVDAYFRQLKGVVDTKSGYANGNKENPTYTEVCNGVATHAEAVKITYDPKGISLDQLLEHFFRIVEPT
    SLNRQGNDVGIQYRSGIYYEDLETKATADAYIVKEQQKYKEKIVVQVEPLTQFFLAEDYHQDYLEKNPTGYCHIDLGLAK
    ADEVK

    >gi|162447822|ref|YP_001620954.1| Na+-transporting NADH:ubiquinone oxidoreductase subunit D [Acholeplasma laidlawii PG-8A]
    MENNQSILPKPSRWLRLQYKKWFLILKNGISEENPIIVSVLGICSALAVTNRVENAIVMGIGVTFVIMASSMMVSMMRNL
    IPSKVRMVAFMVIISMFTIVVQMFLQAFLPVVAANLGAYTGLIITN
    CIVMGRAEAFAIKNPVKYTIIDGFANGMGYTLVL
    IAIAAVREPLAFGTFLGMSIPGFDNWINWNVMALAPGGFFVLTLLAWLVRTLTKKYEEA

    >gi|162447823|ref|YP_001620955.1| Na+-transporting NADH:ubiquinone oxidoreductase subunit E [Acholeplasma laidlawii PG-8A]
    MELIELFLASILSNNIALIFILGMCSLIAVSTSIKNSVNMGVAVIFVVTITAIINWPIYELLKATGTEQLALLVFIIVIA
    AFVQFLEMFLAKYFPKIYESFGIFLPLITVN
    CIVLSVSLFFQQRNYDFLQTTVFAFGSSVGWTFAMILLAGVRQKMYRVS
    NLPKGLRGRAIAFLILGILALAFIGFTGIGRVSF

    >gi|162447889|ref|YP_001621021.1| CoA-disulfide reductase [Acholeplasma laidlawii PG-8A]
    MKVVVIGCTHAGTAAVKSMLNHNKDIEVNVYERNDNVSFLSCGIALYVGGIVKDVNGLFYSSPEELRQLGANVFMEYNVE
    AIDYDKKTVTVKNLTTNEISVDSFDKLVLSTGSWPIIPRIPGISSSNVLLSKNFNQANEIIEQAKHAQKIVVVGAGYIGV
    ELAEAFELLGKEVVLIDGEERIMPKYLDEEFTYHAQKAFTDNGVKLALGEKVDSFITSNDLVTHIKTNKATYETDLVIMC
    IGFKPNDTLYKGILETTPNGALITNEYMQTSNPDVFACGDNANIIYNPTDEVRYIPLATNAVRMGTLVGLNIVDQHVPYV
    GTQGTSGIKIYDLNISSTGLTEGVAQQAGIEYETITIHDHNRPEFMPSYDDVLLKLVYEKHTKRLLGGQILSKYDLTAQM
    NILSLAIQNKMTIEQLAFADFFFQPHYSKPWNLLNTAALAALNKN

    >gi|162447955|ref|YP_001621087.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Acholeplasma laidlawii PG-8A]
    MLYYDFISYGDWTFTIKVSKNGLKSIDIYNHQDLSNLTLNKEITAPYIQILDNYFKGIPIPKDIKLDLEGSSFEKLVWQQ
    LIEIPYGKTASYKDIAVRISNPRAYQAVGNAVGSNPLLIVIP
    CHRVIKSDGRLGGFSSDIQLKIDLLHKEGGKYL

    >gi|162447984|ref|YP_001621116.1| cation transport ATPase [Acholeplasma laidlawii PG-8A]
    MKTTVYIDGMHCKNCMAKVEKSLSTVEGVQSAKVNLDKGFAVLKTKDPVNHDVILDTIHTLGYEVKEIK

    >gi|162447985|ref|YP_001621117.1| cation transport ATPase [Acholeplasma laidlawii PG-8A]
    MKHENLSVKGMTCASCVASVEKATAKLEGITNVNVNLTTEKLTFDYDMDKVSIEDVKKAVKAVGYEVLTETETADEHQLR
    KEQEIKNLWTRFLVSAIFTLPLLYIAMGPMIGLWLPDFMHPDLSPLNFTIIQIILTTPVMIIGYPFFKIGFKTLFKLSPN
    MDSLIAIGTSAAYIYGVYALIMIINGNHHFVHDLYFESAAVILTLITLGKYLESISIGKTSAAIKKLIGLAPKEATILRN
    GIEVRVAIEDVVVGDIIVVKPGDKLPVDGVVTFGHTSIDESMLTGESIPVEKQIGDLVVGASINKFGTIHYKATKIGKDT
    ALAQIIKLVEDAQSSKAPIAKLADIISGYFVPVVIVLAIISGLLWYIFGGQDLNFSMTIFIAVLVIACPCALGLATPTAI
    MIGTGKGAEYGVLIKGGASLETLHKVDTVILDKTGTITQGKPVVTDIITTSEIDGLNLLRLAASAEKGSEHPLGEAIVLD
    ATSKGIELTTPSKFHAIPGHGIEVVIEDQVILLGNLKLMKEQAIDLSELFDQSENLANQGKTPMFVAINQKLAGMIAVAD
    TIKPTSKQAIDKLHQMGVEVVMITGDNKLTADAIAKQIGIDLVLSEVLPEDKANEVEKLQNSGKKVAMVGDGINDAPALV
    KADVGIAIGSGTDVAIESADIVLVKNDLLDVANAIHLSQKTIKNIKENLFWAFGYNVLGIPIAMGVLHLFGGPLLNPMFA
    AAAMSLSSVSVLANALRLKRFKPIVKKG

    >gi|162448023|ref|YP_001621155.1| arsenate reductase [Acholeplasma laidlawii PG-8A]
    MITIYTTPSCSSCRKAKKWLDEHKVAYEEKNLFNHRIDDTDIEMMLHHAENGFDDIISTRSKVFKEQELEVEDMSVSELK
    NFIINHPSVLKRPIIVDAKRMQVGYNDEEIRVFIPKKLREMIMRENSEEDFTHYEDTLSRYFATIDTNETDKE

    >gi|162448046|ref|YP_001621178.1| glutaredoxin-like domain-containing protein [Acholeplasma laidlawii PG-8A]
    MKSLLTPDVAGQIKEVLKMMDNPIKVILFTSHDCETCEPTLQLLEEVSALNDKITFVERTLEDDKVEAEKYNVTLAPTFV
    ILDQNNNFRNFRFNGIPAGHEINSLISALIDSASTKPFFDEKTLARLSKIDKDVNIKVFVTLS
    CPHCPGAVSSAFRLAMT
    NPNITADAYEAQTFSDLSMKYNVSSVPKIIINDKYEFLGNQPIEAFLNEIEKI

    >gi|162448047|ref|YP_001621179.1| thioredoxin reductase [Acholeplasma laidlawii PG-8A]
    MFNFNLDTQLHNTFNTQLIYDFLVIGGGPSGLNASIYAHRLGMTTGIITYDIGGQLLNTNDVDNYLGLPNDTGSGLTEKF
    ISHVKQFEIPVLDKIYVDKITKDNNLFQIYLNNGDIIQSKTVLLSTGSTPKKLGIPGEDIFDAKGISY
    CAICDAPFYKDK
    HVVVAGGGNSAIESALDLAKWAKKVTVIQRSKFRADKILLENMYKNDKIDYMLETQILEVHGRNQVDSLTILDKKTNQTS
    NFKADGLFVAIGMKPNTKFIKDFVTLNDYHEVIVNSKQETNIPGLYAAGDMVDQPHKQIIIAAAEGAKAAIHANQYLKFK
    GE

    >gi|162448101|ref|YP_001621233.1| cation transporting ATPase, P-type [Acholeplasma laidlawii PG-8A]
    MSELTFEENIVCSIEGLDCANCAAKIEIQLNKTDGIEEARVDYLSGKLILSLSSLADKNEVLQKTQKIIDKIEPGVKIRE
    LSKAKNDDHDHDHEEGVSLHEMLKLIIGILIFVGVLFINKSSIFYLPMFIVSYLLIGGEVVFRAFRNILRGKVFDENFLM
    TIATIGAFTVGEYPEAVAVMLFYQVGELFQDIAVNRSRRSIKKLMSIRPDVAYVKKGNEVQEIKVEEVNVDDIIVIKPGE
    RVPLDGIIIDGDSSLDTKALTGESVPMNVTVGEQILSGCININGLLTVKVTKLASESTVAKVLELVENATSKKAPTENFI
    TKFARVYTPIVTLSAVLLAIIPPLIFQVGTFEEWLYRALIFLVISCPCALVVSIPLGFFGGIGAASKNGILVKGGNYLEA
    LNEIEIAVFDKTGTLTEGSFKVTQINPVIDISKDELLEKTAYVESFSNHPIALSVVKEYNKSIKQEIVSDIKEVSGHGIK
    AKVNSDEVLVGNARLMERENISFEASSALGSILYIAINKKYVGNIVVSDQIKKDSKEAIKLLKALGVKKTIMLTGDKKSV
    ATSVGKALGLDEIHAELLPEDKLNKVEELLNSKSKRGKLFFVGDGINDTPVLARADIGIAMGGLGADAAIDVADIVIMTD
    EPLKIVTAVKIARRTRKIVWQNIILALGIKAFFLVLGAFGIATMWEAVIADVGVSLIAILNAMRVLKK

    >gi|162448127|ref|YP_001621259.1| glutaredoxin-like protein NrdH, putative [Acholeplasma laidlawii PG-8A]
    MSVYLLTKNDCTQCAQLKMFLKFGLNNKYEPDITIVNKEDNQEMFDRLTAEYGILTLPAMIANGEALTRTQPSPVLTFLE
    KHVGKK

    >gi|162448148|ref|YP_001621280.1| dihydrolipoamide dehydrogenase [Acholeplasma laidlawii PG-8A]
    MSKEYEIIIVGGGPGGYVAAIKAAQYGAKVALVEKEVVGGICLNHGCIPTKTFLKSAKVFNTVKKSMDFGVSTSGEVGFD
    WSKIVSRKDGVVKQLTNGVAFLLKKNGVDVYNGFGDIKSANEVVVNGESLKTKNVIIATGSSAVVPPIPGVKEAYEKGIV
    VTSRELLNVKNYPKSIVIVGGGVIGVEFATVFNSFGSKVTIIEMMDGILPTMDDDIRVAYAKTLKRDGIEILTKAEVKKV
    DDHKVTYSLDGKETTIEGDLILMSVGTRANSKGLEHLGLEMDRANIKTNEYLQTNVPGVYAIGDVNGKFMLAHVAEHEGI
    TAVQHILKIGHAKMNYDQIPSAIYGFPEIAAIGLTEREAKARGLDYKVSKVPIAAIGKAVADGEKEGFVKLIVDKKYLEV
    LGAHIYAYNATELISEYAVAMTSEATAHEIAHAVHPHPTLSELTKEAAHGAIDKAIHI

    >gi|162448179|ref|YP_001621311.1| thioredoxin reductase [Acholeplasma laidlawii PG-8A]
    MIYDVLIIGSGPAGMTAAIYAKRANLKVMMFEKGAPGGQIVDTAEVENYPGFTKAKGYELATSMFEHVLNLGVEVKFEEV
    LEIKDLGTTKQIVTAHETFESKAILITTGVVPRRLDIPGEMNYTAQGISW
    CAICDGPLYKDKKVVVIGGGNSAVEEALFL
    SNIASHVTVVQNLPYLTADKKAQDLLMHAKNVDFIFNAETKEFVGDDNLKGVKVSVAGKEQVIDTDGVFEYVGLIPATSF
    LKDLNILNEFGYILTGEDFQTPCKGIFAAGDVTVKKIRQIVTAVSDGAIATQNIIKYIENL

    >gi|162448255|ref|YP_001621387.1| glutathione peroxidase [Acholeplasma laidlawii PG-8A]
    MSIYQIRVEDMHNNIVTLDSYKGKVLLIVNTATTCFFTPQYDGLQKLYETYKNQGFEILDFPSNQFKDAKDSVETIDEFC
    VKNYKTDFRRFTKIEVNGPDESILYTYLKRHQKGLFNKKIKWNFTKFLVDQNGRVIKRYAPLVKPEKIAKDIEKLLNKDK


    >gi|162447976|ref|YP_001621108.1| hypothetical protein ACL_1123 [Acholeplasma laidlawii PG-8A]
    MQKNYRVLLYYKYTAIENPEKFKDEHLAYCKSQDLLGRILVSSEGINGTLSGTFEQTENYMDYLKSLQGFEDIFFKIDEV
    DAHAFSKMHVRVKKELVNLSLEDDVNPLEITGKYLEPIEFYQKLQDPNTVVIDARNDYEFDLGHFRGAIKPEIKNFRDLP
    DWIRENKDQFKDKEILTY
    CTGGVRCEKFSGWLIKEGFNVAGQLHGGIHNYGTSKDTEGKLWDGKMYVFDERIAVDINKHE
    HVVVGRDYFTNEPCERYINCGNPECNKQILASEASEEKYLGSCSHACRIHPNNRYVKKHNLTTDFVLQHIASNLETQI